254780824

254780824

hypothetical protein CLIBASIA_03585

GeneID in NCBI database:8209830Locus tag:CLIBASIA_03585
Protein GI in NCBI database:254780824Protein Accession:YP_003065237.1
Gene range:+(426394, 426882)Protein Length:162aa
Gene description:hypothetical protein
COG prediction:[R] Predicted ATPase or kinase
KEGG prediction:hypothetical protein
SEED prediction:ATPase YjeE, predicted to have essential role in cell wall biosynthesis / Predicted phosphotransferase related to Ser/Thr protein kinases
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160--
MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ
cccccccEEEEEEccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHccccccccccccEEEEEEEcccccEEEEEEEEEccHHHHHHccHHHHccccEEEEEcHHHHHcccccHHEEEEEEEcccccEEEEEEccHHHHHHHHHHHHHHcc
cccccccEEEEEcccHHHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHcccccccccccccEEEEEEccccccEEEEEEEEcccHHHHHHcccHHHccccEEEEEccHccccccccccEEEEEEEccccEEEEEEcHHHHHHHHHHcccccccc
mnfsekhltvipipneknticlGRHLASILRLGdcltlsgdlgsgksFLARSIIRFLMHddalevlsptfTLVQLydasipvahfdfyrlssHQEVVELGFDEILNERiciiewpeigrsllpkkYIDIHlsqgktgrkaTISAERWIISHINQmnrstsqq
mnfsekhltvipipnekntICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHlsqgktgrkaTISAERWIIShinqmnrstsqq
MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ
**********IPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHI***N******
MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQ********
****EKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQM*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ
MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ
MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHDDALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRSLLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target162 hypothetical protein CLIBASIA_03585 [Candidatus Liberib
315122048170 hypothetical protein CKC_01490 [Candidatus Liberibacter 1 1e-64
86355697 504 hypothetical protein RHE_CH00029 [Rhizobium etli CFN 42 1 3e-36
190889669 503 hypothetical protein RHECIAT_CH0000030 [Rhizobium etli 1 7e-36
327192797 503 hypothetical protein RHECNPAF_192005 [Rhizobium etli CN 1 7e-36
241206972 505 hypothetical protein Rleg_4289 [Rhizobium leguminosarum 1 7e-35
116249795 505 hypothetical protein RL0029 [Rhizobium leguminosarum bv 1 8e-35
209551533 503 hypothetical protein Rleg2_3962 [Rhizobium leguminosaru 1 1e-34
218461896 493 hypothetical protein RetlK5_21498 [Rhizobium etli Kim 5 1 2e-34
150398437 504 hypothetical protein Smed_3245 [Sinorhizobium medicae W 1 5e-32
15887385 503 hypothetical protein Atu0026 [Agrobacterium tumefaciens 1 2e-31
>gi|315122048|ref|YP_004062537.1| hypothetical protein CKC_01490 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 170 Back     alignment and organism information
 Score =  249 bits (635), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 118/162 (72%), Positives = 139/162 (85%)

Query: 1   MNFSEKHLTVIPIPNEKNTICLGRHLASILRLGDCLTLSGDLGSGKSFLARSIIRFLMHD 60
           MNFS+ H T+I +P+EK+TI LG  LA +L+LGDCLTLSGDLGSGKSFLARSIIRFL ++
Sbjct: 1   MNFSDTHSTIISLPHEKDTILLGHTLAYVLKLGDCLTLSGDLGSGKSFLARSIIRFLSNN 60

Query: 61  DALEVLSPTFTLVQLYDASIPVAHFDFYRLSSHQEVVELGFDEILNERICIIEWPEIGRS 120
           + LEVLSPTFTLVQLY+ASIP+AHFDFYRLSSHQE+ ELGFDEILNER+CIIEWP+IG+ 
Sbjct: 61  NELEVLSPTFTLVQLYEASIPIAHFDFYRLSSHQELFELGFDEILNERLCIIEWPDIGKE 120

Query: 121 LLPKKYIDIHLSQGKTGRKATISAERWIISHINQMNRSTSQQ 162
           LLP + I IHL Q K GRKATI + +WIISH+NQM    SQ+
Sbjct: 121 LLPSQCICIHLEQEKNGRKATILSSKWIISHLNQMINQASQE 162


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86355697|ref|YP_467589.1| hypothetical protein RHE_CH00029 [Rhizobium etli CFN 42] Length = 504 Back     alignment and organism information
>gi|190889669|ref|YP_001976211.1| hypothetical protein RHECIAT_CH0000030 [Rhizobium etli CIAT 652] Length = 503 Back     alignment and organism information
>gi|327192797|gb|EGE59725.1| hypothetical protein RHECNPAF_192005 [Rhizobium etli CNPAF512] Length = 503 Back     alignment and organism information
>gi|241206972|ref|YP_002978068.1| hypothetical protein Rleg_4289 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 505 Back     alignment and organism information
>gi|116249795|ref|YP_765633.1| hypothetical protein RL0029 [Rhizobium leguminosarum bv. viciae 3841] Length = 505 Back     alignment and organism information
>gi|209551533|ref|YP_002283450.1| hypothetical protein Rleg2_3962 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 503 Back     alignment and organism information
>gi|218461896|ref|ZP_03501987.1| hypothetical protein RetlK5_21498 [Rhizobium etli Kim 5] Length = 493 Back     alignment and organism information
>gi|150398437|ref|YP_001328904.1| hypothetical protein Smed_3245 [Sinorhizobium medicae WSM419] Length = 504 Back     alignment and organism information
>gi|15887385|ref|NP_353066.1| hypothetical protein Atu0026 [Agrobacterium tumefaciens str. C58] Length = 503 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target162 hypothetical protein CLIBASIA_03585 [Candidatus Liberib
pfam02367123 pfam02367, UPF0079, Uncharacterized P-loop hydrolase UP 1e-26
TIGR00150133 TIGR00150, HI0065_YjeE, ATPase, YjeE family 3e-26
PRK10646153 PRK10646, PRK10646, ADP-binding protein; Provisional 4e-24
COG0802149 COG0802, COG0802, Predicted ATPase or kinase [General f 3e-34
>gnl|CDD|111276 pfam02367, UPF0079, Uncharacterized P-loop hydrolase UPF0079 Back     alignment and domain information
>gnl|CDD|129254 TIGR00150, HI0065_YjeE, ATPase, YjeE family Back     alignment and domain information
