254780821

254780821

FolC bifunctional protein

GeneID in NCBI database:8209827Locus tag:CLIBASIA_03560
Protein GI in NCBI database:254780821Protein Accession:YP_003065234.1
Gene range:-(434017, 435306)Protein Length:429aa
Gene description:FolC bifunctional protein
COG prediction:[H] Folylpolyglutamate synthase
KEGG prediction:folC; FolC bifunctional protein; K11754 dihydrofolate synthase / folylpolyglutamate synthase [EC:6.3.2.12 6.3.2.17]
SEED prediction:Dihydrofolate synthase (EC 6.3.2.12) / Folylpolyglutamate synthase (EC 6.3.2.17)
Pathway involved in KEGG:Folate biosynthesis [PATH:las00790]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN
cccccHHHHHHHHHHcccHHHHcccEEEEEccccHHHHHHHHHHHHHHccccEEEEcccccccccccEEccccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEccccccEEHHHHcccccEEEEccccHHHHHHHcccHHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHHHcccEEEEEEEEEEEEcccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccEEEEEEccccccccccccEEEEcccccHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHccEEEEEEEcccccccccccccHHHHHHHHHHccccEEEEccHHHHHHHHHHHHHcccccEEEEEccHHHHHHHHHHcccccc
cccccHHHHHHHHHHHcccccccccEEEEEccccccHHHHHHHHHHHHcccEEEEEccccEEEEccEEEEcccccccccccHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHccccEEEEEEccccccccccccccccEEEEEEccccHHHHHcccHHHHHHHHHccccccccEEEcccccHHHHHHHHHHHHHccccEEEEccEEEEEEEcccEEEEcccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccHHEEcccccHHHccccccEEEEEccccHHHHHHHHHHHHHccccccccEEEEEEEcccccHHHHHHHHHcHHHEEEEEccccccccccHHcccHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccEEEEEccHHHHHHHHHHcccccc
MAADSLLKMGYLLedlgrpqdrlppvihiggtngkgsvASFSQRLLEtsglsvhvhtsphlirwNERFrlgvkggrgrlvedVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVglggsldatnIIEKVAVSVITSISLDHEKILGNTVSaiakdksgiikpgcpvvighQVYDEVREILVSKAekmgcpynvygddfyafEKNKCLVyqdkisqtnLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGrlqkitegpllnklpdhsevwidgghnpnagLVVSKEISklkgssnkpfYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLIcrgrerqsisitPKVLMQEAKKLGFQAMACSSMIEALSRVRKineelpppliLIAGSLYLAGEALRENGVRIN
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSvhvhtsphlirwnerfrlgvkggrgrlvedvelldvfrrvrrvksaqnltifELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAiakdksgiikpgcpvVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISklkgssnkpfYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGrerqsisitpkVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNErfrlgvkggrgrlvEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN
*AADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRE***ISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGV***
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN
**ADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENG****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN
MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEALRENGVRIN

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target429 FolC bifunctional protein [Candidatus Liberibacter asia
254781102497 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 0.021
>gi|254781102|ref|YP_003065515.1| UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 497 Back     alignment
 Score = 32.0 bits (71), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 14/27 (51%), Positives = 21/27 (77%)

Query: 26  VIHIGGTNGKGSVASFSQRLLETSGLS 52
           ++ + GT+GK SVASF Q++ + SGLS
Sbjct: 117 ILAVTGTSGKSSVASFVQQICQRSGLS 143

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target429 FolC bifunctional protein [Candidatus Liberibacter asia
315122044429 FolC bifunctional protein [Candidatus Liberibacter sola 1 1e-167
116249790450 FolC bifunctional protein [Includes: folylpolyglutamate 1 1e-106
325291474459 Folylpolyglutamate synthase [Agrobacterium sp. H13-3] L 1 1e-106
15887380447 folylpolyglutamate synthase [Agrobacterium tumefaciens 1 1e-106
222084225431 folylpolyglutamate synthase/dihydrofolate syntase bifun 1 1e-105
153008150430 FolC bifunctional protein [Ochrobactrum anthropi ATCC 4 1 1e-105
327191170450 folC [Rhizobium etli CNPAF512] Length = 450 1 1e-105
222147036470 folylpolyglutamate synthase [Agrobacterium vitis S4] Le 1 1e-105
190889664450 folC [Rhizobium etli CIAT 652] Length = 450 1 1e-104
227823891447 FolC bifunctional protein [Sinorhizobium fredii NGR234] 1 1e-104
>gi|315122044|ref|YP_004062533.1| FolC bifunctional protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 429 Back     alignment and organism information
 Score =  593 bits (1530), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 295/426 (69%), Positives = 348/426 (81%)

Query: 1   MAADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPH 60
           M   SL ++  LLEDLG+PQ+ +PPVIHIGGTNGKGSVASF QRLLETSGLSVHVHTSPH
Sbjct: 1   MTFFSLQRIKCLLEDLGKPQNNIPPVIHIGGTNGKGSVASFIQRLLETSGLSVHVHTSPH 60

Query: 61  LIRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRVKSAQNLTIFELSIATALVLFSKYPA 120
           LIRWNERFRLGVKGG G+LVED  +LD FRRV +  + +++++FE S+ATA VLF++YPA
Sbjct: 61  LIRWNERFRLGVKGGGGKLVEDAIVLDTFRRVIQTNNDRDISVFEASVATAFVLFAEYPA 120

Query: 121 DCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGCPVV 180
           D AIIEVGLGG  DATNIIEK AVSVITSISLDHEK LG TV  IAK+K+ I+K GCPVV
Sbjct: 121 DVAIIEVGLGGRFDATNIIEKTAVSVITSISLDHEKYLGKTVDLIAKEKAAIMKSGCPVV 180

