254780823

254780823

double-strand break repair protein AddB

GeneID in NCBI database:8209829Locus tag:CLIBASIA_03580
Protein GI in NCBI database:254780823Protein Accession:YP_003065236.1
Gene range:+(426908, 430030)Protein Length:1040aa
Gene description:double-strand break repair protein AddB
COG prediction:[L] Inactivated superfamily I helicase
KEGG prediction:double-strand break repair protein AddB
SEED prediction:FIG041266: ATP-dependent nuclease subunit B
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040
MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS
cccccccEEEccccccHHHHHHHHHHHHHHHcccccccccHHHHcEEEEEEccHHHHHHHHHHHHHHcccccEEEEEEEEcccccHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHccccEEEEEcccccccHHHHHHccccccccccccccccccHHHHHHHHHHHccccHHHHHHccccccccHHHHHHHHHHccccHHHHHHHHHHcccccccHHHccccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEEEccHHHHHHHHHHHHHcccccccccccHHHHcHHHHHHHHHHHHHHccccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHcccccccccccEEEEccHHHccccccEEEEcccccccccccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHcHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEccccEEEEEEEEEEEEcccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEEEEcccccccccccccHHcccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHccccccccc
cccccccEcccccccccHHHHHHHHHccccccccccccccHHHHHccEEEcccHHHHHHHHHHHHccccccccccccEEEccccccHHHHccccccccccccccHHHHHHHHHHHHHHHHHHccHccccccccccccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHcHcccccHHHHHHHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHcccccEEEccccccccHHHHHHHccccccccccccccccccHHHHHHHHHHHcccHHHcccccccccccHHHHHHHHHHccccHHHHHHHHHHcccccHcHHHHHcccEEEEcccHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccccccccccccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHcccccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccHHHHHccHcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccccccccccEEEEccHHHHHccccEEEEEccccccccccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHccHHHHHHHHHcccHHHHHHHHHcccccccccccccccccHHHccccccHHHHHHHHHcHHHHHHHHHHcccccccccccccHHHHcHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccEEcccccEEEEEEEEEEEEcccccEEEEEccccccccHHHHHHcccHHHHHHHHHHHcccccccccccHHHEEEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHHHHHccccc
mhnkkpnvftiapsspffREMIPALLNgtlvenfrydplnplllaSVTIYVPTKRAIQELRSEFIEitgkkstilPIIKSLGDVVEEKFTADLLlsynlnppvsnIQRLLELARLILIWRNKLPDiikdlypesplslpispANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLmkgtkgpiiiagstgsipATARLMSTVanhpngaivlpgldchiptAIWNTItekstnitssnttysthpqysLAKLLDFLDIKREDVKRLgnvsnemygrsmvisksflppdtsdmrntdilenkipniqkcFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFginidisagiplstTLHSSILTSLLNAIFKLNDFMAIATLVkhplakfgfpekYLSRAKNALELVALRGnknsydimdLKSLVLDRIatqknnthvphwqsrlsEEDKELAVLLVDHILQCITplvtyktnknstcgnlsisdwTKLTVTCLQNVcldehrklpnlwfeeeGKTLSSLFSKIIETGSCIKANAIEWIDIITRLidgetvkpkieksstLFILGTLESRLLNFDTLilgglnegvwpkntaknpflsrvmqSDLNLKTAEKYIGQAAhdfemangtRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYldwtrkldyttkqphykrpkpfppleaqprtysfSEIKQLINDPYAVYARRILKLdfiphfkkdpdrtdrgtLFHNIITELIKKRINKNTPEINHLMKQIIDShfekenlpphiDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLksgfvditdyktgdnpkketaqklIDPQLSLEAAALKagsfsqidCRKVANLFYIRLKQKFKIDCitndkkkysadelSEKSLKNLIEIVTLLQngeqpfishlrlseksniQSEYDHLARVAEWREEYDIS
mhnkkpnvftiapsspffREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFieitgkkstilpIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEkstnitssnttysthpqYSLAKLLDFLDIKREDVKRLgnvsnemygrsmvisksflppdtsDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALrmsldenkkksalitadrnlaRRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQknnthvphwqsrLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLidgetvkpkiEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLdyttkqphykrpkpfppleaQPRTYSFSEIKQLINDPYAVYARRILKLDFiphfkkdpdrtdrgtLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDyktgdnpkketaqKLIDPQLSLEAAALKagsfsqidcRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEwreeydis
MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLAdiidiieteekkwedLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWntitekstnitssnttystHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPlsttlhssiltsllNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS
****KPN*FTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYT*SL***********WLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKK*TAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQK*************SADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWR******
MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS
****KPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREE****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS
MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS
MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMWWLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMKGTKGPIIIAGSTGSIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAKLLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDENKKKSALITADRNLARRVKLELTRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALRGNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQRLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDHLARVAEWREEYDIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target1040 double-strand break repair protein AddB [Candidatus Lib
3151220471050 double-strand break repair protein AddB [Candidatus Lib 1 0.0
2220842281063 double-strand break repair protein AddB [Agrobacterium 1 0.0
1503984351059 double-strand break repair protein AddB [Sinorhizobium 1 0.0
2221470611062 double-strand break repair protein AddB [Agrobacterium 1 0.0
3252914771061 double-strand break repair protein AddB [Agrobacterium 1 0.0
159637881059 hypothetical protein SMc02759 [Sinorhizobium meliloti 1 1 0.0
3073109761059 double-strand break repair protein AddB [Sinorhizobium 1 0.0
2095515311064 double-strand break repair protein AddB [Rhizobium legu 1 0.0
158873831061 hypothetical protein Atu0024 [Agrobacterium tumefaciens 1 0.0
1162497931063 hypothetical protein RL0027 [Rhizobium leguminosarum bv 1 0.0
>gi|315122047|ref|YP_004062536.1| double-strand break repair protein AddB [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 1050 Back     alignment and organism information
 Score = 1544 bits (3998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 760/1051 (72%), Positives = 885/1051 (84%), Gaps = 12/1051 (1%)

Query: 1    MHNKKPNVFTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQEL 60
            M NKKPN+FTIAPSS FFREM+ +LLNGTLVE+F+YDP NPL LAS+TIYVPTKRAIQ L
Sbjct: 1    MENKKPNIFTIAPSSSFFREMVLSLLNGTLVESFQYDPSNPLSLASITIYVPTKRAIQAL 60

Query: 61   RSEFIEITGKKSTILPIIKSLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWR 120
            RSEF    G+KS ILP+IK LGD+V+E F  D  LS NLNPP+SN++RLLELARLIL WR
Sbjct: 61   RSEFTAAIGEKSIILPVIKPLGDIVDENFNTDFPLSCNLNPPISNMKRLLELARLILAWR 120

Query: 121  NKLPDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGMW 180
            N+ P+ IKD+YPESPL LP SPA+AIWLAKNLADIID+IE EEKKWEDL+ L+N+KYGMW
Sbjct: 121  NQFPNKIKDIYPESPLILPASPADAIWLAKNLADIIDVIEIEEKKWEDLYTLENDKYGMW 180

Query: 181  WLLAADFLKIASKYWTERLVELNASSPVGYQIALMRAEAEHLMK--GTKGPIIIAGSTGS 238
            WL A DFLKIAS+YW +RL EL+ SS V YQIALMRAEAE++ K  GT GPII+AGSTGS
Sbjct: 181  WLFALDFLKIASEYWKDRLSELSVSSAVHYQIALMRAEAEYIAKRKGT-GPIIVAGSTGS 239

Query: 239  IPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLAK 298
            +PATARLMS VA+ PNGAIVLPG+D  +P+ IW+TI+EKS NIT SN T+  +PQYSL+K
Sbjct: 240  MPATARLMSAVASDPNGAIVLPGVDVFMPSNIWDTISEKSNNITQSNATHPMNPQYSLSK 299

Query: 299  LLDFLDIKREDVKRLGNVSNEMYGRSMVISKSFLPPDTSDMRNTDILENKIPNIQKCFSD 358
            LL FL IKREDVK LG V++EM  RS++ISKSF P  + +  +TD +E+KI ++QK FSD
Sbjct: 300  LLHFLKIKREDVKCLGIVNDEMRMRSIIISKSFFPSGSFNTYDTDRMEDKILDLQKSFSD 359

Query: 359  VALIEADNEREEAISIAIALRMSLDENKK-KSALITADRNLARRVKLELTRFGINIDISA 417
            VALIEA+NEREEA SIAIALRMSLDENKK KSALITADRNLARRVKLEL RFGI++DISA
Sbjct: 360  VALIEANNEREEATSIAIALRMSLDENKKTKSALITADRNLARRVKLELIRFGIDVDISA 419

Query: 418  GIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVKHPLAKFGFPEKYLSRAKNALELVALR 477
            GIPLSTTL  SILTSLLNA+FK ND MA+A L+KHPLA FGFPEK+L +AKNALEL+ALR
Sbjct: 420  GIPLSTTLQGSILTSLLNAVFKTNDPMALAVLIKHPLATFGFPEKHLFKAKNALELIALR 479

Query: 478  GNKNSYDIMDLKSLVLDRIATQKNNTHVPHWQSRLSEEDKELAVLLVDHILQCITPLVTY 537
            GN+N  DI+DLKSLV+++I  QKN+ ++P WQSRLSEEDK+L++ L DHI++ I PL  Y
Sbjct: 480  GNRNPCDIIDLKSLVINKINEQKNDKYIPRWQSRLSEEDKKLSLWLADHIVKSIAPLAVY 539