>gnl|CDD|182615 PRK10646, PRK10646, ADP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|31145 COG0802, COG0802, Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 162 hypothetical protein CLIBASIA_03585 [Candidatus Liberib
PRK10646153 putative ATPase; Provisional 100.0
COG0802149 Predicted ATPase or kinase [General function prediction 100.0
TIGR00150147 TIGR00150 conserved hypothetical protein TIGR00150; Int 100.0
pfam02367123 UPF0079 Uncharacterized P-loop hydrolase UPF0079. This 100.0
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 96.91
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 96.53
COG1485 367 Predicted ATPase [General function prediction only] 96.51
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 96.49
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 95.96
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 95.83
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 95.3
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 95.25
pfam03969 361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 95.19
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 95.18
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 94.92
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 94.7
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 93.96
COG0593 408 DnaA ATPase involved in DNA replication initiation [DNA 93.65
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 93.2
pfam07693 301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 97.37
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 97.07
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.72
pfam08298 358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.65
pfam02492174 cobW CobW/HypB/UreG, nucleotide-binding domain. This do 96.6
TIGR02640 265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 96.57
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 96.39
cd03112158 CobW_like The function of this protein family is unkown 96.37
KOG0743 457 consensus 96.37
PRK11537 317 putative GTP-binding protein YjiA; Provisional 96.2
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 96.03
TIGR02475 349 CobW cobalamin biosynthesis protein CobW; InterPro: IPR 96.03
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 96.01
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.0
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 95.74
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 95.71
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 95.68
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 95.58
COG0523 323 Putative GTPases (G3E family) [General function predict 95.57
COG4178604 ABC-type uncharacterized transport system, permease and 95.57
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 95.56
KOG3877 393 consensus 95.53
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 95.46
TIGR02928 383 TIGR02928 orc1/cdc6 family replication initiation prote 95.34
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 95.3
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 95.3
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.29
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 95.26
KOG0651388 consensus 95.26
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 95.23
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.19
cd04119168 RJL RJL (RabJ-Like) subfamily. RJLs are found in many p 95.15
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 95.1
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 95.1
pfam08477118 Miro Miro-like protein. Mitochondrial Rho proteins (Mir 95.05
KOG0989 346 consensus 94.97
pfam00931 285 NB-ARC NB-ARC domain. 94.96
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 94.92
cd04130173 Wrch_1 Wrch-1 subfamily. Wrch-1 (Wnt-1 responsive Cdc42 94.92
cd04157162 Arl6 Arl6 subfamily. Arl6 (Arf-like 6) forms a subfamil 94.9
cd01862172 Rab7 Rab7 subfamily. Rab7 is a small Rab GTPase that re 94.79
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 94.78
cd01875191 RhoG RhoG subfamily. RhoG is a GTPase with high sequenc 94.7
PRK13342 417 recombination factor protein RarA; Reviewed 94.67
KOG1970 634 consensus 94.61
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 94.6
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 94.56
cd00154159 Rab Rab family. Rab GTPases form the largest family wit 94.52
cd04162164 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily. Arl9 (Arf- 94.51
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 94.48
smart00175164 RAB Rab subfamily of small GTPases. Rab GTPases are imp 94.47
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 94.42
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 94.38
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 94.33
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 94.25
pfam03266168 DUF265 Protein of unknown function, DUF265. 94.23
PRK06090 319 DNA polymerase III subunit delta'; Validated 94.21
cd04138162 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily. H-Ras, N-Ra 94.13
cd01863161 Rab18 Rab18 subfamily. Mammalian Rab18 is implicated in 94.13
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 94.09
smart00173164 RAS Ras subfamily of RAS small GTPases. Similar in fold 94.08
PHA02244 383 ATPase-like protein 94.08
COG0410237 LivF ABC-type branched-chain amino acid transport syste 94.07
cd01860163 Rab5_related Rab5-related subfamily. This subfamily inc 94.07
KOG0733 802 consensus 93.96
COG4555245 NatA ABC-type Na+ transport system, ATPase component [E 93.91
COG0470 325 HolB ATPase involved in DNA replication [DNA replicatio 93.8