Query: 181 IGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTVLGLVGEH 240
           IGHQ YDE R++LVSKA+KMGC Y VYGDDFYAF KN+ LVYQDK SQ N +   L+GEH
Sbjct: 181 IGHQSYDEARDVLVSKAQKMGCTYRVYGDDFYAFRKNRHLVYQDKSSQINCSTPNLLGEH 240

Query: 241 QYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSEVWIDGG 300
           QY NAATAICAVQ AGF LEK+C+N ALQSV W GRLQKIT+G LLN+LP++SE+WIDGG
Sbjct: 241 QYFNAATAICAVQTAGFKLEKDCVNIALQSVNWLGRLQKITQGFLLNELPNYSELWIDGG 300

Query: 301 HNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGR 360
           HNP+AGLV+++EISKLK    K FYLVIGM+  K Y  YL+AFV LSPIVL+V ++C+G 
Sbjct: 301 HNPDAGLVIAREISKLKELDTKTFYLVIGMLADKDYEGYLKAFVGLSPIVLTVPIMCKGH 360

Query: 361 ERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIAGSLYLAGEA 420
           E    SI P++LMQ AKKLG  A ACSS+ E+L +V+  N+ LPP ++LI GSLYLAGEA
Sbjct: 361 ESIPESINPQILMQGAKKLGLTAFACSSLTESLVKVKNTNKNLPPAIVLIGGSLYLAGEA 420