Query: 538  KTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSC 597
            K N+NS   +LS  DWT+LT  CLQNVCLDE++KLP+LW  EEGK LS+LFSKIIE G C
Sbjct: 540  KMNENSIGDSLSTPDWTELTAACLQNVCLDENKKLPSLWLAEEGKALSALFSKIIEAGPC 599

Query: 598  IKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKN 657
            IKANAIEWIDIIT LI GETVKPKIEKSST+FILGTLESRLLNFDTLILGGLNEG+WPK 
Sbjct: 600  IKANAIEWIDIITALIAGETVKPKIEKSSTIFILGTLESRLLNFDTLILGGLNEGIWPKY 659

Query: 658  TAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTRHLIYTRSLRENNIPTIASRWLQ 717
            T KNPFLSR+MQSDL L+TAEKYIGQAAHDFEMA+GTRHLIYTRSL+ENNIPT+ASRWLQ
Sbjct: 660  TPKNPFLSRMMQSDLGLETAEKYIGQAAHDFEMASGTRHLIYTRSLQENNIPTVASRWLQ 719

Query: 718  RLLVLGGTDFFDNLKKRGQCYLDWTRKLDYTT-KQPHYKRPKPFPPLEAQPRTYSFSEIK 776
            RLLV GG  F ++LKK+G+ YLDW R+LD +T KQ   KRP+PFPPLE QP+TYSFSEIK
Sbjct: 720  RLLVFGGNAFSNDLKKKGERYLDWARRLDDSTKKQIICKRPRPFPPLETQPKTYSFSEIK 779

Query: 777  QLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMK 836
            +L++DPYA+YA++IL+LDF+P FK DP+  DRG LFH I+T LI+++INKNTPEI   MK
Sbjct: 780  KLMSDPYAIYAQKILRLDFMPRFKNDPNPKDRGILFHKIVTGLIEEKINKNTPEITRRMK 839

Query: 837  QIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGI 896
             IIDS FEKENLPPHIDIIWR+LFHKI+  FLE+EE+ Q  IEK  VN+PAKM I+SIGI
Sbjct: 840  DIIDSCFEKENLPPHIDIIWRYLFHKIALPFLEYEEQRQPLIEKTIVNVPAKMKIDSIGI 899

Query: 897  HLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAALKAGSFSQIDCRK 956
            HLTG ADRID+LKSG+ DI DYKTG+NP K+ AQ LIDPQLSLEA ALKAGSFSQIDCR+
Sbjct: 900  HLTGIADRIDILKSGYADIIDYKTGNNPTKKIAQNLIDPQLSLEAVALKAGSFSQIDCRE 959

Query: 957  VANLFYIRLKQKFK-------IDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGEQPFI 1009
            V  L YIRLK   K       IDCI  ++K  SADELSE+SLKN IEI+  LQ+G++PFI
Sbjct: 960  VGKLVYIRLKLDHKRLKPRLIIDCIAGNEKDLSADELSEESLKNFIEIIKSLQSGKKPFI 1019

Query: 1010 SHLRLSEKSNIQSEYDHLARVAEWREEYDIS 1040
            SHLR SE +NI SEYDHLARV EW+E YD S
Sbjct: 1020 SHLRFSENANIPSEYDHLARVEEWKENYDAS 1050


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084228|ref|YP_002542754.1| double-strand break repair protein AddB [Agrobacterium radiobacter K84] Length = 1063 Back     alignment and organism information
>gi|150398435|ref|YP_001328902.1| double-strand break repair protein AddB [Sinorhizobium medicae WSM419] Length = 1059 Back     alignment and organism information
>gi|222147061|ref|YP_002548018.1| double-strand break repair protein AddB [Agrobacterium vitis S4] Length = 1062 Back     alignment and organism information
>gi|325291477|ref|YP_004277341.1| double-strand break repair protein AddB [Agrobacterium sp. H13-3] Length = 1061 Back     alignment and organism information
>gi|15963788|ref|NP_384141.1| hypothetical protein SMc02759 [Sinorhizobium meliloti 1021] Length = 1059 Back     alignment and organism information
>gi|307310976|ref|ZP_07590621.1| double-strand break repair protein AddB [Sinorhizobium meliloti BL225C] Length = 1059 Back     alignment and organism information
>gi|209551531|ref|YP_002283448.1| double-strand break repair protein AddB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 1064 Back     alignment and organism information
>gi|15887383|ref|NP_353064.1| hypothetical protein Atu0024 [Agrobacterium tumefaciens str. C58] Length = 1061 Back     alignment and organism information
>gi|116249793|ref|YP_765631.1| hypothetical protein RL0027 [Rhizobium leguminosarum bv. viciae 3841] Length = 1063 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1040 double-strand break repair protein AddB [Candidatus Lib
TIGR027861021 TIGR02786, addB_alphas, double-strand break repair prot 0.0
COG2887269 COG2887, COG2887, RecB family exonuclease [DNA replicat 3e-29
COG38571108 COG3857, AddB, ATP-dependent nuclease, subunit B [DNA r 8e-05
TIGR03623874 TIGR03623, TIGR03623, probable DNA repair protein 0.001
COG3893697 COG3893, COG3893, Inactivated superfamily I helicase [D 1e-142
>gnl|CDD|163020 TIGR02786, addB_alphas, double-strand break repair protein AddB, alphaproteobacterial type Back     alignment and domain information
>gnl|CDD|32713 COG2887, COG2887, RecB family exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|33647 COG3857, AddB, ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|163360 TIGR03623, TIGR03623, probable DNA repair protein Back     alignment and domain information
>gnl|CDD|33681 COG3893, COG3893, Inactivated superfamily I helicase [DNA replication, recombination, and repair] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 1040 double-strand break repair protein AddB [Candidatus Lib
TIGR027861096 addB_alphas double-strand break repair protein AddB; In 100.0
TIGR03623874 probable DNA repair protein. Members of this protein fa 100.0
COG38571108 AddB ATP-dependent nuclease, subunit B [DNA replication 100.0
COG3893697 Inactivated superfamily I helicase [DNA replication, re 100.0
TIGR027731192 addB_Gpos ATP-dependent nuclease subunit B; InterPro: I 100.0
TIGR027841190 addA_alphas double-strand break repair helicase AddA; I 100.0
TIGR027851295 addA_Gpos recombination helicase AddA; InterPro: IPR014 100.0
TIGR006091324 recB exodeoxyribonuclease V, beta subunit; InterPro: IP 99.97
PRK110691122 recC exonuclease V subunit gamma; Provisional 100.0
pfam042571008 Exonuc_V_gamma Exodeoxyribonuclease V, gamma subunit. T 100.0
TIGR027741116 rexB_recomb ATP-dependent nuclease subunit B; InterPro: 100.0
PRK108761181 recB exonuclease V subunit beta; Provisional 100.0
COG10741139 RecB ATP-dependent exoDNAse (exonuclease V) beta subuni 100.0
PRK13909911 putative recombination protein RecB; Provisional 100.0
PRK11773722 uvrD DNA-dependent helicase II; Provisional 100.0
PRK10919672 ATP-dependent DNA helicase Rep; Provisional 100.0
COG0210655 UvrD Superfamily I DNA and RNA helicases [DNA replicati 99.97
COG13301078 RecC Exonuclease V gamma subunit [DNA replication, reco 100.0
TIGR01073811 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR0057 100.0
TIGR01075741 uvrD DNA helicase II; InterPro: IPR005753 The SOS respo 100.0
TIGR01074677 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 100.0
pfam00580494 UvrD-helicase UvrD/REP helicase. The Rep family helicas 99.98
COG2887269 RecB family exonuclease [DNA replication, recombination 99.98
pfam10926 363 DUF2800 Protein of unknown function (DUF2800). This is 99.29
TIGR00372206 cas4 CRISPR-associated protein Cas4; InterPro: IPR01334 98.62
pfam06023290 DUF911 Archaeal protein of unknown function (DUF911). T 98.39
COG4343281 CRISPR-associated protein, RecB family exonuclease [Def 97.32
TIGR01896295 cas_AF1879 CRISPR-associated protein, Csa1 family; Inte 97.14
COG1468190 CRISPR-associated protein Cas4 (RecB family exonuclease 95.9
PRK11054684 helD DNA helicase IV; Provisional 99.92
TIGR014501207 recC exodeoxyribonuclease V, gamma subunit; InterPro: I 99.22
KOG18051100 consensus 98.47
pfam09810329 Morph_protein1 Defects in morphology protein 1, mitocho 98.24
pfam01930162 Cas_Cas4 Domain of unknown function DUF83. This domain 98.11
PHA00619210 CRISPR-associated Cas4-like protein 97.6
PHA01622204 CRISPR-associated Cas4-like protein 97.12
TIGR03491457 RecB family nuclease, putative, TM0106 family. Members 97.93
pfam08696209 Dna2 DNA replication factor Dna2. Dna2 is a DNA replica 96.53
PRK09709877 exonuclease VIII; Reviewed 95.88
>TIGR02786 addB_alphas double-strand break repair protein AddB; InterPro: IPR014153 AddAB is a system well described in the Firmicutes as a replacement for RecBCD in many prokaryotes for the repair of double stranded break DNA damage Back     alignment and domain information
>TIGR03623 probable DNA repair protein Back     alignment and domain information
>COG3857 AddB ATP-dependent nuclease, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>COG3893 Inactivated superfamily I helicase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02773 addB_Gpos ATP-dependent nuclease subunit B; InterPro: IPR014140 DNA repair is accomplished by several different systems in prokaryotes Back     alignment and domain information
>TIGR02784 addA_alphas double-strand break repair helicase AddA; InterPro: IPR014151 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>TIGR02785 addA_Gpos recombination helicase AddA; InterPro: IPR014152 AddAB, also called RexAB, substitutes for RecBCD in several bacterial lineages Back     alignment and domain information
>TIGR00609 recB exodeoxyribonuclease V, beta subunit; InterPro: IPR004586 Exodeoxyribonuclease V, or RecBCD holoenzyme, (3 Back     alignment and domain information
>PRK11069 recC exonuclease V subunit gamma; Provisional Back     alignment and domain information
>pfam04257 Exonuc_V_gamma Exodeoxyribonuclease V, gamma subunit Back     alignment and domain information
>TIGR02774 rexB_recomb ATP-dependent nuclease subunit B; InterPro: IPR014141 DNA repair is accomplished by several different systems in prokaryotes Back     alignment and domain information
>PRK10876 recB exonuclease V subunit beta; Provisional Back     alignment and domain information
>COG1074 RecB ATP-dependent exoDNAse (exonuclease V) beta subunit (contains helicase and exonuclease domains) [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13909 putative recombination protein RecB; Provisional Back     alignment and domain information
>PRK11773 uvrD DNA-dependent helicase II; Provisional Back     alignment and domain information
>PRK10919 ATP-dependent DNA helicase Rep; Provisional Back     alignment and domain information
>COG0210 UvrD Superfamily I DNA and RNA helicases [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1330 RecC Exonuclease V gamma subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01073 pcrA ATP-dependent DNA helicase PcrA; InterPro: IPR005751 The DNA helicase PcrA is found mainly in Gram-positive bacteria and belongs to a superfamily of helicases, together with Rep and UvrD helicases from Escherichia coli Back     alignment and domain information
>TIGR01075 uvrD DNA helicase II; InterPro: IPR005753 The SOS response is required for efficient nucleotide excision repair (NER) of the major ultraviolet light (UV) induced DNA lesions Back     alignment and domain information
>TIGR01074 rep ATP-dependent DNA helicase Rep; InterPro: IPR005752 RepA hexameric DNA helicase contain ATP-binding domains similar to those seen in monomeric helicases but which are arranged in a ring Back     alignment and domain information
>pfam00580 UvrD-helicase UvrD/REP helicase Back     alignment and domain information
>COG2887 RecB family exonuclease [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam10926 DUF2800 Protein of unknown function (DUF2800) Back     alignment and domain information
>TIGR00372 cas4 CRISPR-associated protein Cas4; InterPro: IPR013343 This entry consists of conserved proteins found in many prokaryotic genomes whose genes are associated with CRISPRs (Clustered, Regularly Interspaced Short Palidromic Repeats) Back     alignment and domain information
>pfam06023 DUF911 Archaeal protein of unknown function (DUF911) Back     alignment and domain information
>COG4343 CRISPR-associated protein, RecB family exonuclease [Defense mechanisms] Back     alignment and domain information
>TIGR01896 cas_AF1879 CRISPR-associated protein, Csa1 family; InterPro: IPR009260 This family consists of several archaeal strongly conserved proteins whose genes are associated with CRISPRs (Clustered, Regularly Interspaced Short Palidromic Repeats) Back     alignment and domain information
>COG1468 CRISPR-associated protein Cas4 (RecB family exonuclease) [Defense mechanisms] Back     alignment and domain information
>PRK11054 helD DNA helicase IV; Provisional Back     alignment and domain information
>TIGR01450 recC exodeoxyribonuclease V, gamma subunit; InterPro: IPR006697 The exodeoxyribonuclease V enzyme is a multisubunit enzyme comprised of the proteins RecB (IPR004586 from INTERPRO), RecC (this family) and RecD (IPR006344 from INTERPRO) Back     alignment and domain information
>KOG1805 consensus Back     alignment and domain information
>pfam09810 Morph_protein1 Defects in morphology protein 1, mitochondrial precursor Back     alignment and domain information
>pfam01930 Cas_Cas4 Domain of unknown function DUF83 Back     alignment and domain information
>PHA00619 CRISPR-associated Cas4-like protein Back     alignment and domain information
>PHA01622 CRISPR-associated Cas4-like protein Back     alignment and domain information
>TIGR03491 RecB family nuclease, putative, TM0106 family Back     alignment and domain information
>pfam08696 Dna2 DNA replication factor Dna2 Back     alignment and domain information
>PRK09709 exonuclease VIII; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target1040 double-strand break repair protein AddB [Candidatus Lib
1w36_C1122 Recbcd:dna Complex Length = 1122 2e-22
3pjr_A724 Helicase Substrate Complex Length = 724 1e-15
2pjr_A548 Helicase Product Complex Length = 548 3e-12
1qhh_B273 Structure Of Dna Helicase With Adpnp Length = 273 7e-10
gi|56966627|pdb|1W36|C Chain C, Recbcd:dna Complex Length = 1122 Back     alignment and structure
 Score =  113 bits (281), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 114/1086 (10%), Positives = 257/1086 (23%), Gaps = 165/1086 (15%)

