254780827

254780827

pantothenate kinase

GeneID in NCBI database:8209833Locus tag:CLIBASIA_03600
Protein GI in NCBI database:254780827Protein Accession:YP_003065240.1
Gene range:+(420756, 421691)Protein Length:311aa
Gene description:pantothenate kinase
COG prediction:none
KEGG prediction:pantothenate kinase (EC:2.7.1.33); K00867 type I pantothenate kinase [EC:2.7.1.33]
SEED prediction:Pantothenate kinase (EC 2.7.1.33)
Pathway involved in KEGG:Pantothenate and CoA biosynthesis [PATH:las00770]
Subsystem involved in SEED:Coenzyme A Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-
MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
cccccccEEEcHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHcccccccccHHHccHHHHHHHHHHHHcccccEEccEEccccccccccccEEcccccEEEEEcHHHHccccccccccccHHHHHHccEEEEEEccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccEEEEEEEEcc
cccccccccccHHHHHHHccccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEcccEEccccHHHHHHHHHHHccccccEEEEEccccccccHHHHHcccHHcccccccccHHHHHHHHHHHHcccccccccEEEEEEEEEcccccEEEccccEEEEEEEEEccccccccccccEEEEEccEEEEEEEcccHHHHHHHHHHHHHHHHHHHccccccHHHHHccccHHHHHHHHHHHHHHHccHcHHHcccccHHHHHEEEEccccccEEEEEEEcc
mpnhcfyhfftshewavhSKFSSILSKKIsnqllsfdspidsteiykiyfPLSHLLLINVNSAKITCHQYNKFlnlkeeskipfVVGITGSVAVGKSTFARILCILLQQISNFKVSLittdgflfpnaVLTANNlmqrkgfpesydsnklLTFLSdvksgkkkvavpryshsqydilegeydtiiqpdilLIEGINVLqqnslsdnqkatpmisdfldfsiyidadkrDIHRWYLNRFLKLRETaflnprsyfhhfteISEEQSLKIAETAWnninlpnlqhnilptrKRADLILskgedhsvktikikki
MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLsdvksgkkkvavpryshsqydILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINlpnlqhnilPTRKRADLilskgedhsvktikikki
MPNHCFYHFFTSHEWAVHskfssilskkisNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
***HCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
*PNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI
MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINVNSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEGEYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFLKLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGEDHSVKTIKIKKI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target311 pantothenate kinase [Candidatus Liberibacter asiaticus
255764477199 dephospho-CoA kinase [Candidatus Liberibacter asia 0.023
>gi|255764477|ref|YP_003065232.2| dephospho-CoA kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 199 Back     alignment
 Score = 31.2 bits (69), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 19/67 (28%), Positives = 35/67 (52%), Gaps = 8/67 (11%)

Query: 84  FVVGITGSVAVGKSTFARILCILLQQISNFKVSLITTDGFLFPNAVLTANNLMQRKGFPE 143
            ++G+TGS+  GK+T A  L          K+ +I++D  +       A +++ +K FP 
Sbjct: 2   LIIGLTGSIGTGKTTVAEFL-------KKEKIPVISSDDIVDKLYHYEAVDII-KKTFPR 53

Query: 144 SYDSNKL 150
           S  +NK+
Sbjct: 54  SIQNNKV 60

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target311 pantothenate kinase [Candidatus Liberibacter asiaticus
315122051312 pantothenate kinase [Candidatus Liberibacter solanacear 1 1e-108
254709065322 pantothenate kinase [Brucella pinnipedialis B2/94] Leng 1 1e-90
17988322322 pantothenate kinase [Brucella melitensis bv. 1 str. 16M 1 2e-90
256060052322 pantothenate kinase [Brucella neotomae 5K33] Length = 3 1 2e-90
62290931322 pantothenate kinase [Brucella abortus bv. 1 str. 9-941] 1 3e-90
239833131342 pantothenate kinase [Ochrobactrum intermedium LMG 3301] 1 1e-89
153008168322 pantothenate kinase [Ochrobactrum anthropi ATCC 49188] 1 4e-89
116249806331 pantothenate kinase [Rhizobium leguminosarum bv. viciae 1 8e-89
241206983331 pantothenate kinase [Rhizobium leguminosarum bv. trifol 1 3e-88
270313532337 pantothenate kinase [Ochrobactrum sp. T63] Length = 337 1 3e-88
>gi|315122051|ref|YP_004062540.1| pantothenate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 312 Back     alignment and organism information
 Score =  397 bits (1019), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 203/312 (65%), Positives = 248/312 (79%), Gaps = 1/312 (0%)

Query: 1   MPNHCFYHFFTSHEWAVHSKFSSILSKKISNQLLSFDSPIDSTEIYKIYFPLSHLLLINV 60
           M N   YHFFTS EW  HSK     +K+    L SF+  ID  E+ KIY  LS+LLLIN+
Sbjct: 1   MHNSSPYHFFTSDEWKAHSKTLLTPTKEKITGLCSFNKMIDVDEVCKIYLSLSNLLLINI 60

Query: 61  NSAKITCHQYNKFLNLKEESKIPFVVGITGSVAVGKSTFARILCILLQ-QISNFKVSLIT 119
            S KITCHQYNKFLNLKE+ KIPFV+GITGSVAVGKST ARIL +LLQ Q +N K++LIT
Sbjct: 61  ESTKITCHQYNKFLNLKEDIKIPFVIGITGSVAVGKSTIARILDVLLQHQSTNLKIALIT 120

Query: 120 TDGFLFPNAVLTANNLMQRKGFPESYDSNKLLTFLSDVKSGKKKVAVPRYSHSQYDILEG 179
           TDGFLFPNA+LT  NLM RKGFPESYD  K LTFLSD+KSG+K+V  P YSHS+YDILEG
Sbjct: 121 TDGFLFPNAILTKKNLMHRKGFPESYDVGKFLTFLSDIKSGEKEVFTPCYSHSKYDILEG 180

