254780826

254780826

phosphoenolpyruvate carboxykinase

GeneID in NCBI database:8209832Locus tag:CLIBASIA_03595
Protein GI in NCBI database:254780826Protein Accession:YP_003065239.1
Gene range:-(421864, 423393)Protein Length:509aa
Gene description:phosphoenolpyruvate carboxykinase
COG prediction:none
KEGG prediction:pckA; phosphoenolpyruvate carboxykinase (EC:4.1.1.49); K01610 phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
SEED prediction:Phosphoenolpyruvate carboxykinase [ATP] (EC 4.1.1.49)
Pathway involved in KEGG:Glycolysis / Gluconeogenesis [PATH:las00010]
Citrate cycle (TCA cycle) [PATH:las00020]
Pyruvate metabolism [PATH:las00620]
Subsystem involved in SEED:Pyruvate metabolism I: anaplerotic reactions, PEP
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------51
MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI
ccccccccHHHHHccccHHHHHHHHHHHcccEEcccccEEEEccccccccccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEEEEEccHHHEEEEEEEEcHHHHHHHHHHHcccccHHHHHcccccEEEEEcccccccccccccccccEEEEEEcccEEEEEccHHHHHHHHHHHHHHHHHHHHcccEEEEcccccccccccEEEEEEcccccHHHHHccccccEEccccccccccEEEEcccccEEEEccccHHHHHHHHHHHHHHccEEEEEEEccccccccccccHHHcEEEEcccHHccccccccccccHHHHHHHHHHHHcccHHHHHccHHHHHHHHcccHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHHHHHHHccEEEEEEccccccccccccEEcHHHHHHHHHHHHcccccccEEEEcccccccccEEcccccHHHccHHHccccHHHHHHHHHHHHHHHHHHHHHHHHcc
cHHcccccccEEEccccHHHHHHHHHHHHccEEcccccEEEcccccccccHHHEEEEccccccccccccccccccHHHHHHHHHHHHHHHccccEEEEEccccccccccccHEEEHHHHHHHHHHHHHcccccHHHHHcccccEEEEEcccccccccccccccccEEEEEccccEEEEEcccccHHHHHHHHHHHHHHcHHHccEEEcEEEEEccccccEEEEEccccccHHHHHcccccEEEEcccEEEccccEEEcccEEEEEcccccccccHHHHHcHHccccEEEccEEcccccEcccccccccccEEEEEHHHccccccccEEccEEEEEEEEcccccccccEEEEcHHHHHHHHHHcEEEEccccEccccccEEEEcHHHcHHHccccHHHHHHHHHHHHHHHccEEEEEEccEcccccEccHEccHHHHHHHHHHHHcccHHHccEEEEccccEEEEcccccccHHHHcHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccc
mekfdlegssrvyrnlstsrLYEESIRREKTILTCDGALraltgqhtgrsafdkfivrdshtendvfwennkyispadfdTLKADMLDYIKDKDLFLQDlvacphtknaISVCVVTQYAWHSLFIRNLLKHkedlgavpnmmSLQVVVlpdfsadpnrhgccseTIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNhifpergimpmhcsinmdkeKEDVALFfglsgtgkttlsaSVDRfligddehgwskegvfnfeggcyaksinlsketepeifSASCRFGTVLENVVvdecgipnfkdssvtentraayplnfihnhapqsigkhpkHVIMLAADafgvlppvaylnpEKAVYYFLSGYTakvagtekgvlkpeatfsacfgapfmprdpvqygniLKDYIVKYCVDCwlvntgwtagsygegyrmPLSVTRALLKAIFDnsiksvpyrvdenfgfsvplevkgvdrkllnprdswndVEAYDQKMRELLLMFENNAEKKQIKI
mekfdlegssrvyrnlstsrlyeesiRREKTILTCDGALraltgqhtgrsafdkfivrdshtendvfwennkyispadFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSgtgkttlsASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLevkgvdrkllnprdswndVEAYDQKMRELLLMFennaekkqiki
MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI
*EKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQ***
**********RVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI
MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIK*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI
MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI
MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
315122050511 phosphoenolpyruvate carboxykinase [Candidatus Liberibac 1 0.0
325291488536 phosphoenolpyruvate carboxykinase [Agrobacterium sp. H1 1 1e-180
159184132536 phosphoenolpyruvate carboxykinase [Agrobacterium tumefa 1 1e-179
27127146536 phosphoenol pyruvate carboxykinase [Agrobacterium sp. N 1 1e-179
209551541536 phosphoenolpyruvate carboxykinase [Rhizobium leguminosa 1 1e-176
110635830536 phosphoenolpyruvate carboxykinase [Mesorhizobium sp. BN 1 1e-176
13474250536 phosphoenolpyruvate carboxykinase [Mesorhizobium loti M 1 1e-176
86355705536 phosphoenolpyruvate carboxykinase [Rhizobium etli CFN 4 1 1e-175
190889678536 phosphoenolpyruvate carboxykinase [Rhizobium etli CIAT 1 1e-175
163757497531 phosphoenolpyruvate carboxykinase [Hoeflea phototrophic 1 1e-175
>gi|315122050|ref|YP_004062539.1| phosphoenolpyruvate carboxykinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 511 Back     alignment and organism information
 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/504 (81%), Positives = 454/504 (90%), Gaps = 1/504 (0%)

Query: 1   MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDS 60
           MEKF+LEGSS VY N STSRLYEESIRREKTILTC GALRALTGQHTGRS+ DKFIVRD 
Sbjct: 1   MEKFNLEGSSCVYYNFSTSRLYEESIRREKTILTCHGALRALTGQHTGRSSLDKFIVRDD 60

Query: 61  HTENDVFWENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAW 120
            TE  V WE+NK ISPA+F  LKADMLDYIK K+LF QDLVACPHTKNA+SV +VTQYAW
Sbjct: 61  STEEGVCWESNKGISPANFSVLKADMLDYIKGKELFEQDLVACPHTKNALSVRIVTQYAW 120

Query: 121 HSLFIRNLLKHKEDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGLILIGG 180
           HSLF RNLLKH+E+L ++PN ++LQV+VLPDFSADP RH C SETIIA+DL+AGLILIGG
Sbjct: 121 HSLFARNLLKHREELSSIPNTINLQVIVLPDFSADPIRHACRSETIIAIDLSAGLILIGG 180

Query: 181 TSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDR 240
           TSYAGEIKKS+FTYLN+ FPERGIMPMHCSIN  KE  DVALFFGLSGTGKTTLSAS DR
Sbjct: 181 TSYAGEIKKSIFTYLNYTFPERGIMPMHCSINTGKEG-DVALFFGLSGTGKTTLSASSDR 239

Query: 241 FLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPN 300
            LIGDDEHGW++EGVFNFE GCYAKSINLSKE EPEIFSASCRFGTV ENV V+E G+P+
Sbjct: 240 VLIGDDEHGWNEEGVFNFESGCYAKSINLSKEMEPEIFSASCRFGTVFENVTVNEHGVPD 299

Query: 301 FKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYF 360
           FKD+S TENTRAAYPL+F+ N+A +SIG HPK+ IMLAADAFGVLPP+AYLNPE+AVYYF
Sbjct: 300 FKDASYTENTRAAYPLHFVPNYAQKSIGGHPKNAIMLAADAFGVLPPIAYLNPEQAVYYF 359

Query: 361 LSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGW 420
           LSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDP+QYG ILKDYI+KY VDCWLVNTGW
Sbjct: 360 LSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPMQYGKILKDYIIKYQVDCWLVNTGW 419

Query: 421 TAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDS 480
           TAG YGEGYRMP+ VTR+LL AIFD+SIK+V YRVDENFGFSVP+EVKGVDRK+LNPRDS
Sbjct: 420 TAGPYGEGYRMPIDVTRSLLDAIFDHSIKNVAYRVDENFGFSVPIEVKGVDRKILNPRDS 479