cd01864165 Rab19 Rab19 subfamily. Rab19 proteins are associated wi 93.78
cd04122166 Rab14 Rab14 subfamily. Rab14 GTPases are localized to b 93.77
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 93.76
cd00157171 Rho Rho (Ras homology) family. Members of the Rho famil 93.73
cd04137180 RheB Rheb (Ras Homolog Enriched in Brain) subfamily. Rh 93.71
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 93.7
cd04159159 Arl10_like Arl10-like subfamily. Arl9/Arl10 was identif 93.62
cd04108170 Rab36_Rab34 Rab34/Rab36 subfamily. Rab34, found primari 93.55
PRK13341 726 recombination factor protein RarA/unknown domain fusion 93.54
cd04139164 RalA_RalB RalA/RalB subfamily. The Ral (Ras-like) subfa 93.51
cd04172182 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily. Rnd3/RhoE/Rho8 93.5
PRK13695174 putative NTPase; Provisional 93.38
cd04116170 Rab9 Rab9 subfamily. Rab9 is found in late endosomes, t 93.36
cd04140165 ARHI_like ARHI subfamily. ARHI (A Ras homolog member I) 93.34
cd04141172 Rit_Rin_Ric Rit/Rin/Ric subfamily. Rit (Ras-like protei 93.3
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 93.29
cd01893166 Miro1 Miro1 subfamily. Miro (mitochondrial Rho) protein 93.29
cd01861161 Rab6 Rab6 subfamily. Rab6 is involved in microtubule-de 93.23
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 93.21
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 93.2
cd04110199 Rab35 Rab35 subfamily. Rab35 is one of several Rab prot 93.07
cd04175164 Rap1 Rap1 subgroup. The Rap1 subgroup is part of the Ra 93.04
cd04132187 Rho4_like Rho4-like subfamily. Rho4 is a GTPase that co 93.02
TIGR01188 343 drrA daunorubicin resistance ABC transporter, ATP-bindi 93.0
cd01867167 Rab8_Rab10_Rab13_like Rab8/Sec4/Ypt2. Rab8/Sec4/Ypt2 ar 93.0
PTZ00132209 GTP-binding nuclear protein; Provisional 92.99
cd04145164 M_R_Ras_like M-Ras/R-Ras-like subfamily. This subfamily 92.95
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 97.27
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.25
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 97.1
PRK06696227 uridine kinase; Validated 96.93
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 96.89
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 96.88
TIGR02673215 FtsE cell division ATP-binding protein FtsE; InterPro: 96.86
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.79
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 96.76
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 96.74
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.72
PRK07667190 uridine kinase; Provisional 96.66
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.63
PRK06547184 hypothetical protein; Provisional 96.6
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.58
PRK08233182 hypothetical protein; Provisional 96.56
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 96.53
PRK13851343 type IV secretion system protein VirB11; Provisional 96.52
PRK04195 403 replication factor C large subunit; Provisional 96.5
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 96.5
PRK13833323 conjugal transfer protein TrbB; Provisional 96.49
PRK05480209 uridine kinase; Provisional 96.49
smart00763 361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.49
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 96.45
PRK00131175 aroK shikimate kinase; Reviewed 96.41
PRK13948182 shikimate kinase; Provisional 96.35
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 96.31
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 96.28
PRK00411 394 cdc6 cell division control protein 6; Reviewed 96.28
PRK09270230 frcK putative fructose transport system kinase; Reviewe 96.27
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.27
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 96.26
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 96.24
KOG0744 423 consensus 96.22
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 96.22
PRK12402 337 replication factor C small subunit 2; Reviewed 96.21
PRK13542224 consensus 96.2
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 96.16
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 96.15
PRK13946195 shikimate kinase; Provisional 96.15
PTZ00301210 uridine kinase; Provisional 96.14
PRK08154304 anaerobic benzoate catabolism transcriptional regulator 96.13
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 96.12
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 96.1
PRK09984 262 phosphonate/organophosphate ester transporter subunit; 96.08
pfam00004131 AAA ATPase family associated with various cellular acti 96.0
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 95.98
PRK07429 331 phosphoribulokinase; Provisional 95.98
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 95.97
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 95.97
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 95.96
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 95.95
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 95.94
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.94
PRK03731172 aroL shikimate kinase II; Reviewed 95.93
PRK05057172 aroK shikimate kinase I; Reviewed 95.93
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 95.93
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 95.93
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.92
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 95.92
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 95.92
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 95.91
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.89