Query: 180 EYDTIIQPDILLIEGINVLQQNSLSDNQKATPMISDFLDFSIYIDADKRDIHRWYLNRFL 239
           ++D I QPD+L++EGINVLQ + LS+N+K T + SDFLDFSIYIDADK  I +WY+ RF+
Sbjct: 181 KFDKITQPDVLIVEGINVLQHHPLSENKKITSIASDFLDFSIYIDADKDFIRQWYIERFI 240

Query: 240 KLRETAFLNPRSYFHHFTEISEEQSLKIAETAWNNINLPNLQHNILPTRKRADLILSKGE 299
           KLRETA  +P SYFH F +IS++QS KIAE  W  +NLPNL+ NILPTR+RA+L+L+KG+
Sbjct: 241 KLRETALHDPNSYFHRFAKISKDQSQKIAEKIWEEVNLPNLEQNILPTRRRANLVLNKGK 300

Query: 300 DHSVKTIKIKKI 311
           +H VKT++I+K+
Sbjct: 301 NHFVKTVEIRKL 312


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254709065|ref|ZP_05170876.1| pantothenate kinase [Brucella pinnipedialis B2/94] Length = 322 Back     alignment and organism information
>gi|17988322|ref|NP_540956.1| pantothenate kinase [Brucella melitensis bv. 1 str. 16M] Length = 322 Back     alignment and organism information
>gi|256060052|ref|ZP_05450234.1| pantothenate kinase [Brucella neotomae 5K33] Length = 322 Back     alignment and organism information
>gi|62290931|ref|YP_222724.1| pantothenate kinase [Brucella abortus bv. 1 str. 9-941] Length = 322 Back     alignment and organism information
>gi|239833131|ref|ZP_04681460.1| pantothenate kinase [Ochrobactrum intermedium LMG 3301] Length = 342 Back     alignment and organism information
>gi|153008168|ref|YP_001369383.1| pantothenate kinase [Ochrobactrum anthropi ATCC 49188] Length = 322 Back     alignment and organism information
>gi|116249806|ref|YP_765644.1| pantothenate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 331 Back     alignment and organism information
>gi|241206983|ref|YP_002978079.1| pantothenate kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 331 Back     alignment and organism information
>gi|270313532|gb|ACZ73825.1| pantothenate kinase [Ochrobactrum sp. T63] Length = 337 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target311 pantothenate kinase [Candidatus Liberibacter asiaticus
PRK05439311 PRK05439, PRK05439, pantothenate kinase; Provisional 1e-125
TIGR00554290 TIGR00554, panK_bact, pantothenate kinase, bacterial ty 3e-84
COG1072283 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolis 2e-76
PRK09270229 PRK09270, PRK09270, nucleoside triphosphate hydrolase d 7e-21
COG0572218 COG0572, Udk, Uridine kinase [Nucleotide transport and 1e-14
cd02023198 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 4e-12
TIGR00235207 TIGR00235, udk, uridine kinase 5e-09
KOG4203 473 KOG4203, KOG4203, KOG4203, Armadillo/beta-Catenin/plako 8e-05
cd02026273 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme in 4e-04
KOG3308225 KOG3308, KOG3308, KOG3308, Uncharacterized protein of t 0.002
cd02025220 cd02025, PanK, Pantothenate kinase (PanK) catalyzes the 6e-79
COG4240300 COG4240, COG4240, Predicted kinase [General function pr 3e-09
KOG2878282 KOG2878, KOG2878, KOG2878, Predicted kinase [General fu 5e-05
PRK05480209 PRK05480, PRK05480, uridine/cytidine kinase; Provisiona 4e-08
pfam00485196 pfam00485, PRK, Phosphoribulokinase / Uridine kinase fa 4e-07
cd02028179 cd02028, UMPK_like, Uridine monophosphate kinase_like ( 4e-05
PRK07429 327 PRK07429, PRK07429, phosphoribulokinase; Provisional 0.004
>gnl|CDD|180082 PRK05439, PRK05439, pantothenate kinase; Provisional Back     alignment and domain information
>gnl|CDD|129645 TIGR00554, panK_bact, pantothenate kinase, bacterial type Back     alignment and domain information
>gnl|CDD|31270 COG1072, CoaA, Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181743 PRK09270, PRK09270, nucleoside triphosphate hydrolase domain-containing protein; Reviewed Back     alignment and domain information
>gnl|CDD|30917 COG0572, Udk, Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30196 cd02023, UMPK, Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|161782 TIGR00235, udk, uridine kinase Back     alignment and domain information
>gnl|CDD|39404 KOG4203, KOG4203, KOG4203, Armadillo/beta-Catenin/plakoglobin [Signal transduction mechanisms, Cytoskeleton] Back     alignment and domain information
>gnl|CDD|30199 cd02026, PRK, Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>gnl|CDD|38518 KOG3308, KOG3308, KOG3308, Uncharacterized protein of the uridine kinase family [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|30198 cd02025, PanK, Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>gnl|CDD|33963 COG4240, COG4240, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|38089 KOG2878, KOG2878, KOG2878, Predicted kinase [General function prediction only] Back     alignment and domain information