Query: 481 WNDVEAYDQKMRELLLMFENNAEK 504
           W++ EAYD KM+ELL MF++N  K
Sbjct: 480 WDNGEAYDHKMKELLSMFKHNFAK 503


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325291488|ref|YP_004277352.1| phosphoenolpyruvate carboxykinase [Agrobacterium sp. H13-3] Length = 536 Back     alignment and organism information
>gi|159184132|ref|NP_353074.2| phosphoenolpyruvate carboxykinase [Agrobacterium tumefaciens str. C58] Length = 536 Back     alignment and organism information
>gi|27127146|gb|AAN86775.1|AF450091_1 phosphoenol pyruvate carboxykinase [Agrobacterium sp. NRCPB-10] Length = 536 Back     alignment and organism information
>gi|209551541|ref|YP_002283458.1| phosphoenolpyruvate carboxykinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 536 Back     alignment and organism information
>gi|110635830|ref|YP_676038.1| phosphoenolpyruvate carboxykinase [Mesorhizobium sp. BNC1] Length = 536 Back     alignment and organism information
>gi|13474250|ref|NP_105818.1| phosphoenolpyruvate carboxykinase [Mesorhizobium loti MAFF303099] Length = 536 Back     alignment and organism information
>gi|86355705|ref|YP_467597.1| phosphoenolpyruvate carboxykinase [Rhizobium etli CFN 42] Length = 536 Back     alignment and organism information
>gi|190889678|ref|YP_001976220.1| phosphoenolpyruvate carboxykinase [Rhizobium etli CIAT 652] Length = 536 Back     alignment and organism information
>gi|163757497|ref|ZP_02164586.1| phosphoenolpyruvate carboxykinase [Hoeflea phototrophica DFL-43] Length = 531 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
cd00484508 cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykinase ( 0.0
COG1866529 COG1866, PckA, Phosphoenolpyruvate carboxykinase (ATP) 0.0
PRK09344526 PRK09344, PRK09344, phosphoenolpyruvate carboxykinase; 0.0
PTZ00311561 PTZ00311, PTZ00311, phosphoenolpyruvate carboxykinase; 1e-165
TIGR00224532 TIGR00224, pckA, phosphoenolpyruvate carboxykinase (ATP 1e-147
PLN02597555 PLN02597, PLN02597, phosphoenolpyruvate carboxykinase [ 1e-144
cd01919515 cd01919, PEPCK, Phosphoenolpyruvate carboxykinase (PEPC 1e-103
cd00820107 cd00820, PEPCK_HprK, Phosphoenolpyruvate carboxykinase 8e-11
PRK11831269 PRK11831, PRK11831, putative ABC transporter ATP-bindin 0.002
pfam01293451 pfam01293, PEPCK_ATP, Phosphoenolpyruvate carboxykinase 0.0
>gnl|CDD|29830 cd00484, PEPCK_ATP, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>gnl|CDD|32051 COG1866, PckA, Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181788 PRK09344, PRK09344, phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>gnl|CDD|185549 PTZ00311, PTZ00311, phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>gnl|CDD|161774 TIGR00224, pckA, phosphoenolpyruvate carboxykinase (ATP) Back     alignment and domain information
>gnl|CDD|178207 PLN02597, PLN02597, phosphoenolpyruvate carboxykinase [ATP] Back     alignment and domain information
>gnl|CDD|29834 cd01919, PEPCK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>gnl|CDD|73237 cd00820, PEPCK_HprK, Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>gnl|CDD|183331 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|144771 pfam01293, PEPCK_ATP, Phosphoenolpyruvate carboxykinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
PTZ00311543 phosphoenolpyruvate carboxykinase; Provisional 100.0
TIGR00224549 pckA phosphoenolpyruvate carboxykinase (ATP); InterPro: 100.0
cd00484508 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a 100.0
PRK09344525 phosphoenolpyruvate carboxykinase; Provisional 100.0
COG1866529 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy pr 100.0
cd01919515 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a crit 100.0
pfam00821586 PEPCK Phosphoenolpyruvate carboxykinase. Catalyses the 99.58
cd00819579 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a 99.56
PRK04210610 phosphoenolpyruvate carboxykinase; Provisional 99.42
pfam01293451 PEPCK_ATP Phosphoenolpyruvate carboxykinase. 100.0
COG1274608 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy pr 99.0
cd00820107 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a 98.62
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 93.46
COG4175386 ProV ABC-type proline/glycine betaine transport system, 92.72
COG1493308 HprK Serine kinase of the HPr protein, regulates carboh 90.78
PRK06217185 hypothetical protein; Validated 90.32
KOG3749640 consensus 97.78
COG1127263 Ttg2A ABC-type transport system involved in resistance 95.46
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 95.12
TIGR02142361 modC_ABC molybdate ABC transporter, ATP-binding protein 94.79
PRK10789569 putative multidrug transporter membrane\ATP-binding com 91.01
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 90.92
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 90.27
COG1052324 LdhA Lactate dehydrogenase and related dehydrogenases [ 94.72
PRK06436303 glycerate dehydrogenase; Provisional 94.48
PRK06487317 glycerate dehydrogenase; Provisional 93.82
PRK06932314 glycerate dehydrogenase; Provisional 92.91
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 92.87
PRK08605332 D-lactate dehydrogenase; Validated 91.47
COG4148352 ModC ABC-type molybdate transport system, ATPase compon 94.4
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 94.38
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 93.54
PRK05541176 adenylylsulfate kinase; Provisional 93.3
PRK03846198 adenylylsulfate kinase; Provisional 92.22
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 92.2
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 92.16
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 91.66
PRK00889175 adenylylsulfate kinase; Provisional 90.19
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 94.01
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 91.42
>PTZ00311 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>TIGR00224 pckA phosphoenolpyruvate carboxykinase (ATP); InterPro: IPR001272 Phosphoenolpyruvate carboxykinase (PEPCK) catalyses the first committed (rate-limiting) step in hepatic gluconeogenesis, namely the reversible decarboxylation of oxaloacetate to phosphoenolpyruvate (PEP) and carbon dioxide, using either ATP or GTP as a source of phosphate Back     alignment and domain information
>cd00484 PEPCK_ATP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK09344 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>COG1866 PckA Phosphoenolpyruvate carboxykinase (ATP) [Energy production and conversion] Back     alignment and domain information
>cd01919 PEPCK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>pfam00821 PEPCK Phosphoenolpyruvate carboxykinase Back     alignment and domain information
>cd00819 PEPCK_GTP Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>PRK04210 phosphoenolpyruvate carboxykinase; Provisional Back     alignment and domain information
>pfam01293 PEPCK_ATP Phosphoenolpyruvate carboxykinase Back     alignment and domain information
>COG1274 PckA Phosphoenolpyruvate carboxykinase (GTP) [Energy production and conversion] Back     alignment and domain information
>cd00820 PEPCK_HprK Phosphoenolpyruvate carboxykinase (PEPCK), a critical gluconeogenic enzyme, catalyzes the first committed step in the diversion of tricarboxylic acid cycle intermediates toward gluconeogenesis Back     alignment and domain information
>cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1493 HprK Serine kinase of the HPr protein, regulates carbohydrate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>KOG3749 consensus Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter; InterPro: IPR005897 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02142 modC_ABC molybdate ABC transporter, ATP-binding protein; InterPro: IPR011868 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462 The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit; InterPro: IPR005892 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family; InterPro: IPR014324 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK05541 adenylylsulfate kinase; Provisional Back     alignment and domain information
>PRK03846 adenylylsulfate kinase; Provisional Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam05496 RuvB_N Holliday junction DNA helicase ruvB N-terminus Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK00889 adenylylsulfate kinase; Provisional Back     alignment and domain information
>TIGR02868 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) family, permease/ATP-binding protein CydC; InterPro: IPR014223 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK05506 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
1j3b_A529 Crystal Structure Of Atp-Dependent Phosphoenolpyruv 0.0
1ayl_A541 Phosphoenolpyruvate Carboxykinase Length = 541 1e-169
1k3c_A540 Phosphoenolpyruvate Carboxykinase In Complex With A 1e-169
2py7_X540 Crystal Structure Of E. Coli Phosphoenolpyruvate Ca 1e-169
1ygg_A560 Crystal Structure Of Phosphoenolpyruvate Carboxykin 1e-166
1oen_A540 Phosphoenolpyruvate Carboxykinase Length = 540 1e-165
1yvy_A532 Crystal Strucutre Of Anaerobiospirillum Succinicipr 1e-158
1ii2_A524 Crystal Structure Of Phosphoenolpyruvate Carboxykin 1e-140
gi|28948413|pdb|1J3B|A Chain A, Crystal Structure Of Atp-Dependent Phosphoenolpyruvate Carboxykinase From Thermus Thermophilus Hb8 Length = 529 Back     alignment and structure
 Score =  637 bits (1644), Expect = 0.0,   Method: Composition-based stats.
 Identities = 250/515 (48%), Positives = 335/515 (65%), Gaps = 7/515 (1%)