smart00382148 AAA ATPases associated with a variety of cellular activ 95.89
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.89
PRK13949169 shikimate kinase; Provisional 95.89
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 95.89
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 95.87
PRK13638 271 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.87
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 95.86
cd03246173 ABCC_Protease_Secretion This family represents the ABC 95.86
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.86
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 95.86
PRK13547 273 hmuV hemin importer ATP-binding subunit; Provisional 95.86
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 95.85
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 95.84
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 95.84
pfam07726131 AAA_3 ATPase family associated with various cellular ac 95.84
PRK03695245 vitamin B12-transporter ATPase; Provisional 95.83
KOG2004 906 consensus 95.83
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 95.82
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 95.81
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 95.8
cd03289 275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 95.8
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 95.79
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 95.78
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 95.78
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 95.78
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 95.78
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 95.77
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 95.77
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 95.76
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 95.76
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 95.76
PRK10744257 phosphate transporter subunit; Provisional 95.74
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.74
PRK13544208 consensus 95.73
PRK08116262 hypothetical protein; Validated 95.73
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 95.71
PRK13947171 shikimate kinase; Provisional 95.71
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 95.69
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 95.69
PRK03992390 proteasome-activating nucleotidase; Provisional 95.69
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.68
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; Prov 95.67
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 95.67
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 95.67
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 95.66
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.66
COG1131 293 CcmA ABC-type multidrug transport system, ATPase compon 95.64
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 95.64
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 95.63
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.63
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 95.62
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 95.62
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.61
PRK00440 318 rfc replication factor C small subunit; Reviewed 95.61
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 95.61
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 95.6
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 95.6
PRK10789569 putative multidrug transporter membrane\ATP-binding com 95.58
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.58
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 95.57
PRK10908222 cell division protein FtsE; Provisional 95.57
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.56
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.55
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 95.55
TIGR03522 301 GldA_ABC_ATP gliding motility-associated ABC transporte 95.55
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 95.55
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 95.54
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 95.54
PRK10253 265 iron-enterobactin transporter ATP-binding protein; Prov 95.54
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 95.53
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 95.53
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 95.52
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.52
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 95.52
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 95.51
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.5
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 95.49
PRK07261171 topology modulation protein; Provisional 95.49
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 95.49
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.47
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 95.47
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 95.46
PRK13647 273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.46
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.45
PRK05541176 adenylylsulfate kinase; Provisional 95.44
PRK11144 352 modC molybdate transporter ATP-binding protein; Provisi 95.44
PRK13537 304 lipooligosaccharide transporter ATP-binding subunit; Pr 95.44
cd02026 273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 95.43
PRK13644 274 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.42
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 95.41
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 95.41
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 95.41