>gnl|CDD|180114 PRK05480, PRK05480, uridine/cytidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|109538 pfam00485, PRK, Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>gnl|CDD|30201 cd02028, UMPK_like, Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>gnl|CDD|180975 PRK07429, PRK07429, phosphoribulokinase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 311 pantothenate kinase [Candidatus Liberibacter asiaticus
PRK05439312 pantothenate kinase; Provisional 100.0
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 100.0
TIGR00554309 panK_bact pantothenate kinase; InterPro: IPR004566 Pant 100.0
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 97.12
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 100.0
PRK09270230 frcK putative fructose transport system kinase; Reviewe 100.0
TIGR00235220 udk uridine kinase; InterPro: IPR000764 Uridine kinase 100.0
PRK05480209 uridine kinase; Provisional 100.0
PTZ00301210 uridine kinase; Provisional 100.0
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 100.0
PRK07429 331 phosphoribulokinase; Provisional 100.0
COG0572218 Udk Uridine kinase [Nucleotide transport and metabolism 100.0
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 100.0
cd02026273 PRK Phosphoribulokinase (PRK) is an enzyme involved in 100.0
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 100.0
PRK08233182 hypothetical protein; Provisional 99.98
PRK07667190 uridine kinase; Provisional 99.97
PRK06696227 uridine kinase; Validated 99.97
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 99.96
KOG4203 473 consensus 99.94
COG4240300 Predicted kinase [General function prediction only] 99.91
KOG2702323 consensus 99.9
cd02029277 PRK_like Phosphoribulokinase-like (PRK-like) is a famil 99.9
KOG2878282 consensus 99.78
PRK06547184 hypothetical protein; Provisional 99.68
cd02022179 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2.7.1.24) ca 98.98
PRK00081199 coaE dephospho-CoA kinase; Reviewed 98.89
pfam01121179 CoaE Dephospho-CoA kinase. This family catalyses the ph 98.79
PRK01184183 hypothetical protein; Provisional 98.51
COG3954289 PrkB Phosphoribulokinase [Energy production and convers 98.38
PRK08118167 topology modulation protein; Reviewed 98.23
PRK02496185 adk adenylate kinase; Provisional 96.96
cd01428194 ADK Adenylate kinase (ADK) catalyzes the reversible pho 96.81
PRK00279215 adk adenylate kinase; Reviewed 96.48
KOG3079195 consensus 95.91
KOG3308225 consensus 99.42
cd0201969 NK Nucleoside/nucleotide kinase (NK) is a protein super 98.5
COG0237201 CoaE Dephospho-CoA kinase [Coenzyme metabolism] 98.34
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 98.27
PRK07261171 topology modulation protein; Provisional 98.16
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 98.1
PRK03839180 putative kinase; Provisional 98.02
PRK06217185 hypothetical protein; Validated 97.99
COG0378202 HypB Ni2+-binding GTPase involved in regulation of expr 97.91
PRK04182178 cytidylate kinase; Provisional 97.87
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 97.82
PRK08356195 hypothetical protein; Provisional 97.82
COG1102179 Cmk Cytidylate kinase [Nucleotide transport and metabol 97.74
PRK06762166 hypothetical protein; Provisional 97.68
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 97.62
cd03114148 ArgK-like The function of this protein family is unkown 97.47
PRK13973216 thymidylate kinase; Provisional 97.1
TIGR00017223 cmk cytidylate kinase; InterPro: IPR003136 This family 97.02
TIGR03575340 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic. Me 96.87
COG0125208 Tmk Thymidylate kinase [Nucleotide transport and metabo 96.87
PRK00698204 tmk thymidylate kinase; Validated 96.72
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 96.67
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 96.63
PRK12339197 2-phosphoglycerate kinase; Provisional 96.51
PRK00300208 gmk guanylate kinase; Provisional 96.51
TIGR03263180 guanyl_kin guanylate kinase. Members of this family are 96.42
KOG3062281 consensus 96.26
pfam00406186 ADK Adenylate kinase. 96.22
PRK13808297 adenylate kinase; Provisional 96.2
PRK13976202 thymidylate kinase; Provisional 96.17
PRK07933213 thymidylate kinase; Validated 95.96
TIGR01313175 therm_gnt_kin carbohydrate kinase, thermoresistant gluc 95.91
TIGR00101199 ureG urease accessory protein UreG; InterPro: IPR004400 95.9
PRK10078184 ribose 1,5-bisphosphokinase; Provisional 95.74
pfam02223186 Thymidylate_kin Thymidylate kinase. 95.68
PRK13974212 thymidylate kinase; Provisional 95.34
TIGR02315253 ABC_phnC phosphonate ABC transporter, ATP-binding prote 95.14
COG0194191 Gmk Guanylate kinase [Nucleotide transport and metaboli 95.11
cd00071137 GMPK Guanosine monophosphate kinase (GMPK, EC 2.7.4.8), 94.75