Query: 1   MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDS 60
           +E   +    RV+ N  +  L E ++ R + +L   G L   T  +TGRS  DKF+VR+ 
Sbjct: 4   LEALGIHPKKRVFWNTVSPVLVEHTLLRGEGLLAHHGPLVVDTTPYTGRSPKDKFVVREP 63

Query: 61  HTENDVFWE-NNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYA 119
             E +++W   N+  +P  F+ L   ++ Y+ ++DL++QDL A    +  ++V VVT+  
Sbjct: 64  EVEGEIWWGEVNQPFAPEAFEALYQRVVQYLSERDLYVQDLYAGADRRYRLAVRVVTESP 123

Query: 120 WHSLFIRNLLKHK----EDLGAVPNMMSLQVVVLPDFSADPNRHGCCSETIIAVDLTAGL 175
           WH+LF RN+         D      +    VV  P F A P R G  SE  + +     L
Sbjct: 124 WHALFARNMFILPRRFGNDDEVEAFVPGFTVVHAPYFQAVPERDGTRSEVFVGISFQRRL 183

Query: 176 ILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLS 235
           +LI GT YAGEIKKS+FT +N++ P+RG+ PMH S N+ KE  DVA+FFGLSGTGKTTLS
Sbjct: 184 VLIVGTKYAGEIKKSIFTVMNYLMPKRGVFPMHASANVGKEG-DVAVFFGLSGTGKTTLS 242

Query: 236 ASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVD- 294
              +R LIGDDEHGWS++GVFNFEGGCYAK I LS E EP I+ AS +F  +LENVVV+ 
Sbjct: 243 TDPERPLIGDDEHGWSEDGVFNFEGGCYAKVIRLSPEHEPLIYKASNQFEAILENVVVNP 302

Query: 295 ECGIPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPE 354
           E     + D S TENTR++YP+  + N     +  HP+ +  L+ADA+GVLPP+A L+PE
Sbjct: 303 ESRRVQWDDDSKTENTRSSYPIAHLENVVESGVAGHPRAIFFLSADAYGVLPPIARLSPE 362

Query: 355 KAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCW 414
           +A+YYFLSGYTA+VAGTE+GV +P ATFSACFGAPF+P  P  Y  +L + I K+    +
Sbjct: 363 EAMYYFLSGYTARVAGTERGVTEPRATFSACFGAPFLPMHPGVYARMLGEKIRKHAPRVY 422

Query: 415 LVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKL 474
           LVNTGWT G YG GYR PL VTRALLKA    ++++VPYR D  FGF VPLE  GV ++L
Sbjct: 423 LVNTGWTGGPYGVGYRFPLPVTRALLKAALSGALENVPYRRDPVFGFEVPLEAPGVPQEL 482

Query: 475 LNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI 509
           LNPR++W D EAYDQ+ R+L  +F+ N +K    +
Sbjct: 483 LNPRETWADKEAYDQQARKLARLFQENFQKYASGV 517


>gi|157830145|pdb|1AYL|A Chain A, Phosphoenolpyruvate Carboxykinase Length = 541 Back     alignment and structure
gi|18158988|pdb|1K3C|A Chain A, Phosphoenolpyruvate Carboxykinase In Complex With Adp, Alf3 And Pyruvate Length = 540 Back     alignment and structure
>gi|185177560|pdb|2PY7|X Chain X, Crystal Structure Of E. Coli Phosphoenolpyruvate Carboxykinase Mutant Lys213ser Complexed With Atp-Mg2+-Mn2+ Length = 540 Back     alignment and structure
>gi|71042030|pdb|1YGG|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase From Actinobacillus Succinogenes Length = 560 Back     alignment and structure
>gi|157832536|pdb|1OEN|A Chain A, Phosphoenolpyruvate Carboxykinase Length = 540 Back     alignment and structure
gi|73535726|pdb|1YVY|A Chain A, Crystal Strucutre Of Anaerobiospirillum Succiniciproducens Phosphoenolpyruvate Carboxykinase Length = 532 Back     alignment and structure
>gi|17942708|pdb|1II2|A Chain A, Crystal Structure Of Phosphoenolpyruvate Carboxykinase (Pepck) From Trypanosoma Cruzi Length = 524 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
1j3b_A529 ATP-dependent phosphoenolpyruvate carboxykinase; adenos 1e-173
1ii2_A524 Phosphoenolpyruvate carboxykinase; phosphate binding lo 1e-165
1ytm_A532 Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyr 1e-144
2olr_A540 Phosphoenolpyruvate carboxykinase; carbon dioxide, lyas 1e-143
2zci_A610 Phosphoenolpyruvate carboxykinase [GTP], phosphoenolpyr 5e-66
3dtb_A624 Phosphoenolpyruvate carboxykinase, cytosolic [GTP]; glu 6e-52
3moe_A624 Phosphoenolpyruvate carboxykinase, cytosolic [GTP; gluc 2e-51
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Length = 529 Back     alignment and structure
 Score =  603 bits (1557), Expect = e-173
 Identities = 250/510 (49%), Positives = 335/510 (65%), Gaps = 7/510 (1%)

Query: 1   MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDS 60
           +E   +    RV+ N  +  L E ++ R + +L   G L   T  +TGRS  DKF+VR+ 
Sbjct: 4   LEALGIHPKKRVFWNTVSPVLVEHTLLRGEGLLAHHGPLVVDTTPYTGRSPKDKFVVREP 63

Query: 61  HTENDVFW-ENNKYISPADFDTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYA 119
             E +++W E N+  +P  F+ L   ++ Y+ ++DL++QDL A    +  ++V VVT+  
Sbjct: 64  EVEGEIWWGEVNQPFAPEAFEALYQRVVQYLSERDLYVQDLYAGADRRYRLAVRVVTESP 123

Query: 120 WHSLFIRNLLKHKEDLGAVPNMMS----LQVVVLPDFSADPNRHGCCSETIIAVDLTAGL 175
           WH+LF RN+       G    + +      VV  P F A P R G  SE  + +     L
Sbjct: 124 WHALFARNMFILPRRFGNDDEVEAFVPGFTVVHAPYFQAVPERDGTRSEVFVGISFQRRL 183

Query: 176 ILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLS 235
           +LI GT YAGEIKKS+FT +N++ P+RG+ PMH S N+ KE  DVA+FFGLSGTGKTTLS
Sbjct: 184 VLIVGTKYAGEIKKSIFTVMNYLMPKRGVFPMHASANVGKE-GDVAVFFGLSGTGKTTLS 242

Query: 236 ASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDE 295
              +R LIGDDEHGWS++GVFNFEGGCYAK I LS E EP I+ AS +F  +LENVVV+ 
Sbjct: 243 TDPERPLIGDDEHGWSEDGVFNFEGGCYAKVIRLSPEHEPLIYKASNQFEAILENVVVNP 302

Query: 296 CG-IPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPE 354
                 + D S TENTR++YP+  + N     +  HP+ +  L+ADA+GVLPP+A L+PE
Sbjct: 303 ESRRVQWDDDSKTENTRSSYPIAHLENVVESGVAGHPRAIFFLSADAYGVLPPIARLSPE 362