Query: 20   EMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIK 79
            +++ AL+   +      DP  P       I V +    Q L+    +  G  + I     
Sbjct: 11   DVLEALMEFIVERERLDDPFEPE-----MILVQSTGMAQWLQMTLSQKFGIAANID---F 62

Query: 80   SLGDVVEEKFTADLLLSYNLNPPVSNIQRLLELARLILIWRNKLPDIIKDLYPESPLSLP 139
             L           +L         +      +L  L+     +    +        L+  
Sbjct: 63   PLPASFIWDMFVRVLPEIPKESAFNKQSMSWKLMTLLPQLLEREDFTLL----RHYLTDD 118

Query: 140  ISPANAIWLAKNLADIIDIIETEEKKWEDLHALKNEKYGM---WWLLAADFLKIASKYWT 196
                    L+   AD+ D        W  L   +                 L  A   +T
Sbjct: 119  SDKRKLFQLSSKAADLFDQYLVYRPDW--LAQWETGHLVEGLGEAQAWQAPLWKALVEYT 176

Query: 197  ERLVELNASSPVGYQIALMRAEAEHLMKGT--KGPIIIAGSTGSIPATARLMSTVANHPN 254
             +L +             +                + I G +   P   + +  +  H  
Sbjct: 177  HQLGQPRW-HRANLYQRFIETLESATTCPPGLPSRVFICGISALPPVYLQALQALGKHIE 235

Query: 255  GAIVLPGLDCHIPTAIWNTITEKSTNITSSNTTYSTHPQYSLA----------------- 297
              ++      +    I +              ++                          
Sbjct: 236  IHLLFTNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDV 295

Query: 298  --KLLDFLDIKREDVKRLGNVSNEMYGRSMVIS---------------KSFLPPDTSDMR 340
               LL        D   L +           +                +           
Sbjct: 296  GNPLLASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNI 355

Query: 341  NTDILENKIPNIQKCFSDVALIEADNEREEAISIAIALRMSLDEN----KKKSALITADR 396
                  +    +    S +      + + E   +   L   L+E+     +   ++ AD 
Sbjct: 356  EEFSRSDNKRPLDPLDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADI 415

Query: 397  NLARRVKLEL-----TRFGINIDISAGIPLSTTLHSSILTSLLNAIFKLNDFMAIATLVK 451
            +        +         +   IS      +        SLL+          +  L+ 
Sbjct: 416  DSYSPFIQAVFGSAPADRYLPYAISDRRARQSHPVLEAFISLLSLPDSRFVSEDVLALLD 475

Query: 452  HPLAKFGFP--EKYLSRAKNALELVALRGNKNSYDIMDLK-------SLVLDRIATQKNN 502
             P+    F   E+ L   +  +    +R   +  ++ +L+       +            
Sbjct: 476  VPVLAARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRMLLGY 535

Query: 503  THVPHWQSRLSEEDKELAVLL-VDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCL 561
                      S    + +  L  + +    + L+     +        + +W  +    L
Sbjct: 536  AMESAQGEWQSVLPYDESSGLIAELVGHLASLLMQLNIWRRGLAQERPLEEWLPVCRDML 595

Query: 562  QNVCLDEHRKLPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPK 621
                L +             +   ++ ++ +              D + + +D E +  +
Sbjct: 596  NAFFLPDAETEAA--MTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQR 653

Query: 622  IEKSSTLFILGTLESRLLNFDTLILGGLNEGVWPKNTAKNPFLSRVMQSDLNLKTAEKYI 681
                  + I   +  R + F  + L G+N+GV+P+  A   F   +M          +  
Sbjct: 654  FLAGP-VNICTLMPMRSIPFKVVCLLGMNDGVYPRQLAPLGF--DLMSQKPKRGDRSRRD 710

Query: 682  GQAAHDFEMANGTRH-LIYTRSLRE--NNIPTIASRWLQRLLVLGGTDF----------- 727
                   E     +  L  +   R   +N     S  +Q L+   G              
Sbjct: 711  DDRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHYLPGDEALNCD 770

Query: 728  -------------------FDNLKKRGQCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPR 768
                                    + G+        L   ++          P     P 
Sbjct: 771  ESEARVKAHLTCLHTRMPFDPQNYQPGERQSYAREWLPAASQAGKAHSEFVQPLPFTLPE 830

Query: 769  TYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDR---GTLFHNIITELIKKRIN 825
            T     +++    P   + +  L+++F     + PD       G   + I  +L+   + 
Sbjct: 831  TVPLETLQRFWAHPVRAFFQMRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNALVE 890

Query: 826  KNTPEIN-HLMKQIIDSHFEKENLPPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVN 884
            ++  E      +   D                     +++   +      Q         
Sbjct: 891  QDDAERLFRRFRAAGD--LPYGAFGEIFWETQCQEMQQLADRVIA---CRQPG------- 938