PRK10463290 hydrogenase nickel incorporation protein HypB; Provisio 93.84
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 98.44
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.9
PRK13657585 cyclic beta-1,2-glucan ABC transporter; Provisional 97.61
PRK10790593 putative multidrug transporter membrane\ATP-binding com 97.61
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.6
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 97.58
cd03116159 MobB Molybdenum is an essential trace element in the fo 97.56
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 97.52
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.51
TIGR01085 494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 97.38
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, contai 97.37
PRK00139 481 murE UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diamin 97.36
PRK11124242 artP arginine transporter ATP-binding subunit; Provisio 97.07
PRK13768253 GTPase; Provisional 97.07
COG1132567 MdlB ABC-type multidrug transport system, ATPase and pe 96.99
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-bi 96.97
PRK11264248 putative amino-acid ABC transporter ATP-binding protein 96.74
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, LssB fa 96.57
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 96.56
cd03299235 ABC_ModC_like Archeal protein closely related to ModC. 96.53
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.51
PRK13640283 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.5
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the glycine 96.48
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the transpo 96.44
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.39
TIGR01192592 chvA glucan exporter ATP-binding protein; InterPro: IPR 96.23
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 96.2
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.18
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Trans 96.17
PRK13632273 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.13
PRK13650276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.12
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 96.0
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, ATP- 95.98
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 95.91
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC transporte 95.91
COG1126240 GlnQ ABC-type polar amino acid transport system, ATPase 95.8
PRK11000369 maltose/maltodextrin transporter ATP-binding protein; P 95.77
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 95.74
cd03269210 ABC_putative_ATPase This subfamily is involved in drug 95.72
TIGR02857570 CydD ABC transporter, CydDC cysteine exporter (CydDC-E) 95.55
PRK13636285 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.54
PRK09452378 potA putrescine/spermidine ABC transporter ATPase prote 95.51
PRK13546264 teichoic acids export protein ATP-binding subunit; Prov 95.37
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the maltose 95.35
cd00544169 CobU Adenosylcobinamide kinase / adenosylcobinamide pho 95.32
COG4619223 ABC-type uncharacterized transport system, ATPase compo 95.31
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provisiona 95.31
PRK11650358 ugpC glycerol-3-phosphate transporter ATP-binding subun 95.25
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter 95.1
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase component 94.74
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transport s 94.6
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 94.56
cd03264211 ABC_drug_resistance_like ABC-type multidrug transport s 94.53
cd01123235 Rad51_DMC1_radA Rad51_DMC1_radA,B. This group of recomb 94.13
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transport sy 93.98
TIGR01188343 drrA daunorubicin resistance ABC transporter, ATP-bindi 93.88
COG2074299 2-phosphoglycerate kinase [Carbohydrate transport and m 98.34
PRK04220306 2-phosphoglycerate kinase; Provisional 97.76
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 98.14
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.91
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.82
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.75
PRK11176581 lipid transporter ATP-binding/permease protein; Provisi 97.73
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 97.71
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.62
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 97.62
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.62
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 97.53
PRK11160575 cysteine/glutathione ABC transporter membrane/ATP-bindi 97.26
KOG3354191 consensus 97.15