Query: 355 KAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCW 414
           +A+YYFLSGYTA+VAGTE+GV +P ATFSACFGAPF+P  P  Y  +L + I K+    +
Sbjct: 363 EAMYYFLSGYTARVAGTERGVTEPRATFSACFGAPFLPMHPGVYARMLGEKIRKHAPRVY 422

Query: 415 LVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKL 474
           LVNTGWT G YG GYR PL VTRALLKA    ++++VPYR D  FGF VPLE  GV ++L
Sbjct: 423 LVNTGWTGGPYGVGYRFPLPVTRALLKAALSGALENVPYRRDPVFGFEVPLEAPGVPQEL 482

Query: 475 LNPRDSWNDVEAYDQKMRELLLMFENNAEK 504
           LNPR++W D EAYDQ+ R+L  +F+ N +K
Sbjct: 483 LNPRETWADKEAYDQQARKLARLFQENFQK 512


>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Length = 524 Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Length = 532 Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Length = 540 Back     alignment and structure
>2zci_A Phosphoenolpyruvate carboxykinase [GTP], phosphoenolpyruvate; GTP-dependent, signaling protein, lyase; 2.30A {Corynebacterium glutamicum} Length = 610 Back     alignment and structure
>3dtb_A Phosphoenolpyruvate carboxykinase, cytosolic [GTP]; gluconeogenesis, lyase, cytoplasm, decarboxylase, GTP-binding, nucleotide-binding; HET: GDP 1PE EPE; 1.30A {Rattus norvegicus} PDB: 2qey_A* 2qf1_A* 2qew_A* 2rk7_A 2rk8_A 2rka_A* 2rkd_A 2rke_A 2qf2_A* 3dt2_A* 3dt7_A* 3dt4_A* 1khb_A* 1khe_A* 1khf_A* 1khg_A 1m51_A* 1nhx_A* 2gmv_A* Length = 624 Back     alignment and structure
>3moe_A Phosphoenolpyruvate carboxykinase, cytosolic [GTP; gluconeogenesis, lyase; HET: GTP SPV 1PE; 1.25A {Rattus norvegicus} PDB: 3mof_A* 3moh_A* 3dtb_A* 2qey_A* 2qf1_A* 2qew_A* 2rk7_A 2rk8_A 2rka_A* 2rkd_A 2rke_A 2qf2_A* 3dt2_A* 3dt7_A* 3dt4_A* 1khb_A* 1khe_A* 1khf_A* 1khg_A 1m51_A* ... Length = 624 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
1j3b_A529 ATP-dependent phosphoenolpyruvate carboxykinase; adenos 100.0
1ii2_A524 Phosphoenolpyruvate carboxykinase; phosphate binding lo 100.0
2olr_A540 Phosphoenolpyruvate carboxykinase; carbon dioxide, lyas 100.0
1ytm_A532 Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyr 100.0
2zci_A610 Phosphoenolpyruvate carboxykinase [GTP], phosphoenolpyr 100.0
3moe_A624 Phosphoenolpyruvate carboxykinase, cytosolic [GTP; gluc 100.0
2faf_A608 Phosphoenolpyruvate carboxykinase; pepck, phosphoryl tr 99.79
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrion, NA 94.12
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain prote 93.49
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase prote 93.11
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural genomi 92.15
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; st 91.88
3evt_A324 Phosphoglycerate dehydrogenase; structural genomics, PS 90.96
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) 90.29
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear protein, p 90.18
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, 90.08
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarbox 90.05
1m7g_A211 Adenylylsulfate kinase; APS kinase, transferase, sulfat 94.05
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosphosulf 93.8
2pez_A179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfate syn 93.78
2qmh_A205 HPR kinase/phosphorylase; V267F mutation, ATP-binding, 93.39
2qt1_A207 Nicotinamide riboside kinase 1; non-protein kinase, NAD 93.04
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfurylase; 91.86
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase; APS 91.66
2yvu_A186 Probable adenylyl-sulfate kinase; transferase, structur 90.97
3pfi_A338 Holliday junction ATP-dependent DNA helicase RUVB; prob 90.93
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-class A 90.62
2qz4_A262 Paraplegin; AAA+, SPG7, protease, ADP, structural genom 91.56
1zu4_A320 FTSY; GTPase, signal recognition particle, SRP, recepto 90.11
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=1525.13  Aligned_cols=508  Identities=49%  Similarity=0.852  Sum_probs=500.1

Q ss_pred             CCCCCCCCCCCEEECCCHHHHHHHHHHHCCCEECCCCCEEEECCCCCCCCCCCCEEECCCCCCCCCCCCC-CCCCCHHHH
Q ss_conf             9323786822046279889999999972883882685489856876568713223616886544345767-875888999
Q gi|254780826|r    1 MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWEN-NKYISPADF   79 (509)
Q Consensus         1 L~~~Gi~~~~~v~~Nls~~eL~e~ai~~~eG~lt~~GAL~v~TG~~TGRSPkDKfIV~d~~t~d~I~Wg~-N~~i~~e~F   79 (509)
                      |+++||+|.++|||||++++|||+||+|+||+++++|||+|.||+||||||||||||+|+.|+|+||||+ ||||+++.|
T Consensus         4 L~~~Gi~~~~~v~~Nl~~~~L~e~a~~~~eG~lt~~GaL~v~TG~~TGRSPkDkfIV~d~~t~d~I~Wg~vN~pi~~e~F   83 (529)
T 1j3b_A            4 LEALGIHPKKRVFWNTVSPVLVEHTLLRGEGLLAHHGPLVVDTTPYTGRSPKDKFVVREPEVEGEIWWGEVNQPFAPEAF   83 (529)
T ss_dssp             CGGGTCCCSSCEEESCCHHHHHHHHHHTTSCEECTTSCEEECCTTCCSCCGGGEEEECCTTTTTTSCBTTTBEEECHHHH
T ss_pred             HHHCCCCCCCEEEECCCHHHHHHHHHHCCCEEECCCCCEEEECCCCCCCCCCCCEECCCCCCCCCEEECCCCCCCCHHHH
T ss_conf             67649998874897979899999999729918806987898559966889865478079984213200777766899999


Q ss_pred             HHHHHHHHHHHCCCCEEEEEEEEECCHHHCCEEEEECCCCHHHHHHHHHCCCCC----CCCCCCCCCCCEEEECCCCCCC
Q ss_conf             999999999862794699742551783236402872287107789997512542----1113444566127645887637
Q gi|254780826|r   80 DTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHKE----DLGAVPNMMSLQVVVLPDFSAD  155 (509)
Q Consensus        80 ~~L~~~v~~yl~~k~lyv~D~~~Gad~~~rl~vRvite~AwhaLF~~nmFirp~----~~e~~~~~pd~tI~~aP~~~~~  155 (509)
                      +.|+++|++|+++|++||+|+|||||++||++|||+||+||||||++||||||.    .+|+..|.|||||+++|+|++|
T Consensus        84 ~~L~~~~~~yl~~k~lyv~D~~~Gad~~~rl~vRvite~AwhaLF~~nMFirP~~~~~~eel~~f~pd~tIi~aP~f~~~  163 (529)
T 1j3b_A           84 EALYQRVVQYLSERDLYVQDLYAGADRRYRLAVRVVTESPWHALFARNMFILPRRFGNDDEVEAFVPGFTVVHAPYFQAV  163 (529)
T ss_dssp             HHHHHHHHHHHHTSCEEEEEEEECSSTTTCEEEEEEESCHHHHHHHHHHSBCGGGGC------CCCCSEEEEEETTCCCC
T ss_pred             HHHHHHHHHHHHCCCEEEEEEEEECCHHHCEEEEEEEHHHHHHHHHHHHCCCCCCCCCHHHHHCCCCCEEEEECCCCCCC
T ss_conf             99999999998369769986578617301212899732677999998516787545532345324887189855667578