PRK11022 327 dppD dipeptide transporter ATP-binding subunit; Provisi 95.41
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 95.4
PRK10790593 putative multidrug transporter membrane\ATP-binding com 95.38
PRK08939306 primosomal protein DnaI; Reviewed 95.38
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 95.37
PRK11147 632 ABC transporter ATPase component; Reviewed 95.37
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 95.36
cd03234226 ABCG_White The White subfamily represents ABC transport 95.36
PRK13636 285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.35
PRK13651 304 cobalt transporter ATP-binding subunit; Provisional 95.35
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 95.34
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 95.33
PRK00625173 shikimate kinase; Provisional 95.33
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 95.33
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 95.33
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 95.32
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 95.3
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 95.3
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.29
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 95.26
PRK10522547 multidrug transporter membrane component/ATP-binding co 95.25
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 95.25
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.24
PRK13536 306 nodulation factor exporter subunit NodI; Provisional 95.24
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 95.22
PRK06067241 flagellar accessory protein FlaH; Validated 95.22
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 95.19
PRK13650 276 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.18
PRK13640 283 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.17
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 95.17
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 95.17
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.16
PRK13642 277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.16
PRK09473 330 oppD oligopeptide transporter ATP-binding component; Pr 95.16
PRK06921265 hypothetical protein; Provisional 95.15
PRK10762501 D-ribose transporter ATP binding protein; Provisional 95.15
PRK13764 605 ATPase; Provisional 95.15
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 95.15
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 95.14
PRK11308 327 dppF dipeptide transporter ATP-binding subunit; Provisi 95.14
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.12
PRK11147 632 ABC transporter ATPase component; Reviewed 95.12
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 95.12
COG1120 258 FepC ABC-type cobalamin/Fe3+-siderophores transport sys 95.1
TIGR00382 452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 95.09
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 95.08
pfam06745231 KaiC KaiC. This family represents a conserved region wi 95.07
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.06
PRK13632 273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.06
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.05
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 95.05
COG1474 366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 95.04
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 95.04
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 95.03
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 95.02
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 95.01
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 95.01
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.0
PRK13639 275 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.0
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 95.0
COG0467 260 RAD55 RecA-superfamily ATPases implicated in signal tra 94.99
PRK13634 276 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.98
PRK13633 281 cobalt transporter ATP-binding subunit; Provisional 94.95
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 94.94
PRK09700510 D-allose transporter ATP-binding protein; Provisional 94.93
PRK04328250 hypothetical protein; Provisional 94.92
COG1100219 GTPase SAR1 and related small G proteins [General funct 94.91
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 94.9
PRK10851 352 sulfate/thiosulfate transporter subunit; Provisional 94.89
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 94.87
COG2884223 FtsE Predicted ATPase involved in cell division [Cell d 94.85
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 94.85
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 94.84
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 94.82
PRK11153 343 metN DL-methionine transporter ATP-binding subunit; Pro 94.79
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 94.78
COG1123539 ATPase components of various ABC-type transport systems 94.77
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.77
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.77
PRK11650 358 ugpC glycerol-3-phosphate transporter ATP-binding subun 94.76
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 94.75
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 94.74
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.73
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 94.71
PRK00889175 adenylylsulfate kinase; Provisional 94.7
PRK13641 286 cbiO cobalt transporter ATP-binding subunit; Provisiona 94.7
PRK01184183 hypothetical protein; Provisional 94.68
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 94.68