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, closely 97.15
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 97.12
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is of f 97.09
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea receptor S 97.0
KOG0057591 consensus 96.8
cd03217200 ABC_FeS_Assembly ABC-type transport system involved in 96.75
PRK10522547 multidrug transporter membrane component/ATP-binding co 96.73
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 96.71
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding protein; 96.65
TIGR02868566 CydC ABC transporter, CydDC cysteine exporter (CydDC-E) 96.62
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 96.62
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ07 96.55
KOG1970 634 consensus 96.49
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 96.44
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 96.29
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.23
COG0324308 MiaA tRNA delta(2)-isopentenylpyrophosphate transferase 96.22
PRK05506613 bifunctional sulfate adenylyltransferase subunit 1/aden 96.04
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding com 96.04
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranpor 95.88
PRK11248255 tauB taurine transporter ATP-binding subunit; Provision 95.84
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC component o 95.74
TIGR00174307 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.5
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 95.43
pfam01580202 FtsK_SpoIIIE FtsK/SpoIIIE family. FtsK has extensive se 95.35
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the ATPa 95.32
KOG3347176 consensus 95.07
KOG0054 1381 consensus 94.44
COG1674 858 FtsK DNA segregation ATPase FtsK/SpoIIIE and related pr 94.03
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 93.88
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.04
cd02020147 CMPK Cytidine monophosphate kinase (CMPK) catalyzes the 97.94
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 97.93
PRK00023225 cmk cytidylate kinase; Provisional 97.76
PRK10789569 putative multidrug transporter membrane\ATP-binding com 97.62
PRK11860662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 97.62
PRK10867 453 signal recognition particle protein; Provisional 97.61
PRK10416499 cell division protein FtsY; Provisional 97.56
PRK00771 433 signal recognition particle protein Srp54; Provisional 97.56
cd03115173 SRP The signal recognition particle (SRP) mediates the 97.54
PRK12338320 hypothetical protein; Provisional 97.4
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 97.37
cd01673193 dNK Deoxyribonucleoside kinase (dNK) catalyzes the phos 97.37
cd03248226 ABCC_TAP TAP, the Transporter Associated with Antigen P 97.35
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-binding p 97.33
cd01672200 TMPK Thymidine monophosphate kinase (TMPK), also known 97.31
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a 97.29
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. This 97.25
PRK05541176 adenylylsulfate kinase; Provisional 97.23
KOG3220225 consensus 97.21
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 97.2
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter that i 97.18
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic fibr 97.18
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea receptor 97.12
COG0283222 Cmk Cytidylate kinase [Nucleotide transport and metabol 97.1
PRK00889175 adenylylsulfate kinase; Provisional 97.09
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. This 97.07
PRK10744257 phosphate transporter subunit; Provisional 97.07
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is a cen 97.06
PRK03846198 adenylylsulfate kinase; Provisional 97.06
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic fibr 97.03
TIGR00958770 3a01208 antigen peptide transporter 2; InterPro: IPR005 97.01
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 97.0
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin exporte 96.95
PRK11545177 gntK gluconate kinase 1; Provisional 96.95
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.94
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-type tra 96.92
TIGR01143 462 murF UDP-N-acetylmuramoyl-tripeptide--D-alanyl-D-alanin 96.86
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 96.86
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 96.86
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.83
PRK13634276 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.82
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.81
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 96.8