Q ss_pred             CCCCCCCCCCEEEEEHHCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCCCCC
Q ss_conf             42245666616997722193566413678887789999998624107879931245347778702799833543111222
Q gi|254780826|r  156 PNRHGCCSETIIAVDLTAGLILIGGTSYAGEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLS  235 (509)
Q Consensus       156 p~~~g~~Se~~i~in~~~k~~lI~GT~YaGEiKKsiFtvmny~lp~~g~lpmHcsan~~~~~~d~alfFGLSGTGKTTLS  235 (509)
                      |+++|++|+++|+|||++|++||+||+|+||||||+||||||+||++|+||||||||+++++ |+++|||||||||||||
T Consensus       164 p~~~g~~S~~~iiin~~~k~~lI~Gt~Y~GEiKKsiftvmnyllp~~g~l~mHcsan~~~~~-d~alfFGLSGTGKTTLS  242 (529)
T 1j3b_A          164 PERDGTRSEVFVGISFQRRLVLIVGTKYAGEIKKSIFTVMNYLMPKRGVFPMHASANVGKEG-DVAVFFGLSGTGKTTLS  242 (529)
T ss_dssp             HHHHCCSSSCEEEEETTTTEEEEESCCCTHHHHHHHHHHHHHHGGGGTCEEEECEEEECTTC-CEEEEEECTTSCHHHHT
T ss_pred             CCCCCCCCCCEEEECHHCCEEEEECCHHHHHHHHHHHHHHHHHHHHCCEEEEEEEEEECCCC-CEEEEEECCCCCCCEEC
T ss_conf             45457666417997120187999563789998899999998666650966777553226889-74799722788761523


Q ss_pred             CCCCCEEEECCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHCCHHHCCCEECCC-CCEECCCCCCCCCEEEEE
Q ss_conf             4788613303110215674123455532110135833351358875301103124005789-811114788676705898
Q gi|254780826|r  236 ASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDEC-GIPNFKDSSVTENTRAAY  314 (509)
Q Consensus       236 ~d~~r~LigDDehgW~d~gvfn~EgGcYaK~i~Ls~~~EP~I~~aa~~~~ailENV~~d~~-~~~df~d~s~TeNtR~~y  314 (509)
                      +||+|.|||||||||+++||||+|||||||||+||++.||+||+|+.+|+|++|||++|++ +++||+|.|+|+|||++|
T Consensus       243 ad~~r~LigDDehgW~~dgvfn~EgGcyak~~~Ls~e~eP~i~~a~~~~~a~lENV~~d~~~~~v~~~d~s~t~NtR~~y  322 (529)
T 1j3b_A          243 TDPERPLIGDDEHGWSEDGVFNFEGGCYAKVIRLSPEHEPLIYKASNQFEAILENVVVNPESRRVQWDDDSKTENTRSSY  322 (529)
T ss_dssp             CBTTBCEEESSEEEECSSCEEESCSEEEEECTTCCTTTCHHHHHHHSSTTCEEESCEECTTTCCEETTCCSSCSCCEEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCEEEECCEEEEECCCCCCCCCCHHHHHHHHCCCCCCCEEECCCCCCCCCCCCCCCCCCCEEE
T ss_conf             37999735785226267867985135887304688555721799997607655665987898734677876677664545


Q ss_pred             ECCCCCCCCCCCCCCCCCEEEEEECCCCCCCCHHHHCCHHHHHHHHHHHCCCCCCCCCCCCCCCCCEEEHHHCCCCCCCC
Q ss_conf             60004310002567887269996026778876044418588999997423245666200012565312100105001568
Q gi|254780826|r  315 PLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATFSACFGAPFMPRD  394 (509)
Q Consensus       315 p~~~i~n~~~~~~~~~p~~iifl~~d~~gvlPpvsklt~~qa~~~F~sGyT~k~agte~g~~ep~~tfs~cFg~PF~~~~  394 (509)
                      ||++|+|+++++.++||++|||||||+||||||||||||+|||||||||||+|+||||+|++||++|||+|||+||||+|
T Consensus       323 p~~~i~n~~~~~~~~~p~~iifLt~Da~gvlPpvskLt~eQA~~~F~sGyT~k~agte~g~~ep~~tfs~cfg~PF~~~~  402 (529)
T 1j3b_A          323 PIAHLENVVESGVAGHPRAIFFLSADAYGVLPPIARLSPEEAMYYFLSGYTARVAGTERGVTEPRATFSACFGAPFLPMH  402 (529)
T ss_dssp             EGGGCSSBCTTSEECCEEEEEEEECCTTSCSCSEEEECHHHHHHHHHHCEEEEC---------CEEEECGGGCGGGCSSC
T ss_pred             EHHHHCCCCCCCCCCCCCEEEEEECCCCCCCCCHHCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCC
T ss_conf             61440055465557887417999646667767222089999999997303330356556777888766414677656777


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEECCCCCCCCCCCCCCCCHHH
Q ss_conf             31538999999988198099981674688768873207889999999998496024660667887742562079899656
Q gi|254780826|r  395 PVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKL  474 (509)
Q Consensus       395 p~~ya~ll~~~i~~~~~~vyLvNTGw~Gg~~g~G~Ri~l~~Tr~ii~ai~~g~l~~~~~~~~~~f~l~iP~~~~gv~~~~  474 (509)
                      |.+||++|++||++|+++||||||||+||+||+|+||+|++||+||+||++|+|++++|+.||+|||+||++|||||+++
T Consensus       403 ~~~ya~~l~eki~~~~~~~yLvNTGw~gg~~g~G~ri~l~~Tr~ii~ai~~G~l~~~~~~~~~~fgl~iP~~~~gv~~~~  482 (529)
T 1j3b_A          403 PGVYARMLGEKIRKHAPRVYLVNTGWTGGPYGVGYRFPLPVTRALLKAALSGALENVPYRRDPVFGFEVPLEAPGVPQEL  482 (529)
T ss_dssp             HHHHHHHHHHHHHHHCCEEEEEECSEESSSTTTSEECCHHHHHHHHHHHHHTGGGGSCEEECTTTCCEEESCBTTBCGGG
T ss_pred             HHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCEEECCCCCEECCCCCCCCCHHH
T ss_conf             78999999999986698789983577678888887457889999999996197557770676877853676489988466


Q ss_pred             CCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             49766259989999999999999999998751279
Q gi|254780826|r  475 LNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI  509 (509)
Q Consensus       475 l~P~~~w~d~~~Y~~~a~~L~~~F~~Nf~~~~~~v  509 (509)
                      |+||++|.|+++|+++|++|+++|++||+||+++|
T Consensus       483 l~P~~~w~d~~~y~~~~~~L~~~f~~nf~kf~~~~  517 (529)
T 1j3b_A          483 LNPRETWADKEAYDQQARKLARLFQENFQKYASGV  517 (529)
T ss_dssp             GCGGGGSSCHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             CCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             79856058989999999999999999998635258



>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>2zci_A Phosphoenolpyruvate carboxykinase [GTP], phosphoenolpyruvate; GTP-dependent, signaling protein, lyase; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>3moe_A Phosphoenolpyruvate carboxykinase, cytosolic [GTP; gluconeogenesis, lyase; HET: GTP SPV 1PE; 1.25A {Rattus norvegicus} PDB: 3mof_A* 3moh_A* 3dtb_A* 2qey_A* 2qf1_A* 2qew_A* 2rk7_A 2rk8_A 2rka_A* 2rkd_A 2rke_A 2qf2_A* 3dt2_A* 3dt7_A* 3dt4_A* 1khb_A* 1khe_A* 1khf_A* 1khg_A 1m51_A* ... Back     alignment and structure
>2faf_A Phosphoenolpyruvate carboxykinase; pepck, phosphoryl transfer, lyase; HET: 20S EPE 1PE; 1.70A {Gallus gallus} PDB: 2fah_A* 2qzy_A* Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase protein; structural genomics, PSI-2, protein structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substrate-binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepressor, transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenase, oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>2qt1_A Nicotinamide riboside kinase 1; non-protein kinase, NAD+, NRK1, nicotinic acid riboside kinase activity, NAD biosynthesis; HET: NNR; 1.32A {Homo sapiens} PDB: 2qsy_A* 2qsz_A* 2qt0_A* 2p0e_A* 2qg6_A* 2ql6_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.10A {Aeropyrum pernix K1} Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
d1j3ba1318 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxyk 1e-102
d1ii2a1323 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxyk 4e-99
d2olra1313 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxyk 2e-95
d1j3ba2210 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxyki 5e-55
d2olra2222 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxyki 4e-48
d1ii2a2199 c.109.1.1 (A:2-200) Phosphoenolpyruvate (PEP) carboxyki 5e-48
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Length = 318 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Thermus thermophilus [TaxId: 274]
 Score =  366 bits (941), Expect = e-102
 Identities = 176/302 (58%), Positives = 221/302 (73%), Gaps = 2/302 (0%)