Query: 885  IPAKMAIESIGIHLTG---FADRIDLLKSG--FVDITDYKTGDNPKKETAQKLIDPQLSL 939
               ++ +   G+ +TG             G              P   +  +    QL L
Sbjct: 939  QSMEIDLACNGVQITGWLPQV-----QPDGLLRWR---------PSLLSVAQG--MQLWL 982

Query: 940  EAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVT 999
            E     A                           +  D +       +E++L  L +++ 
Sbjct: 983  EHLVYCASG-----------------GNGESRLFLRKDGEWRFPPLAAEQALHYLSQLIE 1025

Query: 1000 LLQNGE 1005
              + G 
Sbjct: 1026 GYREGM 1031


gi|4930230|pdb|3PJR|A Chain A, Helicase Substrate Complex Length = 724 Back     alignment and structure
>gi|9257172|pdb|2PJR|A Chain A, Helicase Product Complex Length = 548 Back     alignment and structure
>gi|5542369|pdb|1QHH|B Chain B, Structure Of Dna Helicase With Adpnp Length = 273 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target1040 double-strand break repair protein AddB [Candidatus Lib
3h4r_A265 Exodeoxyribonuclease 8; exonuclease, recombination, hyd 5e-06
2is6_A680 DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2 4e-04
>3h4r_A Exodeoxyribonuclease 8; exonuclease, recombination, hydrolase; 2.80A {Escherichia coli k-12} Length = 265 Back     alignment and structure
 Score = 49.2 bits (116), Expect = 5e-06
 Identities = 34/251 (13%), Positives = 63/251 (25%), Gaps = 14/251 (5%)

Query: 770  YSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIK-KRINKNT 828
             S S++  + + P     R+   +D            D GT FH  + EL +        
Sbjct: 13   ISKSQLDDIADTPALYLWRKNAPVDT-----TKTKTLDLGTAFHCRVLELEEFSNRFIVA 67

Query: 829  PEINHLMKQIIDSHFEKENLPPHIDII-----WRHLFHKISHSFLEHEEKIQSSIEKIFV 883
            PE N       +                           +  S +               
Sbjct: 68   PEFNRRTNAGKEEEKAFLMECASTGKTVITAEEGRKIELMYQSVMALPLGQWLVESAGHA 127

Query: 884  NIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLIDPQLSLEAAA 943
                       GI      D+I       +D+         K          Q +  +  
Sbjct: 128  ESSIYWEDPETGILCRCRPDKIIPEFHWIMDVKTTADIQRFKTAYYDYRYHVQDAFYSDG 187

Query: 944  LKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQN 1003
             +A    Q     +          ++ ++     ++   A +  ++  +NL  +   L  
Sbjct: 188  YEAQFGVQPTFVFLVAS-TTIECGRYPVEIFMMGEEAKLAGQ--QEYHRNLRTLSDCLNT 244

Query: 1004 GEQPFISHLRL 1014
             E P I  L L
Sbjct: 245  DEWPAIKTLSL 255


>2is6_A DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2.20A {Escherichia coli} PDB: 2is2_A* 2is1_A* 2is4_A* Length = 680 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1040 double-strand break repair protein AddB [Candidatus Lib
1w36_C1122 RECC, exodeoxyribonuclease V gamma chain; recombination 100.0
1w36_B1180 RECB, exodeoxyribonuclease V beta chain; recombination, 100.0
1pjr_A724 PCRA; DNA repair, DNA replication, SOS response, helica 100.0
2is6_A680 DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2 100.0
1uaa_A673 REP helicase, protein (ATP-dependent DNA helicase REP.) 100.0
3h4r_A265 Exodeoxyribonuclease 8; exonuclease, recombination, hyd 99.64
3l0a_A266 Putative exonuclease; RER070207002219, structural genom 99.49
3dmn_A174 Putative DNA helicase; APC89291.2, lactobacillus planta 97.19
2vld_A251 NUCS, UPF0286 protein pyrab01260; endonuclease, hydrola 93.6
>1w36_C RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.25 PDB: 3k70_C* Back     alignment and structure
Probab=100.00  E-value=0  Score=351.57  Aligned_cols=910  Identities=12%  Similarity=0.079  Sum_probs=500.0

Q ss_pred             EEECCCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHCCEEEEECCHHHHHHHHHHHHHHCCCCCEECCEEEEHHHHHHHH
Q ss_conf             98389889379999999711210112367898133222067627968999999999851188865140331257765655
Q gi|254780823|r    9 FTIAPSSPFFREMIPALLNGTLVENFRYDPLNPLLLASVTIYVPTKRAIQELRSEFIEITGKKSTILPIIKSLGDVVEEK   88 (1040)
Q Consensus         9 ~~~~~~~~fl~~~a~~l~~~~~~~~~~~~~~~p~~L~~v~vl~ptrraa~~Lr~~l~~~~~~~~~~~P~i~t~~~~~~~~   88 (1040)
                      |+|..+.- ++.|++.|..-....    ...+|  |...+|||||+.+++||+..|+++.|..+.+  ++.+.+.|....
T Consensus         2 l~~~~Sn~-~e~L~~~l~~~l~~~----~~~~p--f~~~~iiV~s~~~~~wL~~~lA~~~gi~an~--~f~~p~~~~~~~   72 (1122)
T 1w36_C            2 LRVYHSNR-LDVLEALMEFIVERE----RLDDP--FEPEMILVQSTGMAQWLQMTLSQKFGIAANI--DFPLPASFIWDM   72 (1122)
T ss_dssp             EEEEEESC-HHHHHHHHHHHHHSS----CCCCS--SCCCBEECSSHHHHHHHHHHHHHTTSCBCCC--BCCCHHHHHHHH
T ss_pred             CEEECCCC-HHHHHHHHHHHHHHC----CCCCC--CCCCEEEECCHHHHHHHHHHHHHHHCCEEEE--CCCCHHHHHHHH
T ss_conf             77880589-999999999999858----78899--9999788797479999999999984907744--689999999999


Q ss_pred             HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHH-HHHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHH
Q ss_conf             40454334677888881899999999999998631-00000012232111356978899989999999999997599978
Q gi|254780823|r   89 FTADLLLSYNLNPPVSNIQRLLELARLILIWRNKL-PDIIKDLYPESPLSLPISPANAIWLAKNLADIIDIIETEEKKWE  167 (1040)
Q Consensus        89 ~~~~~~~~~~~~~~~~~~~r~~~l~~l~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~lA~~L~~l~d~~~~~~~~~~  167 (1040)
                      ...-...... ..+.++..-.+.+++++....... ....     ...+....+..+.+.+|..|+++|++|..++.+| 
T Consensus        73 ~~~~l~~~~~-~~~~~~~~l~w~l~~~L~~~~~~~~~~~l-----~~yl~~~~~~~r~~~la~~iA~lf~qY~~yRp~~-  145 (1122)
T 1w36_C           73 FVRVLPEIPK-ESAFNKQSMSWKLMTLLPQLLEREDFTLL-----RHYLTDDSDKRKLFQLSSKAADLFDQYLVYRPDW-  145 (1122)
T ss_dssp             HHHHSSSCCS-SCTTCHHHHHHHHHHHHHHHCSSSTTHHH-----HHHTTSSCSSHHHHHHHHHHHHHHHHHTTSSHHH-
T ss_pred             HHHHCCCCCC-CCCCCHHHHHHHHHHHHHHHHCCCCCHHH-----HHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCHHH-
T ss_conf             9985389854-58997440399999998987528460999-----9987058740279999999999999998626999-


Q ss_pred             HHHHCCH------HCCHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCHHHHHHHHHHHHHHHHHC--CCCCEEEEEECCC
Q ss_conf             9874002------20207999999999999999999753248--889899999999874434422--7688099983456
Q gi|254780823|r  168 DLHALKN------EKYGMWWLLAADFLKIASKYWTERLVELN--ASSPVGYQIALMRAEAEHLMK--GTKGPIIIAGSTG  237 (1040)
Q Consensus       168 ~L~~l~~------~~~~~~w~~~~~fL~~~~~~~~~~l~~~g--~~d~~~~~~~~~~~~~~~~~~--~~~~~i~v~g~~~  237 (1040)
                       |..-..      -.....||..+  ...+.+    .....+  ...+.......+.........  .-+.+|+|+|.+.
T Consensus       146 -l~~W~~~~~~~~~~~~~~WQ~~L--wr~L~~----~~~~~~~~~~~~~~l~~~~~~~l~~~~~~~~~lp~r~~vfg~s~  218 (1122)
T 1w36_C          146 -LAQWETGHLVEGLGEAQAWQAPL--WKALVE----YTHQLGQPRWHRANLYQRFIETLESATTCPPGLPSRVFICGISA  218 (1122)
T ss_dssp             -HHHHHTTCCCTTCCTTHHHHHHH--HHHHHH----HHHHTTCCCCCSTTTHHHHHHHHHSCTTCCCSCCSEEEEESCCC
T ss_pred             -HHHHHCCCCCCCCCHHHHHHHHH--HHHHHH----HHCCCCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCC
T ss_conf             -99987599876787235569999--999998----63002687567799999999987426666324886589850464