PRK13407 334 bchI magnesium chelatase subunit I; Provisional 94.66
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 94.65
PRK09452 378 potA putrescine/spermidine ABC transporter ATPase prote 94.65
COG0488 530 Uup ATPase components of ABC transporters with duplicat 94.62
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 94.62
PRK03846198 adenylylsulfate kinase; Provisional 94.61
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 94.61
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 94.6
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 94.6
COG4088 261 Predicted nucleotide kinase [Nucleotide transport and m 94.59
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 94.59
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 94.58
COG1855 604 ATPase (PilT family) [General function prediction only] 94.55
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 94.54
PRK00023225 cmk cytidylate kinase; Provisional 94.54
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 94.53
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 94.53
pfam03308 267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 94.51
PRK00081199 coaE dephospho-CoA kinase; Reviewed 94.5
cd03271 261 ABC_UvrA_II The excision repair protein UvrA domain II; 94.5
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 94.5
PRK13951 488 bifunctional shikimate kinase/3-dehydroquinate synthase 94.48
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 94.46
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 94.42
PRK11000 369 maltose/maltodextrin transporter ATP-binding protein; P 94.42
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 94.4
TIGR01192 592 chvA glucan exporter ATP-binding protein; InterPro: IPR 94.4
PRK13768 253 GTPase; Provisional 94.39
PRK00080 328 ruvB Holliday junction DNA helicase RuvB; Reviewed 94.39
cd03115173 SRP The signal recognition particle (SRP) mediates the 94.39
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 94.38
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 94.37
PRK10982 491 galactose/methyl galaxtoside transporter ATP-binding pr 94.37
PRK08903227 hypothetical protein; Validated 94.35
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 94.35
KOG1969 877 consensus 94.35
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 94.33
COG1118 345 CysA ABC-type sulfate/molybdate transport systems, ATPa 94.32
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 94.32
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 94.28
PRK00300208 gmk guanylate kinase; Provisional 94.27
TIGR02142 361 modC_ABC molybdate ABC transporter, ATP-binding protein 94.25
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 94.24
pfam12128 1192 DUF3584 Protein of unknown function (DUF3584). This pro 94.23
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 94.23
PRK04182178 cytidylate kinase; Provisional 94.22
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 94.22
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 94.2
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 94.2
COG3638258 ABC-type phosphate/phosphonate transport system, ATPase 94.18
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 94.18
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 94.17
PRK06835330 DNA replication protein DnaC; Validated 94.15
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 94.13
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 94.13
COG0714 329 MoxR-like ATPases [General function prediction only] 94.08
PRK11388 639 DNA-binding transcriptional regulator DhaR; Provisional 94.07
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 94.01
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 93.98
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provisiona 93.95
COG2255 332 RuvB Holliday junction resolvasome, helicase subunit [D 93.94
PRK07952242 DNA replication protein DnaC; Validated 93.93
KOG1532 366 consensus 93.93
PRK10436 461 hypothetical protein; Provisional 93.93
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 93.9
CHL00081 347 chlI Mg-protoporyphyrin IX chelatase 93.84
TIGR00955 671 3a01204 Pigment precourser permease; InterPro: IPR00528 93.83
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 93.82
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 93.81
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 93.8
COG1341 398 Predicted GTPase or GTP-binding protein [General functi 93.79
TIGR03185 650 DNA_S_dndD DNA sulfur modification protein DndD. This m 93.78
PRK05564 313 DNA polymerase III subunit delta'; Validated 93.77
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 93.77
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 93.77
COG4559 259 ABC-type hemin transport system, ATPase component [Inor 93.72
PRK00698204 tmk thymidylate kinase; Validated 93.65
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 93.64
COG1484254 DnaC DNA replication protein [DNA replication, recombin 93.63
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 93.62
pfam03029 234 ATP_bind_1 Conserved hypothetical ATP binding protein. 93.58
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 93.54
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 93.52
COG3842 352 PotA ABC-type spermidine/putrescine transport systems, 93.51
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 93.51
COG0488530 Uup ATPase components of ABC transporters with duplicat 93.5
PRK11608 325 pspF phage shock protein operon transcriptional activat 93.5
COG1129 500 MglA ABC-type sugar transport system, ATPase component 93.47
pfam06068 395 TIP49 TIP49 C-terminus. This family consists of the C-t 93.47