Query: 204 IMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCY 263
           + PMH S N+ KE  DVA+FFGLSGTGKTTLS   +R LIGDDEHGWS++GVFNFEGGCY
Sbjct: 1   VFPMHASANVGKEG-DVAVFFGLSGTGKTTLSTDPERPLIGDDEHGWSEDGVFNFEGGCY 59

Query: 264 AKSINLSKETEPEIFSASCRFGTVLENVVVDE-CGIPNFKDSSVTENTRAAYPLNFIHNH 322
           AK I LS E EP I+ AS +F  +LENVVV+       + D S TENTR++YP+  + N 
Sbjct: 60  AKVIRLSPEHEPLIYKASNQFEAILENVVVNPESRRVQWDDDSKTENTRSSYPIAHLENV 119

Query: 323 APQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGYTAKVAGTEKGVLKPEATF 382
               +  HP+ +  L+ADA+GVLPP+A L+PE+A+YYFLSGYTA+VAGTE+GV +P ATF
Sbjct: 120 VESGVAGHPRAIFFLSADAYGVLPPIARLSPEEAMYYFLSGYTARVAGTERGVTEPRATF 179

Query: 383 SACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKA 442
           SACFGAPF+P  P  Y  +L + I K+    +LVNTGWT G YG GYR PL VTRALLKA
Sbjct: 180 SACFGAPFLPMHPGVYARMLGEKIRKHAPRVYLVNTGWTGGPYGVGYRFPLPVTRALLKA 239

Query: 443 IFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNA 502
               ++++VPYR D  FGF VPLE  GV ++LLNPR++W D EAYDQ+ R+L  +F+ N 
Sbjct: 240 ALSGALENVPYRRDPVFGFEVPLEAPGVPQELLNPRETWADKEAYDQQARKLARLFQENF 299

Query: 503 EK 504
           +K
Sbjct: 300 QK 301


>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Length = 323 Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Length = 313 Back     information, alignment and structure
>d1j3ba2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Length = 210 Back     information, alignment and structure
>d2olra2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Length = 222 Back     information, alignment and structure
>d1ii2a2 c.109.1.1 (A:2-200) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Length = 199 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
d1j3ba1318 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 100.0
d1ii2a1323 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 100.0
d2olra1313 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 100.0
d1khba1363 Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrol 98.69
d1j3ba2210 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 100.0
d2olra2222 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 100.0
d1ii2a2199 Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloaceta 100.0
d1khba2250 Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrol 91.83
d1knxa2177 HPr kinase HprK C-terminal domain {Mycoplasma pneumonia 95.56
d1kkma_176 HPr kinase HprK C-terminal domain {Lactobacillus casei 94.96
d1m7ga_208 Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus 94.24
d1ko7a2169 HPr kinase HprK C-terminal domain {Staphylococcus xylos 94.17
d1zp6a1176 Hypothetical protein Atu3015 {Agrobacterium tumefaciens 91.64
d1x6va3195 Adenosine-5'phosphosulfate kinase (APS kinase) {Human ( 91.08
d1np6a_170 Molybdopterin-guanine dinucleotide biosynthesis protein 91.06
d1in4a2238 Holliday junction helicase RuvB {Thermotoga maritima [T 90.89
d1knqa_171 Gluconate kinase {Escherichia coli [TaxId: 562]} 90.49
>d1j3ba1 c.91.1.1 (A:212-529) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PEP carboxykinase-like
superfamily: PEP carboxykinase-like
family: PEP carboxykinase C-terminal domain
domain: Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase)
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=974.31  Aligned_cols=305  Identities=58%  Similarity=1.003  Sum_probs=299.8

Q ss_pred             EEEEECCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCEEEECCCEEECCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHH
Q ss_conf             79931245347778702799833543111222478861330311021567412345553211013583335135887530
Q gi|254780826|r  204 IMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIGDDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCR  283 (509)
Q Consensus       204 ~lpmHcsan~~~~~~d~alfFGLSGTGKTTLS~d~~r~LigDDehgW~d~gvfn~EgGcYaK~i~Ls~~~EP~I~~aa~~  283 (509)
                      +||||||||+|+++ ||+||||||||||||||+||+|.|||||||+|+++||||||||||||||+|+++.||+||+|+.+
T Consensus         1 ~lpmh~san~~~~~-~valffGLSGTGKTTLs~~~~r~ligDDe~~w~~~gv~~~EgGcyaKt~~L~~~~ep~i~~a~~~   79 (318)
T d1j3ba1           1 VFPMHASANVGKEG-DVAVFFGLSGTGKTTLSTDPERPLIGDDEHGWSEDGVFNFEGGCYAKVIRLSPEHEPLIYKASNQ   79 (318)
T ss_dssp             CEEEECEEEECTTC-CEEEEEECTTSCHHHHTCBTTBCEEESSEEEECSSCEEESCSEEEEECTTCCTTTCHHHHHHHSS
T ss_pred             CCCCCCCCCCCCCC-CEEEEECCCCCCCCCCCCCCCCEEECCCCEEECCCCEEEECCCEEEEECCCCCCCCCCHHHHHHH
T ss_conf             96504430048999-88999736879814221079815773762367588736512641444324576688004999986


Q ss_pred             CCHHHCCCEECCCC-CEECCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCEEEEEECCCCCCCCHHHHCCHHHHHHHHHH
Q ss_conf             11031240057898-11114788676705898600043100025678872699960267788760444185889999974
Q gi|254780826|r  284 FGTVLENVVVDECG-IPNFKDSSVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLS  362 (509)
Q Consensus       284 ~~ailENV~~d~~~-~~df~d~s~TeNtR~~yp~~~i~n~~~~~~~~~p~~iifl~~d~~gvlPpvsklt~~qa~~~F~s  362 (509)
                      |+|++|||++|+++ +|||+|.|+|+|||++|||++|+|++.++.++||++|||||||||||||||||||++||||||||
T Consensus        80 ~~ailENV~~d~~~~~vdf~d~s~t~N~R~~yp~~~i~n~~~~~~~~~p~~iifLt~Da~GVLPPvskLt~eQa~~~F~s  159 (318)
T d1j3ba1          80 FEAILENVVVNPESRRVQWDDDSKTENTRSSYPIAHLENVVESGVAGHPRAIFFLSADAYGVLPPIARLSPEEAMYYFLS  159 (318)
T ss_dssp             TTCEEESCEECTTTCCEETTCCSSCSCCEEEEEGGGCSSBCTTSEECCEEEEEEEECCTTSCSCSEEEECHHHHHHHHHH
T ss_pred             HHHEEEEEEEECCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCHHHCCCHHHHHHHHHH
T ss_conf             44323025980677522235776667521773657622221124378874368985273347771310189999999998