Q ss_pred             CCHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHHHCC-------------------------CCCCCCCCCCCH
Q ss_conf             6167999999986148968998248632107888643342012-------------------------333334446763
Q gi|254780823|r  238 SIPATARLMSTVANHPNGAIVLPGLDCHIPTAIWNTITEKSTN-------------------------ITSSNTTYSTHP  292 (1040)
Q Consensus       238 ~~~~~~~ll~al~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~-------------------------~~~~~~~~~~~~  292 (1040)
                      +++.+..+++++++..+.+.++.++|..++.+.-.........                         .........+||
T Consensus       219 l~~~~l~~l~aLs~~~~v~l~~~~P~~~~w~di~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p  298 (1122)
T 1w36_C          219 LPPVYLQALQALGKHIEIHLLFTNPCRYYWGDIKDPAYLAKLLTRQRRHSFEDRELPLFRDSENAGQLFNSDGEQDVGNP  298 (1122)
T ss_dssp             CCHHHHHHHHHHTTTSEEEEEEECSCSSCCSCCCCHHHHTTTSCCBEESSSSCBCCSSTTHHHHSSTTCSSSSCSCCSCH
T ss_pred             CCHHHHHHHHHHHCCCCEEEEECCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHCCCCCHHHCCCCH
T ss_conf             89999999999853698699716868898864058888898999887653200111210122445420475212203786


Q ss_pred             HHHHHHHHHHCCCCHHHCCC------------CCCCCCCCHHHHHHHHHHH--CCCCCCC-HHHCCCCCCCCCCCCCCCC
Q ss_conf             68999999762999666025------------7766645367777544420--1112210-0000012356765321337
Q gi|254780823|r  293 QYSLAKLLDFLDIKREDVKR------------LGNVSNEMYGRSMVISKSF--LPPDTSD-MRNTDILENKIPNIQKCFS  357 (1040)
Q Consensus       293 ~~~~~~l~~~l~~~~~~~~~------------~~~~~~~~~~~~~~~~~~~--~~a~~~~-~~~~~~~~~~~~~~~~~~~  357 (1040)
                      .      +..+|...++...            ..................+  .+..... ...................
T Consensus       299 l------La~~G~~gr~~~~l~~~~~~~~~~~~f~~~~~~sll~~~q~~il~l~~~~~~~~~~~~~~~~~~~~~~~~~D~  372 (1122)
T 1w36_C          299 L------LASWGKLGRDYIYLLSDLESSQELDAFVDVTPDNLLHNIQSDILELENRAVAGVNIEEFSRSDNKRPLDPLDS  372 (1122)
T ss_dssp             H------HHHHTHHHHHHHHHHTTCSSEEEEECCCCCCSCSHHHHHHHHHHHTCCCCCCCCSHHHHHCCTTSEECCTTCC
T ss_pred             H------HHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCCHHHCCCCCHHHCCCCCCCCCCCCCC
T ss_conf             9------9987376799999986046642100257888630678788788752102111343011011002477888999


Q ss_pred             CCEEEECCCHHHHHHHHHHHHHHHHHHC----CCEEEEEECCCCHHHHHHHH-HH----HHCCCCCCCCCCHHHHCHHHH
Q ss_conf             8159955998999999999999986422----98499980264113578884-35----513777665690035288989
Q gi|254780823|r  358 DVALIEADNEREEAISIAIALRMSLDEN----KKKSALITADRNLARRVKLE-LT----RFGINIDISAGIPLSTTLHSS  428 (1040)
Q Consensus       358 ~v~~~~a~~~~~Ea~~ia~~lr~~~~~~----~~~~avv~~d~~~~~~v~~~-L~----~~gipv~~s~g~pL~~~p~v~  428 (1040)
                      +|+++.|+++.+|++.+++.|++.....    +++|+|++||...+.++..+ +.    ..+||++++++.++..+|.+.
T Consensus       373 SI~i~~~~s~~rEvE~l~~~Il~ll~~~~~l~p~DIaVl~pdi~~Y~p~I~avF~~~~~~~~IP~~i~~~~~~~~~pl~~  452 (1122)
T 1w36_C          373 SITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADIDSYSPFIQAVFGSAPADRYLPYAISDRRARQSHPVLE  452 (1122)
T ss_dssp             SSEEEEESSHHHHHHHHHHHHHHHHHHSTTCCGGGEEEEESCHHHHHHHHHHHTSCCSSTTCCCCEECSEETGGGCHHHH
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCCCEEEECCCHHHHHHHHHHHHHCCCCCCCCCEEECCCHHHHCCHHHH
T ss_conf             88999759989999999999999974288888212678728879889999998610245678872413520432058999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCCCCC--CCCCHHHHHHHHHHHHHHHHCCCCC-------------CCCCC-CHHHHH
Q ss_conf             9999999983799978999986296545--6679389999999732232104557-------------77811-178887
Q gi|254780823|r  429 ILTSLLNAIFKLNDFMAIATLVKHPLAK--FGFPEKYLSRAKNALELVALRGNKN-------------SYDIM-DLKSLV  492 (1040)
Q Consensus       429 ~l~~ll~~~~~~~~~~~l~~LL~sPl~~--~~~~~~~~~~~~~~~~~~~~~~~~~-------------~~~~~-~l~~~~  492 (1040)
                      .+++++++..++++..+++++|++|.+.  ++.+.........-......+.+..             ...+. .+....
T Consensus       453 ~l~~lL~l~~~r~~~~~vl~lL~~p~l~~~f~l~~~~~~~l~~~~~~~gir~g~~~~~~~~~~~~~~~~~tw~~~l~Rll  532 (1122)
T 1w36_C          453 AFISLLSLPDSRFVSEDVLALLDVPVLAARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLTRML  532 (1122)
T ss_dssp             HHHHHTTGGGCCCCHHHHHHHTTSHHHHHHTTCCHHHHHHHHHHHHHHTCCSCSCHHHHHHTTCCCCSSSSHHHHHHHHH
T ss_pred             HHHHHHHHHHCCCCHHHHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHHCCCCCCCCCHHHHHHHHH
T ss_conf             99999987417999999999976814232138987899999999998087657435667876045211134877677776


Q ss_pred             HHHCCCCCCC-CCCCCHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             5220114444-345520101553432579999999899999987501100221023788999999999997236763211
Q gi|254780823|r  493 LDRIATQKNN-THVPHWQSRLSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRK  571 (1040)
Q Consensus       493 ~~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~l~~~l~~~l~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~  571 (1040)
                      .......... ................    +...+...+..+...   ........++.+|...+...++.........
T Consensus       533 lg~~~~~~~~~~~~~~p~~~~~~~~~~----~l~~~~~~l~~L~~~---~~~l~~~~t~~~w~~~l~~lL~~~~~~~~~~  605 (1122)
T 1w36_C          533 LGYAMESAQGEWQSVLPYDESSGLIAE----LVGHLASLLMQLNIW---RRGLAQERPLEEWLPVCRDMLNAFFLPDAET  605 (1122)
T ss_dssp             HHHSSCSTTCCSSSCCCCTTSCSSTHH----HHHHHHHHHHHHHHH---HHHTSSCEEHHHHTTHHHHHHHHHCCCCSHH
T ss_pred             HHHHHHHHHHHHHCCCCCHHHHHHHHH----HHHHHHHHHHHHHHH---HHHHCCCCCHHHHHHHHHHHHHHHHCCCHHH
T ss_conf             543201345564123450012222699----999999999999999---9997188989999999999999974888668


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCCCCEEEECCCCC
Q ss_conf             14566577799999999866421376644778899999986224433566778773798034333566586378528631
Q gi|254780823|r  572 LPNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNE  651 (1040)
Q Consensus       572 ~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~v~~~~~a~~~~~~~v~v~gl~e  651 (1040)
                      ..  ........+....+..........++...+..++...+........... ++|+|++++.+++.+|++|+++|+||
T Consensus       606 ~~--~~~~~~~~l~~l~~~~~~~~~~~~l~l~~~~~~L~~~l~~~~~~~~~~~-~~V~v~tl~~~R~ipfkvVfllGlnd  682 (1122)
T 1w36_C          606 EA--AMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFLA-GPVNICTLMPMRSIPFKVVCLLGMND  682 (1122)
T ss_dssp             HH--HHHHHHHHHHHHHHHHHHTCCCSEECHHHHHHHHHHHHHHCEECTTTTS-SSCEEECCCTTCCCCEEEEEEECCBT
T ss_pred             HH--HHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCCCCCCC-CCEEEECCHHHCCCCCCEEEEEECCC
T ss_conf             99--9999999999999999872367643899999999987401345678989-97698112553578867699973366


Q ss_pred             CCCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHH-CCCEEEEEEECCC--CCCCCCCCHHHHHHHHCCCCCCH
Q ss_conf             13456666676489678856489996678889999999985-5985999920467--77665665378887731473100
Q gi|254780823|r  652 GVWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMAN-GTRHLIYTRSLRE--NNIPTIASRWLQRLLVLGGTDFF  728 (1040)
Q Consensus       652 ~~~P~~~~~~~~l~~~~r~~l~l~~~e~~~~~~~~~~~~~~-~a~~v~lt~~~~~--~~~~~~ps~~l~~l~~~~~~~~~  728 (1040)
                      |.||.....++|.....+...|.+.....  ..+.+|..++ +..++++||+..+  ++.+..||.++.++.........
T Consensus       683 g~fP~~~~~~~fdl~~~~~~~gd~~~~~e--dr~lfl~al~sA~~~L~lSy~~~~~~~~~~~~PS~~l~eL~d~l~~~~~  760 (1122)
T 1w36_C          683 GVYPRQLAPLGFDLMSQKPKRGDRSRRDD--DRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQELIDYIGQSHY  760 (1122)
T ss_dssp             TTSSCCCCCCSSCHHHHSCCTTCCCHHHH--HHHHHHHHHHHEEEEEEEEEECBCSSSCCBCCBCHHHHHHHHHHHTTEE
T ss_pred             CCCCCCCCCCCCCCHHHCCCCCCCHHHHH--HHHHHHHHHHHHHHHHEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHCC
T ss_conf             75766566666531544236688106578--9999999999754423144412327899834877899999999974235