Query: 421 LRENGV 426
           L +NG 
Sbjct: 421 LYKNGT 426


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116249790|ref|YP_765628.1| FolC bifunctional protein [Includes: folylpolyglutamate synthase (Folylpoly-gamma-glutamate synthetase) (FPGS); dihydrofolate synthase] [Rhizobium leguminosarum bv. viciae 3841] Length = 450 Back     alignment and organism information
>gi|325291474|ref|YP_004277338.1| Folylpolyglutamate synthase [Agrobacterium sp. H13-3] Length = 459 Back     alignment and organism information
>gi|15887380|ref|NP_353061.1| folylpolyglutamate synthase [Agrobacterium tumefaciens str. C58] Length = 447 Back     alignment and organism information
>gi|222084225|ref|YP_002542751.1| folylpolyglutamate synthase/dihydrofolate syntase bifunctional protein [Agrobacterium radiobacter K84] Length = 431 Back     alignment and organism information
>gi|153008150|ref|YP_001369365.1| FolC bifunctional protein [Ochrobactrum anthropi ATCC 49188] Length = 430 Back     alignment and organism information
>gi|327191170|gb|EGE58213.1| folC [Rhizobium etli CNPAF512] Length = 450 Back     alignment and organism information
>gi|222147036|ref|YP_002547993.1| folylpolyglutamate synthase [Agrobacterium vitis S4] Length = 470 Back     alignment and organism information
>gi|190889664|ref|YP_001976206.1| folC [Rhizobium etli CIAT 652] Length = 450 Back     alignment and organism information
>gi|227823891|ref|YP_002827864.1| FolC bifunctional protein [Sinorhizobium fredii NGR234] Length = 447 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target429 FolC bifunctional protein [Candidatus Liberibacter asia
TIGR01499397 TIGR01499, folC, folylpolyglutamate synthase/dihydrofol 1e-83
KOG2525496 KOG2525, KOG2525, KOG2525, Folylpolyglutamate synthase 3e-49
PLN02913510 PLN02913, PLN02913, dihydrofolate synthetase 1e-46
COG0769475 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase 2e-06
COG0285427 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme me 7e-95
PLN02881530 PLN02881, PLN02881, tetrahydrofolylpolyglutamate syntha 4e-42
PRK10846416 PRK10846, PRK10846, bifunctional folylpolyglutamate syn 4e-36
COG0770451 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthas 5e-07
TIGR01143417 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-ala 5e-04
PRK11929958 PRK11929, PRK11929, putative bifunctional UDP-N-acetylm 0.001
pfam08245188 pfam08245, Mur_ligase_M, Mur ligase middle domain 0.003
>gnl|CDD|162392 TIGR01499, folC, folylpolyglutamate synthase/dihydrofolate synthase Back     alignment and domain information
>gnl|CDD|37736 KOG2525, KOG2525, KOG2525, Folylpolyglutamate synthase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|178501 PLN02913, PLN02913, dihydrofolate synthetase Back     alignment and domain information
>gnl|CDD|31112 COG0769, MurE, UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|30633 COG0285, FolC, Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|178469 PLN02881, PLN02881, tetrahydrofolylpolyglutamate synthase Back     alignment and domain information
>gnl|CDD|182774 PRK10846, PRK10846, bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional Back     alignment and domain information
>gnl|CDD|31113 COG0770, MurF, UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162224 TIGR01143, murF, UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase Back     alignment and domain information
>gnl|CDD|183385 PRK11929, PRK11929, putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2, 6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D- alanine ligase; Provisional Back     alignment and domain information
>gnl|CDD|149357 pfam08245, Mur_ligase_M, Mur ligase middle domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 429 FolC bifunctional protein [Candidatus Liberibacter asia
). A crystal structure of the MgATP complex of the enzyme from Lactobacillus casei reveals that folylpolyglutamate synthetase is a modular protein consisting of two domains, one with a typical mononucleotide-binding fold and the other strikingly similar to the folate-binding enzyme dihydrofolate reductase. The active site of the enzyme is located in a large interdomain cleft adjacent to an ATP-binding P-loop motif. Opposite this site, in the C domain, a cavity likely to be the folate binding site has been identified, and inspection of this cavity and the surrounding protein structure suggests that the glutamate tail of the substrate may project into the active site. A further feature of the structure is a well defined Omega loop, which contributes both to the active site and to interdomain interactions .; GO: 0004326 tetrahydrofolylpolyglutamate synthase activity, 0005524 ATP binding, 0009396 folic acid and derivative biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01499">TIGR01499460 folC FolC bifunctional protein; InterPro: IPR001645 Fol 100.0
COG0285427 FolC Folylpolyglutamate synthase [Coenzyme metabolism] 100.0
PRK10846416 bifunctional folylpolyglutamate synthase/ dihydrofolate 100.0
KOG2525496 consensus 100.0
TIGR01085494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 100.0
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
PRK00139481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 100.0
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 100.0
COG0769475 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell enve 100.0
TIGR02068876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 100.0
PRK10773452 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK11929953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 100.0
TIGR01143462 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 100.0
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK02006501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK11930 824 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D 100.0
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
TIGR01082491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 100.0
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK04690468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0770451 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell en 100.0
COG0773459 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope 100.0
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 100.0
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 100.0
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 100.0
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 99.98
TIGR01081459 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso 99.96
pfam08245188 Mur_ligase_M Mur ligase middle domain. 99.96
pfam0287587 Mur_ligase_C Mur ligase family, glutamate ligase domain 99.43
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.03
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.96
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 97.47
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.37
cd03114148 ArgK-like The function of this protein family is unkown 96.93
TIGR03172232 probable selenium-dependent hydroxylase accessory prote 97.39
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 96.97
PRK13869405 plasmid-partitioning protein RepA; Provisional 96.77
PHA02519387 plasmid partition protein SopA; Reviewed 96.31
PRK05439312 pantothenate kinase; Provisional 95.9
cd02040270 NifH NifH gene encodes component II (iron protein) of n 95.68
PRK00090223 bioD dithiobiotin synthetase; Reviewed 95.17
PRK00771433 signal recognition particle protein Srp54; Provisional 94.93
PRK13705388 plasmid-partitioning protein SopA; Provisional 94.91
PRK06761281 hypothetical protein; Provisional 94.57
PRK10867453 signal recognition particle protein; Provisional 94.18
PRK11670369 putative ATPase; Provisional 94.14
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 94.04
COG2403449 Predicted GTPase [General function prediction only] 93.71
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 92.89
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 92.48
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 92.45
PRK09112352 DNA polymerase III subunit delta'; Validated 92.42
PRK07667190 uridine kinase; Provisional 91.9
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 91.86
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 91.75
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 91.6
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 91.59
CHL00175279 minD septum-site determining protein; Validated 91.5
PRK10818270 cell division inhibitor MinD; Provisional 91.35
COG4240300 Predicted kinase [General function prediction only] 91.34
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 91.33
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 91.25
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 91.18
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 91.17
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 90.87
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 90.77
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 90.76
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 90.68
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 90.51
PRK12374231 putative dithiobiotin synthetase; Provisional 90.32
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 90.24
PRK09270230 frcK putative fructose transport system kinase; Reviewe 90.06
KOG0780483 consensus 90.01
PRK10416499 cell division protein FtsY; Provisional 94.92
TIGR02082 1265 metH methionine synthase; InterPro: IPR011822 Vitamin B 93.74
PRK13896432 cobyrinic acid a,c-diamide synthase; Provisional 93.41
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 92.67
TIGR02533 495 type_II_gspE general secretory pathway protein E; Inter 92.55
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 91.7
PRK11519720 tyrosine kinase; Provisional 91.44
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 90.97
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 91.12
>TIGR01499 folC FolC bifunctional protein; InterPro: IPR001645 Folylpolyglutamate synthase 6 Back     alignment and domain information
>COG0285 FolC Folylpolyglutamate synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK10846 bifunctional folylpolyglutamate synthase/ dihydrofolate synthase; Provisional Back     alignment and domain information
>KOG2525 consensus Back     alignment and domain information
>TIGR01085 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterPro: IPR005761 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>PRK00139 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase; Provisional Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>COG0769 MurE UDP-N-acetylmuramyl tripeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02068 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011810 Cyanophycin is an insoluble storage polymer for carbon, nitrogen, and energy, found in most Cyanobacteria Back     alignment and domain information
>PRK10773 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; Reviewed Back     alignment and domain information
>PRK11929 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase/UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase; Provisional Back     alignment and domain information
>TIGR01143 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanine ligase; InterPro: IPR005863 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03803 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK02006 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03806 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK11930 putative bifunctional UDP-N-acetylmuramoyl-tripeptide:D-alanyl-D-alanine ligase/alanine racemase; Provisional Back     alignment and domain information
>PRK01390 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01082 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IPR005758 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01710 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04663 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK04690 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0770 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0773 MurC UDP-N-acetylmuramate-alanine ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK01368 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK00141 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK03815 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>TIGR01081 mpl UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-meso-diaminopimelate ligase; InterPro: IPR005757 The tripeptide L-ananyl-gamma-D-glutamyl-meso-diaminopimelic acid is efficiently re-cycled during the formation of bacterial cell wall murein Back     alignment and domain information
>pfam08245 Mur_ligase_M Mur ligase middle domain Back     alignment and domain information
>pfam02875 Mur_ligase_C Mur ligase family, glutamate ligase domain Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>PRK09435 arginine/ornithine transport system ATPase; Provisional Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>TIGR03172 probable selenium-dependent hydroxylase accessory protein YqeC Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PRK06761 hypothetical protein; Provisional Back     alignment and domain information
>PRK10867 signal recognition particle protein; Provisional Back     alignment and domain information
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>COG2403 Predicted GTPase [General function prediction only] Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>COG1663 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>PRK01906 tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein B; InterPro: IPR004435 The majority of molybdenum-containing enzymes utilise a molybdenum cofactor (MoCF or Moco) consisting of a Mo atom coordinated via a cisdithiolene moiety to molybdopterin (MPT) Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>PRK00313 lpxK tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional Back     alignment and domain information
>pfam02606 LpxK Tetraacyldisaccharide-1-P 4'-kinase Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>pfam03205 MobB Molybdopterin guanine dinucleotide synthesis protein B Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>KOG0780 consensus Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR02082 metH methionine synthase; InterPro: IPR011822 Vitamin B12 dependent methionine synthase 2 Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR02533 type_II_gspE general secretory pathway protein E; InterPro: IPR013369 GspE, the E protein of the type II secretion system, is also referred to as the main terminal branch of the general secretion pathway Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target429 FolC bifunctional protein [Candidatus Liberibacter asia
1o5z_A442 Crystal Structure Of Folylpolyglutamate Synthase (T 1e-48
1w78_A422 E.Coli Folc In Complex With Dhpp And Adp Length = 4 5e-46
3n2a_A437 Crystal Structure Of Bifunctional Folylpolyglutamat 9e-46
1fgs_A428 Folylpolyglutamate Synthetase From Lactobacillus Ca 4e-43
2gca_A428 Apo Form Of L. Casei Fpgs Length = 428 4e-43
1jbv_A428 Fpgs-Amppcp Complex Length = 428 4e-43
2gc5_A428 G51s Mutant Of L. Casei Fpgs Length = 428 3e-42
2gcb_A428 G51sS52T DOUBLE MUTANT OF L. CASEI FPGS Length = 42 5e-42
2gc6_A428 S73a Mutant Of L. Casei Fpgs Length = 428 7e-42
2vor_A487 Crystal Structures Of Mycobacterium Tuberculosis Fo 3e-36
2vos_A487 Mycobacterium Tuberculosis Folylpolyglutamate Synth 3e-30
2wtz_A535 Mure Ligase Of Mycobacterium Tuberculosis Length = 1e-09
1e8c_A498 Structure Of Mure The Udp-N-Acetylmuramyl Tripeptid 3e-08
>gi|39654293|pdb|1O5Z|A Chain A, Crystal Structure Of Folylpolyglutamate Synthase (Tm0166) From Thermotoga Maritima At 2.10 A Resolution Length = 442 Back     alignment and structure
 Score =  198 bits (504), Expect = 1e-48,   Method: Composition-based stats.
 Identities = 116/439 (26%), Positives = 186/439 (42%), Gaps = 43/439 (9%)