Q ss_pred             HCCCCCCCCCCCCCCCCCEEEHHHCCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCCCCCCCCCCCCCCHHHHHHHHHH
Q ss_conf             23245666200012565312100105001568315389999999881980999816746887688732078899999999
Q gi|254780826|r  363 GYTAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGSYGEGYRMPLSVTRALLKA  442 (509)
Q Consensus       363 GyT~k~agte~g~~ep~~tfs~cFg~PF~~~~p~~ya~ll~~~i~~~~~~vyLvNTGw~Gg~~g~G~Ri~l~~Tr~ii~a  442 (509)
                      |||+|+||||+|++||++|||+|||+||||+||++||++|++||++|+++||||||||+||+||+|+||+|++||+||+|
T Consensus       160 GyT~k~agtE~g~~ep~~tfs~cfg~PFl~~~p~~ya~lL~~ki~~~~~~~~LvNTGW~Gg~yg~G~Ri~l~~TR~ii~a  239 (318)
T d1j3ba1         160 GYTARVAGTERGVTEPRATFSACFGAPFLPMHPGVYARMLGEKIRKHAPRVYLVNTGWTGGPYGVGYRFPLPVTRALLKA  239 (318)
T ss_dssp             CEEEEC---------CEEEECGGGCGGGCSSCHHHHHHHHHHHHHHHCCEEEEEECSEESSSTTTSEECCHHHHHHHHHH
T ss_pred             HHHHHCCCCCCCCCCCCCEEEHHHHCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECCCCCCCCCCCCCCCCHHHHHHHHH
T ss_conf             87642257764433566514200121015437556899999999866974899704534555556885780436999999


Q ss_pred             HHCCCCCCCCEEECCCCCCCCCCCCCCCCHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             9849602466066788774256207989965649766259989999999999999999998751279
Q gi|254780826|r  443 IFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDVEAYDQKMRELLLMFENNAEKKQIKI  509 (509)
Q Consensus       443 i~~g~l~~~~~~~~~~f~l~iP~~~~gv~~~~l~P~~~w~d~~~Y~~~a~~L~~~F~~Nf~~~~~~v  509 (509)
                      |++|+|++++|+.||+|||+||++|+|||+++|+||++|+|+++|+++|++|+++|++||+||++.|
T Consensus       240 Il~G~l~~~e~~~d~~Fgl~IP~~v~gV~~~iL~Pr~~W~d~~~Yd~~a~~L~~~F~eNFkkf~~~~  306 (318)
T d1j3ba1         240 ALSGALENVPYRRDPVFGFEVPLEAPGVPQELLNPRETWADKEAYDQQARKLARLFQENFQKYASGV  306 (318)
T ss_dssp             HHHTGGGGSCEEECTTTCCEEESCBTTBCGGGGCGGGGSSCHHHHHHHHHHHHHHHHHHHHHHHTTS
T ss_pred             HHCCCCCCCCEEECCCCCEECCCCCCCCCHHHCCHHHHCCCHHHHHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             9739655641587587785410468999857679857369999999999999999999999755478



>d1ii2a1 c.91.1.1 (A:201-523) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2olra1 c.91.1.1 (A:228-540) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1khba1 c.91.1.1 (A:260-622) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j3ba2 c.109.1.1 (A:2-211) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2olra2 c.109.1.1 (A:6-227) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ii2a2 c.109.1.1 (A:2-200) Phosphoenolpyruvate (PEP) carboxykinase (ATP-oxaloacetate carboxy-lyase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1khba2 c.109.1.1 (A:10-259) Cytosolic phosphoenolpyruvate carboxykinase (GTP-hydrolyzing) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knxa2 c.91.1.2 (A:133-309) HPr kinase HprK C-terminal domain {Mycoplasma pneumoniae [TaxId: 2104]} Back     information, alignment and structure
>d1kkma_ c.91.1.2 (A:) HPr kinase HprK C-terminal domain {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} Back     information, alignment and structure
>d1ko7a2 c.91.1.2 (A:130-298) HPr kinase HprK C-terminal domain {Staphylococcus xylosus [TaxId: 1288]} Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 509 phosphoenolpyruvate carboxykinase [Candidatus Libe
1ytm_A_202-276_338-532270 (A:202-276,A:338-532) Phosphoenolpyruvate carboxyk 8e-93
2olr_A_226-282_344-540254 (A:226-282,A:344-540) Phosphoenolpyruvate carboxyk 7e-80
1j3b_A_1-209_253-338295 (A:1-209,A:253-338) ATP-dependent phosphoenolpyruv 1e-88
1ii2_A_1-198_241-325283 (A:1-198,A:241-325) Phosphoenolpyruvate carboxykin 1e-83
2olr_A_1-225_283-343286 (A:1-225,A:283-343) Phosphoenolpyruvate carboxykin 3e-66
1ytm_A_14-201_277-337249 (A:14-201,A:277-337) Phosphoenolpyruvate carboxyki 6e-64
1ii2_A_199-240_326-524241 (A:199-240,A:326-524) Phosphoenolpyruvate carboxyk 9e-62
1ii2_A_199-240_326-524241 (A:199-240,A:326-524) Phosphoenolpyruvate carboxyk 2e-16
1j3b_A_217-252_339-360_418-483124 (A:217-252,A:339-360,A:418-483) ATP-dependent phos 7e-12
1j3b_A_217-252_339-360_418-483124 (A:217-252,A:339-360,A:418-483) ATP-dependent phos 2e-24
1j3b_A_210-216_361-417_484-529110 (A:210-216,A:361-417,A:484-529) ATP-dependent phos 4e-23
1j3b_A_210-216_361-417_484-529110 (A:210-216,A:361-417,A:484-529) ATP-dependent phos 4e-04
2qmh_A_1-177177 (A:1-177) HPR kinase/phosphorylase; V267F mutation 4e-10
>1ytm_A (A:202-276,A:338-532) Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_ALength = 270 Back     alignment and structure
 Score =  335 bits (861), Expect = 8e-93
 Identities = 124/320 (38%), Positives = 168/320 (52%), Gaps = 65/320 (20%)

Query: 185 GEIKKSVFTYLNHIFPERGIMPMHCSINMDKEKEDVALFFGLSGTGKTTLSASVDRFLIG 244
           GE+KK +F+ +N   P +GI  MHCS N D E ++ A+FFGLSGTGKTTLS    R LIG
Sbjct: 1   GEMKKGMFSMMNFYLPLQGIAAMHCSANTDLEGKNTAIFFGLSGTGKTTLSTDPKRLLIG 60

Query: 245 DDEHGWSKEGVFNFEGGCYAKSINLSKETEPEIFSASCRFGTVLENVVVDECGIPNFKDS 304
           DDEHGW  +GVFNFE                                             
Sbjct: 61  DDEHGWDDDGVFNFE--------------------------------------------- 75

Query: 305 SVTENTRAAYPLNFIHNHAPQSIGKHPKHVIMLAADAFGVLPPVAYLNPEKAVYYFLSGY 364
                     P++              K VI L+ADAFGVLPPV+ L+ E+  YYFLSG+
Sbjct: 76  -------IVKPVSKA---------PAAKRVIFLSADAFGVLPPVSILSKEQTKYYFLSGF 119

Query: 365 TAKVAGTEKGVLKPEATFSACFGAPFMPRDPVQYGNILKDYIVKYCVDCWLVNTGWTAGS 424
           TAK+AGTE+G+ +P  TFS+CFGA F+   P +Y  +L   +       +LVNTGW    
Sbjct: 120 TAKLAGTERGITEPTPTFSSCFGAAFLTLPPTKYAEVLVKRMEASGAKAYLVNTGW---- 175

Query: 425 YGEGYRMPLSVTRALLKAIFDNSIKSVPYRVDENFGFSVPLEVKGVDRKLLNPRDSWNDV 484
            G G R+ +  TR ++ AI D SI +        F F+VP E+KGVD K+L+PR+++ D 
Sbjct: 176 NGTGKRISIKDTRGIIDAILDGSIDTANTATIPYFNFTVPTELKGVDTKILDPRNTYADA 235