PRK10247225 putative ABC transporter ATP-binding protein YbbL; Prov 96.8
PRK09518 714 bifunctional cytidylate kinase/GTP-binding protein; Rev 96.74
PRK13477512 bifunctional pantoate ligase/cytidylate kinase; Provisi 96.73
PRK09825176 idnK D-gluconate kinase; Provisional 96.73
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 96.72
COG1123539 ATPase components of various ABC-type transport systems 96.71
PRK11022327 dppD dipeptide transporter ATP-binding subunit; Provisi 96.67
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.65
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.64
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 96.64
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 96.6
PRK11831269 putative ABC transporter ATP-binding protein YrbF; Prov 96.57
cd02030219 NDUO42 NADH:Ubiquinone oxioreductase, 42 kDa (NDUO42) i 96.56
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 96.54
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 96.54
PRK00131175 aroK shikimate kinase; Reviewed 96.53
PRK10418254 nikD nickel transporter ATP-binding protein; Provisiona 96.53
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) tr 96.51
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type tr 96.5
COG1428216 Deoxynucleoside kinases [Nucleotide transport and metab 96.5
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 96.5
smart00382148 AAA ATPases associated with a variety of cellular activ 96.48
PRK12269 863 bifunctional cytidylate kinase/ribosomal protein S1; Pr 96.47
PRK13695174 putative NTPase; Provisional 96.45
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 96.45
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonate tra 96.44
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-binding 96.42
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 96.41
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 96.41
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 96.37
pfam04665241 Pox_A32 Poxvirus A32 protein. The A32 protein is though 96.36
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.32
PRK10584228 putative ABC transporter ATP-binding protein YbbA; Prov 96.32
PRK06761281 hypothetical protein; Provisional 96.3
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 96.3
cd03257228 ABC_NikE_OppD_transporters The ABC transporter subfamil 96.3
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.29
COG1136226 SalX ABC-type antimicrobial peptide transport system, A 96.29
TIGR00972248 3a0107s01c2 phosphate ABC transporter, ATP-binding prot 96.28
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.26
KOG0058716 consensus 96.25
PRK13651304 cobalt transporter ATP-binding subunit; Provisional 96.24
COG1855 604 ATPase (PilT family) [General function prediction only] 96.21
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.21
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; Provi 96.21
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.19
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.19
cd00227175 CPT Chloramphenicol (Cm) phosphotransferase (CPT). Cm-i 96.19
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 96.18
pfam03266168 DUF265 Protein of unknown function, DUF265. 96.16
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 96.15
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 96.13
PRK00625173 shikimate kinase; Provisional 96.13
PRK13641286 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.11
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC component 96.09
pfam07931174 CPT Chloramphenicol phosphotransferase-like protein. Th 96.09
KOG1533290 consensus 96.09
PRK09473330 oppD oligopeptide transporter ATP-binding component; Pr 96.09
TIGR03415 382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.08
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transporter c 96.07
PRK10619257 histidine/lysine/arginine/ornithine transporter subunit 96.06
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 96.05
cd03278197 ABC_SMC_barmotin Barmotin is a tight junction-associate 96.05
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.04
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 96.01
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.01
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provisiona 96.01
PTZ002651467 multidrug resistance protein (mdr1); Provisional 96.0
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 96.0
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-b 95.99
PRK13764 605 ATPase; Provisional 95.99
PRK10771233 thiQ thiamine transporter ATP-binding subunit; Provisio 95.99
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein PhnL; 95.98