Q ss_pred             HHCCCC------------------------------C---CCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCHH
Q ss_conf             001136------------------------------5---3223478752101234345475567630012467780045
Q gi|254780823|r  729 DNLKKR------------------------------G---QCYLDWTRKLDYTTKQPHYKRPKPFPPLEAQPRTYSFSEI  775 (1040)
Q Consensus       729 ~~~~~~------------------------------~---~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~lS~S~l  775 (1040)
                      ......                              .   .....+.......   .........+.....+..+|+|.+
T Consensus       761 ~~~~~~~~~~~~~~~~~~~l~~~h~l~~fs~~~f~~~~~~~~~~~~~~~~~~~---~~~~~~~~~~l~~~~~~~ls~s~L  837 (1122)
T 1w36_C          761 LPGDEALNCDESEARVKAHLTCLHTRMPFDPQNYQPGERQSYAREWLPAASQA---GKAHSEFVQPLPFTLPETVPLETL  837 (1122)
T ss_dssp             CSSCSSSCHHHHHHHHHHHHCCBCCSSTTSGGGSSSSTTCCSCGGGHHHHTTC---CCCCCCSCCCCCCCCCSCEEHHHH
T ss_pred             CCCCCCCCCCCHHHHHHHHHHCCCCCCCCCHHHHHCCCCCCCHHHHHHHHCCC---CCCCCCCCCCCCCCCCCCCCHHHH
T ss_conf             77743346320046788654012667888855530043234409998763254---556764456899877884489999


Q ss_pred             HHHHCCHHHHHHHHHCCCCCCCCCC-------CCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCCC
Q ss_conf             7764283688897632888887212-------489988998999999999986125898347899999999999653279
Q gi|254780823|r  776 KQLINDPYAVYARRILKLDFIPHFK-------KDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHFEKENL  848 (1040)
Q Consensus       776 ~~~~~cP~~~~~~~~l~l~~~~~~~-------~~~~a~~~GtlvH~~Le~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~  848 (1040)
                      ++|.+||++||++++|++...+...       ..+++..++++.|.+|+.+...   ...+.....+..      ....+
T Consensus       838 ~~f~~~P~~~fl~~~L~~~~~~~~~~~~d~Ep~~ld~L~~~~l~~~ll~~~l~~---~~~~~~~~~~~~------~g~LP  908 (1122)
T 1w36_C          838 QRFWAHPVRAFFQMRLQVNFRTEDSEIPDTEPFILEGLSRYQINQQLLNALVEQ---DDAERLFRRFRA------AGDLP  908 (1122)
T ss_dssp             HHHSSSHHHHHHHTTTCCCCCCSCCCCCSSCCSSCCHHHHHHHHHHHHHHHHTT---CCHHHHHHHHHH------HTCSC
T ss_pred             HHHHHCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCC---CCHHHHHHHHHH------CCCCC
T ss_conf             999979689999974488886212245556866677065524999999998718---999999999997------59999


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEECCCCEEEEEEEEEEEECCCCCEEEEECCCCCCCCHHH
Q ss_conf             86699999999999999999999732468859999965688978823799999978888799858999726853468879
Q gi|254780823|r  849 PPHIDIIWRHLFHKISHSFLEHEEKIQSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKET  928 (1040)
Q Consensus       849 ~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~E~~~~~~i~~~~~~l~GrIDRid~~~dG~~~IvDYKTG~~p~~~~  928 (1040)
                      +......++.+....+..++..........    .+.++.+.++  +++|+|+||+|.  +||   +|.|++|+... ++
T Consensus       909 ~g~~g~~~~~~~~~~~~~l~~~~~~~~~~~----~~~~~~l~~~--~~~L~G~l~~v~--~~~---~v~~~~~~~~~-~~  976 (1122)
T 1w36_C          909 YGAFGEIFWETQCQEMQQLADRVIACRQPG----QSMEIDLACN--GVQITGWLPQVQ--PDG---LLRWRPSLLSV-AQ  976 (1122)
T ss_dssp             SHHHHHHHHHHHHHHHHHHHHHHHTTCCCC----EEEEEEEEET--TEEEEEEEEEEC--SSE---EEEECSSCCCH-HH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHCCCC----CCEEEEEEEC--CEEEEEEECCCC--CCC---EEEEEECCCCH-HH
T ss_conf             825569999999999999999998706888----8634898409--889999889862--683---59997278987-88


Q ss_pred             HHCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             84230121699999998288677785574213888606866554345654558988899999999999999984889
Q gi|254780823|r  929 AQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSLKNLIEIVTLLQNGE 1005 (1040)
Q Consensus       929 ~~~~~~~QL~lY~~~~~~~~~~~~~~~~~~~~~y~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~ 1005 (1040)
                      .     .++.++-+++...+.      ......++  +.+......     ..+    .++....|..++.-|..|.
T Consensus       977 ~-----l~~wl~hL~~~a~~~------~~~~~~~~--~~~~~~~~~-----p~~----~~~A~~~L~~l~~~~~~g~ 1031 (1122)
T 1w36_C          977 G-----MQLWLEHLVYCASGG------NGESRLFL--RKDGEWRFP-----PLA----AEQALHYLSQLIEGYREGM 1031 (1122)
T ss_dssp             H-----HHHHHHHHHHHHTSC------CCEEEEEC--GGGCEEEEC-----CCC----HHHHHHHHHHHHHHHHHTT
T ss_pred             H-----HHHHHHHHHHHHCCC------CCCEEEEE--ECCCEEEEC-----CCC----HHHHHHHHHHHHHHHHHHH
T ss_conf             9-----999999999982699------99728999--769679989-----989----7999999999999999983



>1w36_B RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 c.52.1.24 PDB: 3k70_B* Back     alignment and structure
>1pjr_A PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} SCOP: c.37.1.19 c.37.1.19 PDB: 1qhg_A* 3pjr_A* 2pjr_A* 1qhh_B* 1qhh_D* 1qhh_A* 1qhh_C* 2pjr_B* Back     alignment and structure
>2is6_A DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2.20A {Escherichia coli} PDB: 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1uaa_A REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 Back     alignment and structure
>3h4r_A Exodeoxyribonuclease 8; exonuclease, recombination, hydrolase; 2.80A {Escherichia coli k-12} Back     alignment and structure
>3l0a_A Putative exonuclease; RER070207002219, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: PE4; 2.19A {Eubacterium rectale} Back     alignment and structure
>3dmn_A Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, structural genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>2vld_A NUCS, UPF0286 protein pyrab01260; endonuclease, hydrolase; 2.60A {Pyrococcus abyssi} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1040 double-strand break repair protein AddB [Candidatus Lib
d1w36c2470 Exodeoxyribonuclease V gamma chain (RecC), N-terminal d 99.96
d1uaaa2333 DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 5 99.86
d1pjra2333 DEXX box DNA helicase {Bacillus stearothermophilus, Pcr 99.81
g1qhh.1623 DEXX box DNA helicase {Bacillus stearothermophilus, Pcr 99.95
d1w36b2395 Exodeoxyribonuclease V beta chain (RecB), N-terminal do 99.78
d1w36c1347 Exodeoxyribonuclease V gamma chain (RecC), N-terminal d 99.42
d1pjra1318 DEXX box DNA helicase {Bacillus stearothermophilus, Pcr 98.47
d1uaaa1306 DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 5 98.1
d1w36b3276 Exodeoxyribonuclease V beta chain (RecB), C-terminal do 99.28
d1w36b1485 Exodeoxyribonuclease V beta chain (RecB), N-terminal do 99.15
d1w36c3304 Exodeoxyribonuclease V beta chain (RecC), C-terminal do 97.48
>d1w36c2 c.37.1.19 (C:348-817) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Tandem AAA-ATPase domain
domain: Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=4e-26  Score=184.77  Aligned_cols=360  Identities=14%  Similarity=0.115  Sum_probs=223.5

Q ss_pred             CCCCCEEEECCCHHHHHHHHHHHHHHHHHH-C---CCEEEEEECCCCHHHHHHHH-----HHHHCCCCCCCCCCHHHHCH
Q ss_conf             337815995599899999999999998642-2---98499980264113578884-----35513777665690035288
Q gi|254780823|r  355 CFSDVALIEADNEREEAISIAIALRMSLDE-N---KKKSALITADRNLARRVKLE-----LTRFGINIDISAGIPLSTTL  425 (1040)
Q Consensus       355 ~~~~v~~~~a~~~~~Ea~~ia~~lr~~~~~-~---~~~~avv~~d~~~~~~v~~~-----L~~~gipv~~s~g~pL~~~p  425 (1040)
                      ...+|+++.|+++.+|++.|++.|++.... +   +++|+|++|+...+.++..+     +...+||+.++++.++..+|
T Consensus        23 ~D~si~i~~c~~~~rEvE~l~~~I~~~l~~~~~~~~~DIaVl~r~~~~Y~~~I~~vF~~~~~~~~IPy~i~~~~~~~~~p  102 (470)
T d1w36c2          23 LDSSITFHVCHSPQREVEVLHDRLLAMLEEDPTLTPRDIIVMVADIDSYSPFIQAVFGSAPADRYLPYAISDRRARQSHP  102 (470)
T ss_dssp             TCCSSEEEEESSHHHHHHHHHHHHHHHHHHSTTCCGGGEEEEESCHHHHHHHHHHHTSCCSSTTCCCCEECSEETGGGCH
T ss_pred             CCCCEEEEECCCHHHHHHHHHHHHHHHHHHCCCCCCCEEEEECCCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCCCCCH
T ss_conf             99988999799869999999999999997785979050788859768879999999815443578786985884122179