Query: 2   AADSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHL 61
               L ++  LL  LG P       IHIGGTNGKGSVA+    +L + G  V  + SPHL
Sbjct: 31  VKPGLERISMLLSKLGNPHLEY-KTIHIGGTNGKGSVANMVSNILVSQGYRVGSYYSPHL 89

Query: 62  IRWNERFRLGVKGGRGRLVEDVELLDVFRRVRRV------KSAQNLTIFELSIATALVLF 115
             + ER RL         + + +++ ++  +  +      +   + + FE+  A A + F
Sbjct: 90  STFRERIRLN-----EEYISEEDVVKIYETMEPILNELDKEEIFSPSFFEVVTAMAFLYF 144

Query: 116 SKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKP 175
           ++   D A++EVGLGG LDATN++     S I ++  DHEK LG T+  IA +KSGIIK 
Sbjct: 145 AEKNVDIAVLEVGLGGRLDATNVV-FPLCSTIVTVDRDHEKTLGYTIEQIAWEKSGIIKE 203

Query: 176 GCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEKNKCLVYQDKISQTNLTV-- 233
             P+V G +   E  +++   A K      V   DF    K+  L           T   
Sbjct: 204 RVPLVTGERKR-EALKVMEDVARKKSSRMYVIDKDFSVKVKSLKLHENRFDYCGENTFED 262

Query: 234 --LGLVGEHQYINAATAICAVQMAGFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPD 291
             L + G HQ  NA  A+  ++  G  L ++ I   L++ +  GR +            +
Sbjct: 263 LVLTMNGPHQIENAGVALKTLEATGLPLSEKAIREGLKNAKNLGRFEI--------LEKN 314

Query: 292 HSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVL 351
                +DG HNP+    + + +      + +P  LVIG+++ K     L  +  +   V+
Sbjct: 315 GKMYILDGAHNPHGAESLVRSL--KLYFNGEPLSLVIGILDDKNREDILRKYTGIFERVI 372

Query: 352 SVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLILIA 411
              +                L+  AKK           +EA+    +          ++ 
Sbjct: 373 VTRV------PSPRMKDMNSLVDMAKKFFKNVEVIEDPLEAIESTERAT--------VVT 418