TIGR02528144 EutP ethanolamine utilization protein, EutP; InterPro: 93.4
PRK06217185 hypothetical protein; Validated 93.38
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 93.37
PRK08084235 DNA replication initiation factor; Provisional 93.37
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 93.36
cd02029 277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 93.36
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 93.36
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 93.33
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 93.3
cd01394218 radB RadB. The archaeal protein radB shares similarity 93.27
PRK00771 433 signal recognition particle protein Srp54; Provisional 93.22
pfam00308219 Bac_DnaA Bacterial dnaA protein. 93.2
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 93.19
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 93.17
PRK09112 352 DNA polymerase III subunit delta'; Validated 93.14
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 93.1
PRK12377248 putative replication protein; Provisional 93.09
PRK05642234 DNA replication initiation factor; Validated 93.07
COG1224 450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 93.06
COG3839 338 MalK ABC-type sugar transport systems, ATPase component 93.06
PRK05342 411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 93.05
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 93.04
PRK10246 1047 exonuclease subunit SbcC; Provisional 93.03
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 93.02
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 93.01
pfam01202158 SKI Shikimate kinase. 92.99
PRK09435 325 arginine/ornithine transport system ATPase; Provisional 92.99
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 92.97
CHL00176 631 ftsH cell division protein; Validated 92.96
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 92.94
PRK13409 590 putative ATPase RIL; Provisional 95.49
PRK08118167 topology modulation protein; Reviewed 95.47
cd00876160 Ras Ras family. The Ras family of the Ras superfamily i 95.45
cd04124161 RabL2 RabL2 subfamily. RabL2 (Rab-like2) subfamily. Rab 95.03
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 94.95
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 94.92
TIGR00635 305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 94.8
cd04125188 RabA_like RabA-like subfamily. RabA was first identifie 94.78
cd04118193 Rab24 Rab24 subfamily. Rab24 is distinct from other Rab 94.62
pfam06431 417 Polyoma_lg_T_C Polyomavirus large T antigen C-terminus. 94.6
pfam00071162 Ras Ras family. Includes sub-families Ras, Rab, Rac, Ra 94.52
cd04121189 Rab40 Rab40 subfamily. This subfamily contains Rab40a, 94.44
cd04106162 Rab23_lke Rab23-like subfamily. Rab23 is a member of th 94.41
cd04128182 Spg1 Spg1p. Spg1p (septum-promoting GTPase) was first i 94.39
cd04123162 Rab21 Rab21 subfamily. The localization and function of 94.34
cd04114169 Rab30 Rab30 subfamily. Rab30 appears to be associated w 94.2
cd01869166 Rab1_Ypt1 Rab1/Ypt1 subfamily. Rab1 is found in every e 93.99
smart00174174 RHO Rho (Ras homology) subfamily of Ras-like small GTPa 93.83
cd04117161 Rab15 Rab15 subfamily. Rab15 colocalizes with the trans 93.82
cd00877166 Ran Ran (Ras-related nuclear proteins) /TC4 subfamily o 93.8
PRK03839180 putative kinase; Provisional 93.7
cd04135174 Tc10 TC10 subfamily. TC10 is a Rho family protein that 93.61
cd01868165 Rab11_like Rab11-like. Rab11a, Rab11b, and Rab25 are cl 93.58
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 93.39
cd01870175 RhoA_like RhoA-like subfamily. The RhoA subfamily consi 93.11
>PRK10646 putative ATPase; Provisional Back     alignment and domain information
>COG0802 Predicted ATPase or kinase [General function prediction only] Back     alignment and domain information
>TIGR00150 TIGR00150 conserved hypothetical protein TIGR00150; InterPro: IPR003442 This group consists of bacterial proteins, which contain a P-loop Back     alignment and domain information
>pfam02367 UPF0079 Uncharacterized P-loop hydrolase UPF0079 Back     alignment and domain information
>PRK07133 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06645 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG1485 Predicted ATPase [General function prediction only] Back     alignment and domain information
>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR014155 This entry contains VirB11, a protein that is found in the vir locus of Agrobacterium Ti plasmids where it is involved in the type IV secretion system for DNA transfer Back     alignment and domain information
>PRK05896 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06647 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK08451 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06305 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>pfam03969 AFG1_ATPase AFG1-like ATPase Back     alignment and domain information
>PRK07764 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK06674 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK05563 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK07270 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>pfam07693 KAP_NTPase KAP family P-loop domain Back     alignment and domain information
>PRK09111 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>pfam08298 AAA_PrkA PrkA AAA domain Back     alignment and domain information
>pfam02492 cobW CobW/HypB/UreG, nucleotide-binding domain Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462 The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd03112 CobW_like The function of this protein family is unkown Back     alignment and domain information