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.98
TIGR02770239 nickel_nikD nickel import ATP-binding protein NikD; Int 95.97
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein; Rev 95.96
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 95.95
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-bindi 95.94
COG4618580 ArpD ABC-type protease/lipase transport system, ATPase 95.94
KOG0055 1228 consensus 95.94
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.93
PRK10070 400 glycine betaine transporter ATP-binding subunit; Provis 95.92
cd03258233 ABC_MetN_methionine_transporter MetN (also known as Yus 95.92
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNa 95.92
PRK10261623 glutathione transporter ATP-binding protein; Provisiona 95.9
PRK11153343 metN DL-methionine transporter ATP-binding subunit; Pro 95.88
PRK11701258 phnK phosphonates transport ATP-binding protein; Provis 95.88
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 95.87
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is the 95.82
TIGR00602 670 rad24 checkpoint protein rad24; InterPro: IPR004582 To 95.81
PRK13851343 type IV secretion system protein VirB11; Provisional 95.79
PRK13549513 xylose transporter ATP-binding subunit; Provisional 95.78
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 95.76
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 95.75
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pigment 95.75
KOG00551228 consensus 95.74
PTZ00243 1560 ABC transporter; Provisional 95.74
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding subunit 95.73
COG4608268 AppF ABC-type oligopeptide transport system, ATPase com 95.73
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding component 95.72
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.71
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 95.71
PRK10436461 hypothetical protein; Provisional 95.71
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.7
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase component o 95.69
PRK10261 623 glutathione transporter ATP-binding protein; Provisiona 95.69
cd02032267 Bchl_like This family of proteins contains bchL and chl 95.69
PRK09580248 sufC cysteine desulfurase ATPase component; Reviewed 95.68
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.67
cd03234226 ABCG_White The White subfamily represents ABC transport 95.63
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.62
COG1123 539 ATPase components of various ABC-type transport systems 95.62
PRK13407334 bchI magnesium chelatase subunit I; Provisional 95.61
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 95.6
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNa 95.6
PRK13647273 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.6
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of the L 95.58
PRK11819 556 putative ABC transporter ATP-binding protein; Reviewed 95.57
PRK10895241 putative ABC transporter ATP-binding protein YhbG; Prov 95.55
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 95.55
PRK13975198 thymidylate kinase; Provisional 95.53
PRK13833323 conjugal transfer protein TrbB; Provisional 95.51
PTZ002431560 ABC transporter; Provisional 95.49
PRK10865857 protein disaggregation chaperone; Provisional 95.48
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; Provi 95.46
PRK10938 490 putative molybdenum transport ATP-binding protein ModF; 95.46
COG2805353 PilT Tfp pilus assembly protein, pilus retraction ATPas 95.45
PRK10762501 D-ribose transporter ATP binding protein; Provisional 95.45
PRK13549 513 xylose transporter ATP-binding subunit; Provisional 95.42
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporte 95.42
COG1131293 CcmA ABC-type multidrug transport system, ATPase compon 95.38
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 95.38
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 95.37
cd03215182 ABC_Carb_Monos_II This family represents domain II of t 95.36
PRK06067241 flagellar accessory protein FlaH; Validated 95.36
PRK10851352 sulfate/thiosulfate transporter subunit; Provisional 95.35
PRK10908222 cell division protein FtsE; Provisional 95.35
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor ( 95.34
pfam05049 375 IIGP Interferon-inducible GTPase (IIGP). Interferon-ind 95.34
PRK09984262 phosphonate/organophosphate ester transporter subunit; 95.32
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 95.3
PRK11300255 livG leucine/isoleucine/valine transporter ATP-binding 95.29
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 95.29
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provisiona 95.28