Query: 412 GSLYLAGEALRENGV-RIN 429
           GSL+L G         +IN
Sbjct: 419 GSLFLVGYVREFLTTGKIN 437


>gi|61680167|pdb|1W78|A Chain A, E.Coli Folc In Complex With Dhpp And Adp Length = 422 Back     alignment and structure
>gi|299856869|pdb|3N2A|A Chain A, Crystal Structure Of Bifunctional Folylpolyglutamate SynthaseDIHYDROFOLATE SYNTHASE FROM YERSINIA PESTIS CO92 Length = 437 Back     alignment and structure
>gi|157831071|pdb|1FGS|A Chain A, Folylpolyglutamate Synthetase From Lactobacillus Casei Length = 428 Back     alignment and structure
gi|110590234|pdb|2GCA|A Chain A, Apo Form Of L. Casei Fpgs Length = 428 Back     alignment and structure
>gi|15988306|pdb|1JBV|A Chain A, Fpgs-Amppcp Complex Length = 428 Back     alignment and structure
>gi|110590230|pdb|2GC5|A Chain A, G51s Mutant Of L. Casei Fpgs Length = 428 Back     alignment and structure
>gi|110590235|pdb|2GCB|A Chain A, G51sS52T DOUBLE MUTANT OF L. CASEI FPGS Length = 428 Back     alignment and structure
>gi|110590231|pdb|2GC6|A Chain A, S73a Mutant Of L. Casei Fpgs Length = 428 Back     alignment and structure
gi|193506585|pdb|2VOR|A Chain A, Crystal Structures Of Mycobacterium Tuberculosis Folylpolyglutamate Synthase Complexed With Adp And Amppcp Length = 487 Back     alignment and structure
>gi|193506586|pdb|2VOS|A Chain A, Mycobacterium Tuberculosis Folylpolyglutamate Synthase Complexed With Adp Length = 487 Back     alignment and structure
>gi|281306936|pdb|2WTZ|A Chain A, Mure Ligase Of Mycobacterium Tuberculosis Length = 535 Back     alignment and structure
>gi|15988379|pdb|1E8C|A Chain A, Structure Of Mure The Udp-N-Acetylmuramyl Tripeptide Synthetase From E. Coli Length = 498 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target429 FolC bifunctional protein [Candidatus Liberibacter asia
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 2e-56
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthase; TM0 1e-55
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 1e-54
2vos_A487 Folylpolyglutamate synthase protein FOLC; ligase, confo 3e-40
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate synthase 1e-33
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopim 6e-29
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diamino 3e-18
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalac 9e-08
1j6u_A469 UDP-N-acetylmuramate-alanine ligase MURC; structural ge 1e-06
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 3e-06
1gg4_A452 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimel 7e-05
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Length = 428 Back     alignment and structure
 Score =  215 bits (547), Expect = 2e-56
 Identities = 128/434 (29%), Positives = 210/434 (48%), Gaps = 49/434 (11%)

Query: 5   SLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRW 64
              ++  LL  LG PQ +    IH+ GTNGKGS A+    +LE SGL+V ++TSP ++R+
Sbjct: 21  DHRRILTLLHALGNPQQQGR-YIHVTGTNGKGSAANAIAHVLEASGLTVGLYTSPFIMRF 79

Query: 65  NERFRLGVKGGRGRLVEDVELLDV-------FRRVRRVKSAQNLTIFELSIATALVLFSK 117
           NER  +         + D  L++          R+++ ++  N+T FE   A A   F +
Sbjct: 80  NERIMID-----HEPIPDAALVNAVAFVRAALERLQQQQADFNVTEFEFITALAYWYFRQ 134

Query: 118 YPADCAIIEVGLGGSLDATNIIEKVAVSVITSISLDHEKILGNTVSAIAKDKSGIIKPGC 177
              D A+IEVG+GG  D+TN+I  V VSV+T ++LDH+K+LG+T++AIAK K+GIIK G 
Sbjct: 135 RQVDVAVIEVGIGGDTDSTNVITPV-VSVLTEVALDHQKLLGHTITAIAKHKAGIIKRGI 193

Query: 178 PVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFY-----AFEKNKCLVYQDKISQTNLT 232
           PVV G+    +   ++ +K    G  +  +  DF           +   Y+D+  + +  
Sbjct: 194 PVVTGNL-VPDAAAVVAAKVATTGSQWLRFDRDFSVPKAKLHGWGQRFTYEDQDGRISDL 252

Query: 233 VLGLVGEHQYINAATAICAVQMAGFTLEKEC----INAALQSVQWFGRLQKITEGPLLNK 288
            + LVG++Q  N A AI   ++     E       I   L +  W  RL+KI++ PL   
Sbjct: 253 EVPLVGDYQQRNMAIAIQTAKVYAKQTEWPLTPQNIRQGLAASHWPARLEKISDTPL--- 309

Query: 289 LPDHSEVWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSP 348
                 + IDG HNP+    +   + +L    ++P  ++ G++  K Y    +    L+ 
Sbjct: 310 ------IVIDGAHNPDGINGLITALKQLF---SQPITVIAGILADKDYAAMAD---RLTA 357

Query: 349 IVLSVSLICRGRERQSISITPKVLMQEAKKLGFQAMACSSMIEALSRVRKINEELPPPLI 408
              +V L+      +++        +   +   +     S  EAL        ++P   I
Sbjct: 358 AFSTVYLVPVPGTPRALP-------EAGYEALHEGRLKDSWQEAL---AASLNDVPDQPI 407