Q ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCCCC--CCCCCHHHHHHHHHHHHHHHHCCCCC----------CCCCCCHHHHHH
Q ss_conf             989999999998379997899998629654--56679389999999732232104557----------778111788875
Q gi|254780823|r  426 HSSILTSLLNAIFKLNDFMAIATLVKHPLA--KFGFPEKYLSRAKNALELVALRGNKN----------SYDIMDLKSLVL  493 (1040)
Q Consensus       426 ~v~~l~~ll~~~~~~~~~~~l~~LL~sPl~--~~~~~~~~~~~~~~~~~~~~~~~~~~----------~~~~~~l~~~~~  493 (1040)
                      .+.+++++|+++.++++..+++++|++|++  ..+..................+....          ......+.....
T Consensus       103 ~i~~ll~lL~l~~~~~~~~~l~~lL~~p~~~~~~~i~~~~~~~l~~~~~~~~i~~~~~~~~~~~~~~~~~~~~s~~~~~~  182 (470)
T d1w36c2         103 VLEAFISLLSLPDSRFVSEDVLALLDVPVLAARFDITEEGLRYLRQWVNESGIRWGIDDDNVRELELPATGQHTWRFGLT  182 (470)
T ss_dssp             HHHHHHHHTTGGGCCCCHHHHHHHTTSHHHHHHTTCCHHHHHHHHHHHHHHTCCSCSCHHHHHHTTCCCCSSSSHHHHHH
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHCCHHHHHCCCCCHHHHHHHHHHHHHHCCCHHHHHHHHHHHCCCHHHHCCHHHHHH
T ss_conf             99999999997608998189999868715310258987799999999998454324678878760231010124998876


Q ss_pred             HHCCCCCCCCCCCCHHHC-CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHCCCCCCCCH
Q ss_conf             220114444345520101-5534325799999998999999875011002210237889999999999972367632111
Q gi|254780823|r  494 DRIATQKNNTHVPHWQSR-LSEEDKELAVLLVDHILQCITPLVTYKTNKNSTCGNLSISDWTKLTVTCLQNVCLDEHRKL  572 (1040)
Q Consensus       494 ~~~~~~~~~~~~~~~~~~-~~~~~~~~~~~l~~~l~~~l~~l~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  572 (1040)
                      ..............+... ...............+...+..+...   .........+..|...+.............. 
T Consensus       183 r~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~---~~~~~~~~~l~~~~~~l~~~~~~~~~~~~~~-  258 (470)
T d1w36c2         183 RMLLGYAMESAQGEWQSVLPYDESSGLIAELVGHLASLLMQLNIW---RRGLAQERPLEEWLPVCRDMLNAFFLPDAET-  258 (470)
T ss_dssp             HHHHHHSSCSTTCCSSSCCCCTTSCSSTHHHHHHHHHHHHHHHHH---HHHTSSCEEHHHHTTHHHHHHHHHCCCCSHH-
T ss_pred             HHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH-
T ss_conf             543321000134555333346554335799999999999999999---9987344779999999998888874100345-


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCCCCEEEECCCCCC
Q ss_conf             45665777999999998664213766447788999999862244335667787737980343335665863785286311
Q gi|254780823|r  573 PNLWFEEEGKTLSSLFSKIIETGSCIKANAIEWIDIITRLIDGETVKPKIEKSSTLFILGTLESRLLNFDTLILGGLNEG  652 (1040)
Q Consensus       573 ~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~v~v~~~~~a~~~~~~~v~v~gl~e~  652 (1040)
                       ..........+....+..........++...+..++...+........... ++|+|||+|.++|++|++|||+|+|||
T Consensus       259 -~~~~~~~~~~l~~l~~~~~~~~~~~~~~l~~~~~~l~~~l~~~~~~~~~~~-d~V~v~tih~akglef~vVfl~Gl~eg  336 (470)
T d1w36c2         259 -EAAMTLIEQQWQAIIAEGLGAQYGDAVPLSLLRDELAQRLDQERISQRFLA-GPVNICTLMPMRSIPFKVVCLLGMNDG  336 (470)
T ss_dssp             -HHHHHHHHHHHHHHHHHHHHTCCCSEECHHHHHHHHHHHHHHCEECTTTTS-SSCEEECCCTTCCCCEEEEEEECCBTT
T ss_pred             -HHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCC-CCCEEECCHHHCCCCCCEEEEEEECCC
T ss_conf             -678999999999999999975113313699999999854321002445756-783773315324888888999983376


Q ss_pred             CCCCCCCCCCCCCHHHHHHCCCCCHHHHHHHHHHHHHHHHCCC-EEEEEEECCC--CCCCCCCCHHHHHHHHC
Q ss_conf             3456666676489678856489996678889999999985598-5999920467--77665665378887731
Q gi|254780823|r  653 VWPKNTAKNPFLSRVMQSDLNLKTAEKYIGQAAHDFEMANGTR-HLIYTRSLRE--NNIPTIASRWLQRLLVL  722 (1040)
Q Consensus       653 ~~P~~~~~~~~l~~~~r~~l~l~~~e~~~~~~~~~~~~~~~a~-~v~lt~~~~~--~~~~~~ps~~l~~l~~~  722 (1040)
                      .||.....+++.....+...+.+.....  ..+++|..+++++ ++++||+..+  .+.+..||+|+.++...
T Consensus       337 ~fP~~~~~~~~~~~~~~~~~~~~~~~~e--er~lfy~altrA~~~L~lSy~~~~~~~g~~~~PS~~i~el~~~  407 (470)
T d1w36c2         337 VYPRQLAPLGFDLMSQKPKRGDRSRRDD--DRYLFLEALISAQQKLYISYIGRSIQDNSERFPSVLVQELIDY  407 (470)
T ss_dssp             TSSCCCCCCSSCHHHHSCCTTCCCHHHH--HHHHHHHHHHHEEEEEEEEEECBCSSSCCBCCBCHHHHHHHHH
T ss_pred             EEECCCCCCHHHHHHHHHHCCCCHHHHH--HHHHHHHHHHHHHCEEEEEEECCCCCCCCCCCCCHHHHHHHHH
T ss_conf             1205556100002788776066112478--9999999998444049999824656687974887899999999



>d1uaaa2 c.37.1.19 (A:308-640) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1pjra2 c.37.1.19 (A:319-651) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1w36b2 c.37.1.19 (B:486-880) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36c1 c.37.1.19 (C:1-347) Exodeoxyribonuclease V gamma chain (RecC), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} Back     information, alignment and structure
>d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} Back     information, alignment and structure
>d1w36b3 c.52.1.24 (B:899-1174) Exodeoxyribonuclease V beta chain (RecB), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36b1 c.37.1.19 (B:1-485) Exodeoxyribonuclease V beta chain (RecB), N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w36c3 c.52.1.25 (C:818-1121) Exodeoxyribonuclease V beta chain (RecC), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 1040 double-strand break repair protein AddB [Candidatu
3h4r_A_265 (A:) Exodeoxyribonuclease 8; exonuclease, recombin 5e-21
3l0a_A_266 (A:) Putative exonuclease; RER070207002219, struct 6e-09
1w36_B_444-587_727-885303 (B:444-587,B:727-885) RECB, exodeoxyribonuclease V 0.001
>3h4r_A (A:) Exodeoxyribonuclease 8; exonuclease, recombination, hydrolase; 2.80A {Escherichia coli k-12}Length = 265 Back     alignment and structure
 Score = 98.2 bits (243), Expect = 5e-21
 Identities = 33/256 (12%), Positives = 59/256 (23%), Gaps = 20/256 (7%)

Query: 761  PPLEAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELI 820
                      S S++  + + P     R+   +D            D GT FH  + EL 
Sbjct: 4    MENYHAGPGISKSQLDDIADTPALYLWRKNAPVD-----TTKTKTLDLGTAFHCRVLELE 58

Query: 821  KKRINKNTPE-INHLMKQIIDSHFEKE-----NLPPHIDIIWRHLFHKISHSFLEHEEKI 874
            +           N       +                I          +  S +      
Sbjct: 59   EFSNRFIVAPEFNRRTNAGKEEEKAFLMECASTGKTVITAEEGRKIELMYQSVMALPLGQ 118

Query: 875  QSSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDITDYKTGDNPKKETAQKLI- 933
                                GI      D+I      F  I D KT  + ++        
Sbjct: 119  WLVESAGHAESSIYWEDPETGILCRCRPDKII---PEFHWIMDVKTTADIQRFKTAYYDY 175

Query: 934  --DPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKFKIDCITNDKKKYSADELSEKSL 991
                Q +  +   +A    Q        L      +  +         + +     ++  
Sbjct: 176  RYHVQDAFYSDGYEAQFGVQPT---FVFLVASTTIECGRYPVEIFMMGEEAKLAGQQEYH 232