>KOG0743 consensus Back     alignment and domain information
>PRK11537 putative GTP-binding protein YjiA; Provisional Back     alignment and domain information
>PRK12323 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>TIGR02475 CobW cobalamin biosynthesis protein CobW; InterPro: IPR012824 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>PRK07003 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>PRK08853 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>COG3267 ExeA Type II secretory pathway, component ExeA (predicted ATPase) [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR02397 dnaX_nterm DNA polymerase III, subunits gamma and tau; InterPro: IPR012763 This entry represents the well-conserved first N-terminal domain of DnaX, approx Back     alignment and domain information
>PRK06872 DNA polymerase III subunits gamma and tau; Provisional Back     alignment and domain information
>COG0523 Putative GTPases (G3E family) [General function prediction only] Back     alignment and domain information
>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>KOG3877 consensus Back     alignment and domain information
>PRK08691 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>TIGR02928 TIGR02928 orc1/cdc6 family replication initiation protein; InterPro: IPR014277 This set of DNA binding proteins shows homology to the origin recognition complex subunit 1/cell division control protein 6 family in eukaryotes Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>cd04160 Arfrp1 Arfrp1 subfamily Back     alignment and domain information
>pfam05729 NACHT NACHT domain Back     alignment and domain information
>PRK05648 DNA polymerase III subunits gamma and tau; Reviewed Back     alignment and domain information
>KOG0651 consensus Back     alignment and domain information
>PRK07994 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04119 RJL RJL (RabJ-Like) subfamily Back     alignment and domain information
>PRK10078 ribose 1,5-bisphosphokinase; Provisional Back     alignment and domain information
>PRK08770 DNA polymerase III subunits gamma and tau; Validated Back     alignment and domain information
>pfam08477 Miro Miro-like protein Back     alignment and domain information
>KOG0989 consensus Back     alignment and domain information
>pfam00931 NB-ARC NB-ARC domain Back     alignment and domain information
>cd04102 RabL3 RabL3 (Rab-like3) subfamily Back     alignment and domain information
>cd04130 Wrch_1 Wrch-1 subfamily Back     alignment and domain information
>cd04157 Arl6 Arl6 subfamily Back     alignment and domain information
>cd01862 Rab7 Rab7 subfamily Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>cd01875 RhoG RhoG subfamily Back     alignment and domain information
>PRK13342 recombination factor protein RarA; Reviewed Back     alignment and domain information
>KOG1970 consensus Back     alignment and domain information
>COG2812 DnaX DNA polymerase III, gamma/tau subunits [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>cd00154 Rab Rab family Back     alignment and domain information
>cd04162 Arl9_Arfrp2_like Arl9/Arfrp2-like subfamily Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>smart00175 RAB Rab subfamily of small GTPases Back     alignment and domain information
>COG0464 SpoVK ATPases of the AAA+ class [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00878 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) small GTPases Back     alignment and domain information
>cd04153 Arl5_Arl8 Arl5/Arl8 subfamily Back     alignment and domain information
>cd04155 Arl3 Arl3 subfamily Back     alignment and domain information
>pfam03266 DUF265 Protein of unknown function, DUF265 Back     alignment and domain information
>PRK06090 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>cd04138 H_N_K_Ras_like H-Ras/N-Ras/K-Ras subfamily Back     alignment and domain information
>cd01863 Rab18 Rab18 subfamily Back     alignment and domain information
>cd04107 Rab32_Rab38 Rab38/Rab32 subfamily Back     alignment and domain information
>smart00173 RAS Ras subfamily of RAS small GTPases Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd01860 Rab5_related Rab5-related subfamily Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>COG0470 HolB ATPase involved in DNA replication [DNA replication, recombination, and repair] Back     alignment and domain information
>cd01864 Rab19 Rab19 subfamily Back     alignment and domain information
>cd04122 Rab14 Rab14 subfamily Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd00157 Rho Rho (Ras homology) family Back     alignment and domain information
>cd04137 RheB Rheb (Ras Homolog Enriched in Brain) subfamily Back     alignment and domain information
>cd04176 Rap2 Rap2 subgroup Back     alignment and domain information
>cd04159 Arl10_like Arl10-like subfamily Back     alignment and domain information
>cd04108 Rab36_Rab34 Rab34/Rab36 subfamily Back     alignment and domain information
>PRK13341 recombination factor protein RarA/unknown domain fusion protein; Reviewed Back     alignment and domain information
>cd04139 RalA_RalB RalA/RalB subfamily Back     alignment and domain information
>cd04172 Rnd3_RhoE_Rho8 Rnd3/RhoE/Rho8 subfamily Back     alignment and domain information
>PRK13695 putative NTPase; Provisional Back     alignment and domain information
>cd04116 Rab9 Rab9 subfamily Back     alignment and domain information
>cd04140 ARHI_like ARHI subfamily Back     alignment and domain information