Query: 485 EAYDQKMRELLLMFENNAEK 504
             ++ K ++L   F+ N +K
Sbjct: 236 SEWEVKAKDLAERFQKNFKK 255


>2olr_A (A:226-282,A:344-540) Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12}Length = 254 Back     alignment and structure
>1j3b_A (A:1-209,A:253-338) ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8}Length = 295 Back     alignment and structure
>1ii2_A (A:1-198,A:241-325) Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi}Length = 283 Back     alignment and structure
>2olr_A (A:1-225,A:283-343) Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12}Length = 286 Back     alignment and structure
>1ytm_A (A:14-201,A:277-337) Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_ALength = 249 Back     alignment and structure
>1ii2_A (A:199-240,A:326-524) Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi}Length = 241 Back     alignment and structure
>1ii2_A (A:199-240,A:326-524) Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi}Length = 241 Back     alignment and structure
>1j3b_A (A:217-252,A:339-360,A:418-483) ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8}Length = 124 Back     alignment and structure
>1j3b_A (A:217-252,A:339-360,A:418-483) ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8}Length = 124 Back     alignment and structure
>1j3b_A (A:210-216,A:361-417,A:484-529) ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8}Length = 110 Back     alignment and structure
>1j3b_A (A:210-216,A:361-417,A:484-529) ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8}Length = 110 Back     alignment and structure
>2qmh_A (A:1-177) HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A*Length = 177 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target509 phosphoenolpyruvate carboxykinase [Candidatus Liberibac
1j3b_A_1-209_253-338295 ATP-dependent phosphoenolpyruvate carboxykinase; a 100.0
1ii2_A_1-198_241-325283 Phosphoenolpyruvate carboxykinase; phosphate bindi 100.0
2olr_A_1-225_283-343286 Phosphoenolpyruvate carboxykinase; carbon dioxide, 100.0
1ytm_A_14-201_277-337249 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 100.0
3dtb_A_1-242_331-421333 Phosphoenolpyruvate carboxykinase, cytosolic [GTP] 96.0
2zci_A_1-226_314-403316 Phosphoenolpyruvate carboxykinase [GTP], phosphoen 95.98
1ytm_A_202-276_338-532270 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 100.0
2olr_A_226-282_344-540254 Phosphoenolpyruvate carboxykinase; carbon dioxide, 100.0
1ii2_A_199-240_326-524241 Phosphoenolpyruvate carboxykinase; phosphate bindi 100.0
3dtb_A_243-330_422-624291 Phosphoenolpyruvate carboxykinase, cytosolic [GTP] 95.8
1j3b_A_217-252_339-360_418-483124 ATP-dependent phosphoenolpyruvate carboxykinase; a 100.0
1j3b_A_210-216_361-417_484-529110 ATP-dependent phosphoenolpyruvate carboxykinase; a 100.0
2qmh_A_1-177177 HPR kinase/phosphorylase; V267F mutation, ATP-bind 98.41
1ko7_A_130-287158 HPR kinase/phosphatase; protein kinase, phosphotra 96.74
1knx_A_134-291158 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 96.23
1ukz_A_203 Uridylate kinase; transferase; HET: ADP AMP; 1.90A 92.52
2pez_A_179 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 91.85
2r2a_A_199 Uncharacterized protein; zonular occludens toxin, 91.44
1rkb_A_173 Protein AD-004, protein CGI-137; five-stranded par 91.4
1yj5_A_205-366162 5' polynucleotide kinase-3' phosphatase catalytic 91.37
2p65_A_187 Hypothetical protein PF08_0063; CLPB, malaria, str 91.24
3hws_A_1-255255 ATP-dependent CLP protease ATP-binding subunit CLP 91.0
2axn_A_27-244218 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 90.89
1ofh_A_1-201201 ATP-dependent HSL protease ATP-binding subunit HSL 90.67
1zp6_A_191 Hypothetical protein ATU3015; alpha-beta protein., 90.64
1y63_A_184 LMAJ004144AAA protein; structural genomics, protei 90.55
1knq_A_175 Gluconate kinase; ALFA/beta structure, transferase 90.44
2gks_A_369-546178 Bifunctional SAT/APS kinase; transferase, sulfuryl 90.27
3a4m_A_1-182182 L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m 90.2
2yvu_A_186 Probable adenylyl-sulfate kinase; transferase, str 90.06
1fnn_A_1-192192 CDC6P, cell division control protein 6; ORC1, AAA 90.05
2faf_A_1-226_315-405317 Phosphoenolpyruvate carboxykinase; pepck, phosphor 94.4
>1j3b_A (A:1-209,A:253-338) ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, riken structural genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus HB8} Back     alignment and structure
Probab=100.00  E-value=0  Score=778.68  Aligned_cols=286  Identities=41%  Similarity=0.703  Sum_probs=279.7

Q ss_pred             CCCCCCCCCCCEEECCCHHHHHHHHHHHCCCEECCCCCEEEECCCCCCCCCCCCEEECCCCCCCCCCCCC-CCCCCHHHH
Q ss_conf             9323786822046279889999999972883882685489856876568713223616886544345767-875888999
Q gi|254780826|r    1 MEKFDLEGSSRVYRNLSTSRLYEESIRREKTILTCDGALRALTGQHTGRSAFDKFIVRDSHTENDVFWEN-NKYISPADF   79 (509)
Q Consensus         1 L~~~Gi~~~~~v~~Nls~~eL~e~ai~~~eG~lt~~GAL~v~TG~~TGRSPkDKfIV~d~~t~d~I~Wg~-N~~i~~e~F   79 (509)
                      |+.+||+++++||||||+++|+|+|++|+||++++.|||+|+||++|||||+|||||+++.|+++||||+ ||||++++|
T Consensus         4 L~~~Gi~~~~~v~~Nls~~eL~e~ai~r~eG~~t~~GaL~v~TG~~TGRSPkDKfIV~~~~t~d~I~Wg~vN~pis~e~f   83 (295)
T 1j3b_A            4 LEALGIHPKKRVFWNTVSPVLVEHTLLRGEGLLAHHGPLVVDTTPYTGRSPKDKFVVREPEVEGEIWWGEVNQPFAPEAF   83 (295)
T ss_dssp             CGGGTCCCSSCEEESCCHHHHHHHHHHTTSCEECTTSCEEECCTTCCSCCGGGEEEECCTTTTTTSCBTTTBEEECHHHH
T ss_pred             HHHCCCCCCCEEEECCCHHHHHHHHHHCCCEEECCCCCEEEECCCCCCCCCCCCEECCCCCCCCCEEECCCCCCCCHHHH
T ss_conf             67649998874897979899999999729918806987898559966889865478079984213200777766899999


Q ss_pred             HHHHHHHHHHHCCCCEEEEEEEEECCHHHCCEEEEECCCCHHHHHHHHHCCCC----CCCCCCCCCCCCEEEECCCCCCC
Q ss_conf             99999999986279469974255178323640287228710778999751254----21113444566127645887637
Q gi|254780826|r   80 DTLKADMLDYIKDKDLFLQDLVACPHTKNAISVCVVTQYAWHSLFIRNLLKHK----EDLGAVPNMMSLQVVVLPDFSAD  155 (509)
Q Consensus        80 ~~L~~~v~~yl~~k~lyv~D~~~Gad~~~rl~vRvite~AwhaLF~~nmFirp----~~~e~~~~~pd~tI~~aP~~~~~  155 (509)
                      +.|+++|++|+++|++||+|+||||||+||++||||||.||||||++||||||    +++++..|+|||||+++|+|++|
T Consensus        84 ~~L~~~~~~~l~~kdlyv~D~~vGaDp~~rl~vRvItE~Aw~~LF~~nLfirP~~~~~~eel~~~~PdftIi~~P~~~ad  163 (295)
T 1j3b_A           84 EALYQRVVQYLSERDLYVQDLYAGADRRYRLAVRVVTESPWHALFARNMFILPRRFGNDDEVEAFVPGFTVVHAPYFQAV  163 (295)
T ss_dssp             HHHHHHHHHHHHTSCEEEEEEEECSSTTTCEEEEEEESCHHHHHHHHHHSBCGGGGC------CCCCSEEEEEETTCCCC
T ss_pred             HHHHHHHHHHHHCCCEEEEEEEEECCHHHCEEEEEEEHHHHHHHHHHHHCCCCCCCCCHHHHHCCCCCEEEEECCCCCCC
T ss_conf             99999999998369769986578617301212899732677999998516787545532345324887189855667578


Q ss_pred             CCCCCCCCCCEEEEEHHCCEEEEECCHHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCCCCEEEEEEECCCCCCCCCC
Q ss_conf