Query: 409 LIAGSLYLAGEALR 422
           +I GSLYLA    +
Sbjct: 408 VITGSLYLASAVRQ 421


>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthase; TM0166, structural genomics, JCSG, PSI, protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Length = 442 Back     alignment and structure
>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* Length = 437 Back     alignment and structure
>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, conformational change, peptidoglycan synthesis, cell division, cobalt binding; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* Length = 487 Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Length = 422 Back     alignment and structure
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.0A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Length = 498 Back     alignment and structure
>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, cytoplasm; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} Length = 535 Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Length = 451 Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Length = 469 Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Length = 475 Back     alignment and structure
>1gg4_A UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimelate-D-alanyl-D-alanyl ligase...; alpha/beta sheet; 2.30A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Length = 452 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target429 FolC bifunctional protein [Candidatus Liberibacter asia
2vos_A487 Folylpolyglutamate synthase protein FOLC; ligase, confo 100.0
3nrs_A437 Dihydrofolate:folylpolyglutamate synthetase; structural 100.0
1o5z_A442 Folylpolyglutamate synthase/dihydrofolate synthase; TM0 100.0
1jbw_A428 Folylpolyglutamate synthase; FPGS folate AMPPCP ternary 100.0
1w78_A422 FOLC bifunctional protein; DHFS, dihydrofolate synthase 100.0
2wtz_A535 UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diamino 100.0
1e8c_A498 UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopim 100.0
3hn7_A524 UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, str 100.0
1j6u_A469 UDP-N-acetylmuramate-alanine ligase MURC; structural ge 100.0
2f00_A491 UDP-N-acetylmuramate--L-alanine ligase; amide bond liga 100.0
1p3d_A475 UDP-N-acetylmuramate--alanine ligase; alpha/beta protei 100.0
2am1_A454 SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysi 100.0
1gg4_A452 UDP-N-acetylmuramoylalanyl-D-glutamyl-2,6- diaminopimel 100.0
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalac 100.0
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-bi 100.0
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl- MESO-di 99.96
3mvn_A163 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamayl-M diami 99.48
2www_A349 Methylmalonic aciduria type A protein, mitochondrial; t 97.33
2p67_A341 LAO/AO transport system kinase; ARGK, structural genomi 96.26
3p32_A355 Probable GTPase RV1496/MT1543; structural genomics, sea 94.52
1byi_A224 Dethiobiotin synthase; biotin synthesis, cyclo-ligase, 96.7
2qmo_A220 Dethiobiotin synthetase; structural genomics, PSI-2, pr 96.4
2j37_W504 Signal recognition particle 54 kDa protein (SRP54); rib 96.15
3end_A307 Light-independent protochlorophyllide reductase iron-su 96.08
3fgn_A251 Dethiobiotin synthetase; biotin biosynthesis, BIOD, ATP 95.82
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone; HET: M 95.26
1np6_A174 Molybdopterin-guanine dinucleotide biosynthesis protein 94.31
1g3q_A237 MIND ATPase, cell division inhibitor; alpha-beta-alpha 94.3
3bfv_A271 CAPA1, CAPB2, membrane protein CAPA1, protein tyrosine 94.25
2ph1_A262 Nucleotide-binding protein; alpha-beta protein, structu 94.18
3cio_A299 ETK, tyrosine-protein kinase ETK; WZC, escherichia coli 94.12
2ffh_A425 Protein (FFH); SRP54, signal recognition particle, GTPa 94.08
1xjc_A169 MOBB protein homolog; structural genomics, midwest cent 94.03
3la6_A286 Tyrosine-protein kinase WZC; P-loop protein, nucleotide 93.94
2v3c_C432 SRP54, signal recognition 54 kDa protein; nucleotide-bi 93.91
3kl4_A433 SRP54, signal recognition 54 kDa protein; signal recogn 93.49
3k9g_A267 PF-32 protein; ssgcid, SBRI, decode biostructures, UW, 93.37
1a7j_A290 Phosphoribulokinase; transferase, calvin cycle; 2.50A { 93.18
2afh_E289 Nitrogenase iron protein 1; nitrogen fixation, iron-sul 93.05
1hyq_A263 MIND, cell division inhibitor (MIND-1); MINC, FTSZ, bac 92.49
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 92.19
1rz3_A201 Hypothetical protein rbstp0775; MCSG, structural genomi 91.97
3ez2_A398 Plasmid partition protein A; type IA, DNA binding, wing 91.93
1ihu_A 589 Arsenical pump-driving ATPase; aluminum fluoride, ADP, 91.83
3c8u_A208 Fructokinase; YP_612366.1, putative fructose transport 91.15
1wcv_1257 SOJ, segregation protein; ATPase, bacterial, chromosome 90.69
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CPFTSY; 95.92
1vma_A306 Cell division protein FTSY; TM0570, structural genomics 92.28
3e70_C328 DPA, signal recognition particle receptor; FTSY, SRP-GT 91.71
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, recepto 90.9
2qy9_A309 Cell division protein FTSY; SRP receptor, protein targe 90.83
1ls1_A295 Signal recognition particle protein; FFH, SRP54, SRP, G 90.49
1j8m_F297 SRP54, signal recognition 54 kDa protein; signaling pro 90.4
2og2_A359 Putative signal recognition particle receptor; nucleoti 94.37
1ihu_A589 Arsenical pump-driving ATPase; aluminum fluoride, ADP, 90.83
>2vos_A Folylpolyglutamate synthase protein FOLC; ligase, conformational change, peptidoglycan synthesis, cell division, cobalt binding; HET: ADP; 2.0A {Mycobacterium tuberculosis} PDB: 2vor_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=675.33  Aligned_cols=399  Identities=28%  Similarity=0.408  Sum_probs=342.5

Q ss_pred             CCHHHHHHHHHHCCCHHHHCCCEEEEECCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCEEEEEEEECCCCCCCEECCHH
Q ss_conf             88899999998729958835983999458984799999999999978935141378411012008988847787155889
Q gi|254780821|r    4 DSLLKMGYLLEDLGRPQDRLPPVIHIGGTNGKGSVASFSQRLLETSGLSVHVHTSPHLIRWNERFRLGVKGGRGRLVEDV   83 (429)
Q Consensus         4 ~~l~r~~~ll~~lg~P~~~~~~vI~VtGTnGKttt~~~i~~il~~~g~k~g~~tSPhl~~~~Eri~i~~~~~~g~~i~~~   83 (429)
                      =+|+||++||++|||||+++ |||||||||||||||+|+++||+++|+|||+||||||++++|||+||     |++|++.
T Consensus        45 ~gL~ri~~~l~~lg~P~~~~-~vI~VtGTNGKtSt~~~l~~iL~~~G~~vG~~tSPhl~~~~Eri~i~-----g~~I~~~  118 (487)
T 2vos_A           45 PSLTRISALMDLLGSPQRSY-PSIHIAGTNGKTSVARMVDALVTALHRRTGRTTSPHLQSPVERISID-----GKPISPA  118 (487)
T ss_dssp             TTCHHHHHHHHHTTCGGGSS-CEEEEECSSSHHHHHHHHHHHHHHTTCCEEEECSSCSSCGGGGEEET-----TEECCHH
T ss_pred             CCHHHHHHHHHHCCCHHHCC-CEEEEECCCHHHHHHHHHHHHHHHCCCCEEEECCCCCCCEEEEEEEC-----CEECCHH
T ss_conf             98799999999749927619-97999888018999999999999779986896787738424599999-----9983899