Query: 992  KNLIEIVTLLQNGEQP 1007
            +NL  +   L   E P
Sbjct: 233  RNLRTLSDCLNTDEWP 248


>3l0a_A (A:) Putative exonuclease; RER070207002219, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: PE4; 2.19A {Eubacterium rectale}Length = 266 Back     alignment and structure
>1w36_B (B:444-587,B:727-885) RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli}Length = 303 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target1040 double-strand break repair protein AddB [Candidatus Lib
3h4r_A_265 Exodeoxyribonuclease 8; exonuclease, recombination 99.94
3l0a_A_266 Putative exonuclease; RER070207002219, structural 99.9
1w36_C_808-1035228 RECC, exodeoxyribonuclease V gamma chain; recombin 97.71
1w36_B_444-587_727-885303 RECB, exodeoxyribonuclease V beta chain; recombina 99.31
1w36_C_371-446_653-739_781-807190 RECC, exodeoxyribonuclease V gamma chain; recombin 99.28
3dmn_A_174 Putative DNA helicase; APC89291.2, lactobacillus p 97.25
1w36_D_361-595235 RECD, exodeoxyribonuclease V alpha chain; recombin 95.58
1uaa_A_278-376_544-673229 REP helicase, protein (ATP-dependent DNA helicase 99.2
1pjr_A_287-385_549-724275 PCRA; DNA repair, DNA replication, SOS response, h 99.13
1w36_B_886-964_1014-1180246 RECB, exodeoxyribonuclease V beta chain; recombina 99.14
2is6_A_284-381_547-680232 DNA helicase II; hydrolase/DNA complex; HET: DNA A 98.85
1uaa_A_1-102_185-277195 REP helicase, protein (ATP-dependent DNA helicase 98.27
2is6_A_1-106_189-283201 DNA helicase II; hydrolase/DNA complex; HET: DNA A 98.16
1pjr_A_1-107_194-286200 PCRA; DNA repair, DNA replication, SOS response, h 97.55
1w36_C_1-82_185-330228 RECC, exodeoxyribonuclease V gamma chain; recombin 98.23
1w36_B_1-148_349-443243 RECB, exodeoxyribonuclease V beta chain; recombina 98.2
1uaa_A_377-543167 REP helicase, protein (ATP-dependent DNA helicase 96.05
2is6_A_382-524143 DNA helicase II; hydrolase/DNA complex; HET: DNA A 96.05
1w36_B_588-726139 RECB, exodeoxyribonuclease V beta chain; recombina 95.83
1pjr_A_386-548163 PCRA; DNA repair, DNA replication, SOS response, h 95.03
2vld_A_122-251130 NUCS, UPF0286 protein pyrab01260; endonuclease, hy 95.46
>3h4r_A (A:) Exodeoxyribonuclease 8; exonuclease, recombination, hydrolase; 2.80A {Escherichia coli k-12} Back     alignment and structure
Probab=99.94  E-value=1.5e-27  Score=196.62  Aligned_cols=244  Identities=13%  Similarity=-0.046  Sum_probs=151.5

Q ss_pred             CCCCCCCCCCHHHHHHCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             01246778004577642836888976328888872124899889989999999999861258983478999999999996
Q gi|254780823|r  764 EAQPRTYSFSEIKQLINDPYAVYARRILKLDFIPHFKKDPDRTDRGTLFHNIITELIKKRINKNTPEINHLMKQIIDSHF  843 (1040)
Q Consensus       764 ~~~~~~lS~S~l~~~~~cP~~~~~~~~l~l~~~~~~~~~~~a~~~GtlvH~~Le~~~~~~~~~~~~~~~~~l~~~~~~~~  843 (1040)
                      ...+..+|+|.+++|..||++||+++++++++...     .++.+||++|.+|+.++..............+........
T Consensus         7 ~~~~~~~S~S~l~~~~~Cp~~~~~~~~~~~~~~~~-----~~~~~G~~~H~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (265)
T 3h4r_A            7 YHAGPGISKSQLDDIADTPALYLWRKNAPVDTTKT-----KTLDLGTAFHCRVLELEEFSNRFIVAPEFNRRTNAGKEEE   81 (265)
T ss_dssp             ----CCBCHHHHHHHHHCHHHHHHHTTSCCCCCCC-----SCCTHHHHHHHHHSSHHHHTCC------------------
T ss_pred             HCCCCCCCHHHHHHHHHCHHHHHHHHHCCCCCCCC-----HHHHHHHHHHHHHHCHHHHCCCCCCCCCHHHHHHHHHHHH
T ss_conf             44899839889999985999999997378999997-----7998729999987472232123324663023456666799


Q ss_pred             HHCCC------CHHHHHHHHHHHHHHHHHHHHHHHHCC--CCCEEEEEEEEEEEEECCCCEEEEEEEEEEEECCCCCEEE
Q ss_conf             53279------866999999999999999999997324--6885999996568897882379999997888879985899
Q gi|254780823|r  844 EKENL------PPHIDIIWRHLFHKISHSFLEHEEKIQ--SSIEKIFVNIPAKMAIESIGIHLTGFADRIDLLKSGFVDI  915 (1040)
Q Consensus       844 ~~~~~------~~~~~~~~~~~~~~~~~~~l~~~~~~~--~~~~~~~~E~~~~~~i~~~~~~l~GrIDRid~~~dG~~~I  915 (1040)
                      .....      .......+..++..++.++...+....  .......  .+..+.++..++.++|+||||+   +|.+.|
T Consensus        82 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--~e~~~~~~~~~~~l~G~iD~i~---~~~~~I  156 (265)
T 3h4r_A           82 KAFLMECASTGKTVITAEEGRKIELMYQSVMALPLGQWLVESAGHAE--SSIYWEDPETGILCRCRPDKII---PEFHWI  156 (265)
T ss_dssp             ----------------CCCTTHHHHHHHHHTTSHHHHHHHSSSCBSS--CCEEEECTTTCCEEEECCSEEE---GGGTEE
T ss_pred             HHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHCHHHHHHHHHCCCCE--EEEEEEECCCCEEEEEEEEEEE---CCCCEE
T ss_conf             99986555316542129999999999999982954676654202314--7899997676648888899997---799748


Q ss_pred             EECCCCCCCCHH---HHHCCCCCCHHHHHHHHHHCCCCCCCCCCCCCEEEEEECCCC--CCCCCCCCCCCCCHHHHHHHH
Q ss_conf             972685346887---984230121699999998288677785574213888606866--554345654558988899999
Q gi|254780823|r  916 TDYKTGDNPKKE---TAQKLIDPQLSLEAAALKAGSFSQIDCRKVANLFYIRLKQKF--KIDCITNDKKKYSADELSEKS  990 (1040)
Q Consensus       916 vDYKTG~~p~~~---~~~~~~~~QL~lY~~~~~~~~~~~~~~~~~~~~~y~~l~~~~--~~~~~~~~~~~~~~~~~~~~~  990 (1040)
                      ||||||+.++..   +...++.+||++|++++++.     .+..+....|+.+..+.  ..............++..+++
T Consensus       157 iDyKTg~~~~~~~~~~~~~~~~~Ql~lY~~~l~~~-----~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  231 (265)
T 3h4r_A          157 MDVKTTADIQRFKTAYYDYRYHVQDAFYSDGYEAQ-----FGVQPTFVFLVASTTIECGRYPVEIFMMGEEAKLAGQQEY  231 (265)
T ss_dssp             EEEEEESCHHHHHHHHHHHTTTHHHHHHHHHHHHH-----HSSCCEEEEEEEESSCBTTBCCEEEEECCHHHHHHHHHHH
T ss_pred             EEEEECCCHHHHHHCCCCCCHHHHHHHHHHHHHHH-----CCCCCCEEEEEEECCCCCCCCEEEEEECCHHHHHHHHHHH
T ss_conf             89830267776532012337799999999999984-----2999863999998335677622799968999999999999


Q ss_pred             HHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCHHH
Q ss_conf             999999999984889885555451015668986544
Q gi|254780823|r  991 LKNLIEIVTLLQNGEQPFISHLRLSEKSNIQSEYDH 1026 (1040)
Q Consensus       991 ~~~l~~~~~~~~~~~~~f~~~~~~~~~~~~~~~y~~ 1026 (1040)
                      .+.+..+...+.++..|    +......|.||+|+.
T Consensus       232 ~~~~~~~~~~~~~~~~~----~~~~~~~C~~C~~k~  263 (265)
T 3h4r_A          232 HRNLRTLSDCLNTDEWP----AIKTLSLPRWAKEYA  263 (265)
T ss_dssp             HHHHHHHHHHHHTCCCC----CCCCCCCCTTCTTCC
T ss_pred             HHHHHHHHHHHHCCCCC----CCCCCCCCCCCCCCC
T ss_conf             99999999999669799----986467884511000



>3l0a_A (A:) Putative exonuclease; RER070207002219, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: PE4; 2.19A {Eubacterium rectale} Back     alignment and structure
>1w36_C (C:808-1035) RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} Back     alignment and structure
>1w36_B (B:444-587,B:727-885) RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} Back     alignment and structure
>1w36_C (C:371-446,C:653-739,C:781-807) RECC, exodeoxyribonuclease V gamma chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} Back     alignment and structure
>3dmn_A (A:) Putative DNA helicase; APC89291.2, lactobacillus plantarum WCFS1, structural genomics, PSI-2, midwest center for structural genomics; HET: MSE; 1.66A {Lactobacillus plantarum} Back     alignment and structure
>1w36_D (D:361-595) RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} Back     alignment and structure
>1uaa_A (A:278-376,A:544-673) REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} Back     alignment and structure
>1pjr_A (A:287-385,A:549-724) PCRA; DNA repair, DNA replication, SOS response, helicase, ATP- binding, DNA-binding; 2.50A {Geobacillus stearothermophilus} Back     alignment and structure
>1w36_B (B:886-964,B:1014-1180) RECB, exodeoxyribonuclease V beta chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} Back     alignment and structure
>2is6_A (A:284-381,A:547-680) DNA helicase II; hydrolase/DNA complex; HET: DNA ADP; 2.20A {Escherichia coli} PDB: 2is2_A* 2is1_A* 2is4_A* Back     alignment and structure
>1uaa_A (A:1-102,A:185-277) REP helicase, protein (ATP-dependent DNA helicase REP.); complex (helicase/DNA), DNA unwinding, hydrolase/DNA complex; HET: DNA; 3.00A {Escherichia coli} Back     alignment and structure