Q ss_pred             HHHHHHHHHHHC-------------CCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCEEEEEEC
Q ss_conf             999999998630-------------4776779578999999987411446247776444756764135677515898602
Q gi|254780821|r   84 ELLDVFRRVRRV-------------KSAQNLTIFELSIATALVLFSKYPADCAIIEVGLGGSLDATNIIEKVAVSVITSI  150 (429)
Q Consensus        84 ~~~~~~~~i~~~-------------~~~~~~t~FE~lt~~a~~~f~~~~~d~~vlE~GlGGr~DaTnvi~~~~vavITnI  150 (429)
                      ++.+++.++...             .....+||||++|++||.+|.++++|++|+|+|+|||+|+||+++ |+++|||||
T Consensus       119 ~~~~~~~~i~~~~~~~~~~~~~~~~~~~~~~t~fe~~t~~a~~~~~~~~~d~~v~E~glgg~~datn~~~-~~vavITnI  197 (487)
T 2vos_A          119 QYVATYREIEPLVALIDQQSQASAGKGGPAMSKFEVLTAMAFAAFADAPVDVAVVEVGMGGRWDATNVIN-APVAVITPI  197 (487)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHC-----CCCCHHHHHHHHHHHHHHHTTCSEEEEECSSSSTTSTTCSSC-CSEEEECCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCC-CCEEEECCC
T ss_conf             9999999998998764455432114699988778999999999987503168888420465304210345-564787167


Q ss_pred             CCHHCCCCCCCHHHHHHHHHHHCCC------CCCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCC-----CCE
Q ss_conf             5000000278523445666531137------98331544471789889999862105665235763210125-----852
Q gi|254780821|r  151 SLDHEKILGNTVSAIAKDKSGIIKP------GCPVVIGHQVYDEVREILVSKAEKMGCPYNVYGDDFYAFEK-----NKC  219 (429)
Q Consensus       151 ~~DHle~LG~tle~Ia~eKa~I~k~------~~~~v~~~~~~~~~~~~i~~~a~~~~~~~~~~~~~~~~~~~-----~~~  219 (429)
                      ++||+|+||+|+++||++|++||+.      +.++|++.+ ++++.+++..++.+.++..+..+.++.....     +..
T Consensus       198 ~~DH~d~lG~t~e~ia~eKagIi~~~~~~~p~~~~v~~~~-~~~~~~~~~~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~  276 (487)
T 2vos_A          198 SIDHVDYLGADIAGIAGEKAGIITRAPDGSPDTVAVIGRQ-VPKVMEVLLAESVRADASVAREDSEFAVLRRQIAVGGQV  276 (487)
T ss_dssp             CCCBCSCSSCCHHHHHHHHHTTCCCCC--CCCCEEEECCC-CHHHHHHHHHHHHHTTCEEEEBTTTBEEEEEEEETTEEE
T ss_pred             CCCHHHHHCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCC-CHHHHHHHHHHHHHCCCEEEECCCCCCEEEEECCCCCCE
T ss_conf             7652223366899999998767763335799725994354-278999999999745962662155410012100257723


Q ss_pred             EEEEECCCCCCCCCCCCCCCCCCCCHHHHHHHHHHH-----HHCCHHHHCCCCCCCCCCCCCEEEEECCCCCCCCCCCCE
Q ss_conf             444310333344444432222111114699998753-----200001100112222336653035422875444578745
Q gi|254780821|r  220 LVYQDKISQTNLTVLGLVGEHQYINAATAICAVQMA-----GFTLEKECINAALQSVQWFGRLQKITEGPLLNKLPDHSE  294 (429)
Q Consensus       220 ~~~~~~~~~~~~~~l~l~G~hn~~Na~~Aiaa~~~l-----g~~i~~~~I~~gL~~~~~pGR~e~i~~~~~~~~~~~~~~  294 (429)
                      +.+...........++|+|.||++|+++|++++..+     ...++.+.|++||++++||||||.+..++         .
T Consensus       277 ~~~~~~~~~~~~~~l~L~G~h~~~Na~~Aia~~~~l~~~~~~~~i~~~~i~~gL~~~~~pGR~e~i~~~~---------~  347 (487)
T 2vos_A          277 LQLQGLGGVYSDIYLPLHGEHQAHNAVLALASVEAFFGAGAQRQLDGDAVRAGFAAVTSPGRLERMRSAP---------T  347 (487)
T ss_dssp             EEEEETTEEEEEEEECCCSHHHHHHHHHHHHHHHHHTTC----CCCHHHHHHHHHTCCCTTSSEEEETTT---------E
T ss_pred             EEEECCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHCCCCCCCEECCCCC---------E
T ss_conf             7883488740244468752668988999999999997523433356899999876414788643025797---------6


Q ss_pred             EEEECCCCHHHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCEEEEEEECCCCCCCCCCCCCHHHHHH
Q ss_conf             99933632157998886543311477771243113467989899999888638889998422889984212789899999
Q gi|254780821|r  295 VWIDGGHNPNAGLVVSKEISKLKGSSNKPFYLVIGMVEGKKYGRYLEAFVELSPIVLSVSLICRGRERQSISITPKVLMQ  374 (429)
Q Consensus       295 viiD~AHNp~s~~~l~~~l~~l~~~~~~~i~~I~G~~~dKd~~~~l~~l~~~~d~i~~~~~~~~~~~~~~~~~~~~~l~~  374 (429)
                      |++||||||+|+++++++++..  ++.+++++|||+++|||..+|++.+.+.+|.++++..      ..+++.+++++++
T Consensus       348 viiD~AHNp~a~~~ll~~l~~~--~~~~~ii~V~G~~~dKD~~~~l~~l~~~~d~viit~~------~~pR~~~~~~l~~  419 (487)
T 2vos_A          348 VFIDAAHNPAGASALAQTLAHE--FDFRFLVGVLSVLGDKDVDGILAALEPVFDSVVVTHN------GSPRALDVEALAL  419 (487)
T ss_dssp             EEECCCCSHHHHHHHHHHHHHS--CCCSEEEEEECCBTTBCHHHHHHHHTTTCSEEEECCC------SCTTBCCHHHHHH
T ss_pred             EEEECCCCHHHHHHHHHHHHHH--CCCCCEEEEEECCCCCCHHHHHHHHHHHCCEEEEECC------CCCCCCCHHHHHH
T ss_conf             9994587989999999989986--5899789999606995999999998854899999689------9967799999999


Q ss_pred             HHHHC--CCCEEEECCHHHHHHHHHHHCC-----------CCCCCEEEEECCHHHHHHHHHHCCCC
Q ss_conf             99854--9978996998999999998603-----------58867999949779999999987974
Q gi|254780821|r  375 EAKKL--GFQAMACSSMIEALSRVRKINE-----------ELPPPLILIAGSLYLAGEALRENGVR  427 (429)
Q Consensus       375 ~~~~~--~~~~~~~~~~~eAi~~a~~~~~-----------~~~~d~VLV~GS~ylvge~l~~~g~~  427 (429)
                      .+...  ..++..++++++|++.|.++++           ..++|.|||||||||||++++++|+.
T Consensus       420 ~~~~~~~~~~v~~~~~~~eAi~~A~~~a~~~~~~~~~~~~~~~~d~IlV~GSlylvgev~~~l~~~  485 (487)
T 2vos_A          420 AAGERFGPDRVRTAENLRDAIDVATSLVDDAAADPDVAGDAFSRTGIVITGSVVTAGAARTLFGRD  485 (487)
T ss_dssp             HHHHHHCGGGEEECSSHHHHHHHHHHHHHHHHTCTTTTC----CEEEEEESSHHHHHHHHHHTTCC
T ss_pred             HHHHHCCCCCEEEECCHHHHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEECHHHHHHHHHHHHCCC
T ss_conf             998637876479918999999999997655332234554147998599975199999999985659



>3nrs_A Dihydrofolate:folylpolyglutamate synthetase; structural genomics, center for structural genomics of infec diseases, csgid; HET: TLA MES; 1.80A {Yersinia pestis} PDB: 3n2a_A* Back     alignment and structure
>1o5z_A Folylpolyglutamate synthase/dihydrofolate synthase; TM0166, structural genomics, JCSG, PSI, protein structure initiative; 2.10A {Thermotoga maritima} SCOP: c.59.1.2 c.72.2.2 Back     alignment and structure
>1jbw_A Folylpolyglutamate synthase; FPGS folate AMPPCP ternary complex, ligase; HET: KCX ACQ TMF; 1.85A {Lactobacillus casei} SCOP: c.59.1.2 c.72.2.2 PDB: 1fgs_A* 1jbv_A* 2gca_A 2gc5_A* 2gc6_A* 2gcb_A Back     alignment and structure
>1w78_A FOLC bifunctional protein; DHFS, dihydrofolate synthase, synthase, ATP-binding, folate biosynthesis, ligase, multifunctional enzyme; HET: KCX PD8 ADP; 1.82A {Escherichia coli} PDB: 1w7k_A* Back     alignment and structure
>2wtz_A UDP-N-acetylmuramoyl-L-alanyl-D-glutamate- -2,6-diaminopimelate ligase; nucleotide-binding, peptidoglycan synthesis, MURE, cytoplasm; HET: KCX UAG; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1e8c_A UDP-N-acetylmuramoylalanyl-D-glutamate--2,6- diaminopimelate ligase; peptidoglycan biosynthesis; HET: KCX UAG API; 2.00A {Escherichia coli} SCOP: c.98.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>3hn7_A UDP-N-acetylmuramate-L-alanine ligase; YP_263340.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.65A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1j6u_A UDP-N-acetylmuramate-alanine ligase MURC; structural genomics, TM0231, JCSG, PSI, protein structure initiative; 2.30A {Thermotoga maritima} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 Back     alignment and structure
>2f00_A UDP-N-acetylmuramate--L-alanine ligase; amide bond ligase, ATPase, bacterial cell WALL; 2.50A {Escherichia coli} Back     alignment and structure
>1p3d_A UDP-N-acetylmuramate--alanine ligase; alpha/beta protein; HET: UMA ANP; 1.70A {Haemophilus influenzae} SCOP: c.5.1.1 c.59.1.1 c.72.2.1 PDB: 1gqq_A* 1p31_A* 1gqy_A* Back     alignment and structure
>2am1_A SP protein, UDP-N-acetylmuramoylalanine-D-glutamyl-lysine-D- alanyl-D-alanine ligase, MURF protein...; HET: 1LG; 2.50A {Streptococcus pneumoniae R6} PDB: 2am2_A* Back     alignment and structure