PRK11147632 ABC transporter ATPase component; Reviewed 95.26
pfam01202158 SKI Shikimate kinase. 95.26
PRK11614237 livF leucine/isoleucine/valine transporter ATP-binding 95.25
PRK09700510 D-allose transporter ATP-binding protein; Provisional 95.24
PRK13548257 hmuV hemin importer ATP-binding subunit; Provisional 95.24
COG4598256 HisP ABC-type histidine transport system, ATPase compon 95.21
PRK09302 501 circadian clock protein KaiC; Reviewed 95.21
TIGR02068 876 cya_phycin_syn cyanophycin synthetase; InterPro: IPR011 95.21
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 95.21
PRK11819556 putative ABC transporter ATP-binding protein; Reviewed 95.21
PRK04328250 hypothetical protein; Provisional 95.19
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 95.18
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 95.17
TIGR00345 330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 95.17
cd02040270 NifH NifH gene encodes component II (iron protein) of n 95.17
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, invol 95.15
PRK09544251 znuC high-affinity zinc transporter ATPase; Reviewed 95.15
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.15
PRK10762 501 D-ribose transporter ATP binding protein; Provisional 95.12
PRK11147 632 ABC transporter ATPase component; Reviewed 95.11
PRK13547273 hmuV hemin importer ATP-binding subunit; Provisional 95.11
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 95.09
cd03235213 ABC_Metallic_Cations ABC component of the metal-type tr 95.07
COG2019189 AdkA Archaeal adenylate kinase [Nucleotide transport an 95.07
PRK10636638 putative ABC transporter ATP-binding protein; Provision 95.06
PRK10253265 iron-enterobactin transporter ATP-binding protein; Prov 95.03
PRK04195 403 replication factor C large subunit; Provisional 95.03
PRK13544208 consensus 95.02
PRK13230292 nitrogenase reductase-like protein; Reviewed 95.02
cd04104197 p47_IIGP_like p47 (47-kDa) family. The p47 GTPase famil 95.01
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 95.01
cd03216163 ABC_Carb_Monos_I This family represents the domain I of 95.0
PRK13894320 conjugal transfer ATPase TrbB; Provisional 94.98
PRK13233275 nifH nitrogenase reductase; Reviewed 94.98
PRK03695245 vitamin B12-transporter ATPase; Provisional 94.98
PRK11607 377 potG putrescine transporter ATP-binding subunit; Provis 94.97
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 94.94
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 94.93
COG1135339 AbcC ABC-type metal ion transport system, ATPase compon 94.93
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 94.9
PRK10636 638 putative ABC transporter ATP-binding protein; Provision 94.89
PRK05800170 cobU adenosylcobinamide kinase/adenosylcobinamide-phosp 94.88
COG1341398 Predicted GTPase or GTP-binding protein [General functi 94.87
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding prote 94.85
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 94.85
PRK11231255 fecE iron-dicitrate transporter ATP-binding subunit; Pr 94.84
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily represent 94.83
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 94.8
cd03218232 ABC_YhbG The ABC transporters belonging to the YhbG fam 94.79
PRK11929 953 putative bifunctional UDP-N-acetylmuramoylalanyl-D-glut 94.79
PRK13409590 putative ATPase RIL; Provisional 94.78
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.78
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 94.77
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 94.76
COG4987573 CydC ABC-type transport system involved in cytochrome b 94.73
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) f 94.72
COG0770 451 MurF UDP-N-acetylmuramyl pentapeptide synthase [Cell en 94.71
PRK13536306 nodulation factor exporter subunit NodI; Provisional 94.57
TIGR00968241 3a0106s01 sulfate ABC transporter, ATP-binding protein; 94.53
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 94.53
PRK13542224 consensus 94.53
cd03230173 ABC_DR_subfamily_A This family of ATP-binding proteins 94.52
PRK13869405 plasmid-partitioning protein RepA; Provisional 94.51
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding prote 94.51
cd02034116 CooC The accessory protein CooC, which contains a nucle 94.51
PRK09536 409 btuD corrinoid ABC transporter ATPase; Reviewed 94.5
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 94.49
PRK08533230 flagellar accessory protein FlaH; Reviewed 94.49
PRK13537304 lipooligosaccharide transporter ATP-binding subunit; Pr 94.4
KOG1534273 consensus 94.38
COG4172534 ABC-type uncharacterized transport system, duplicated A 94.38
COG1127263 Ttg2A ABC-type transport system involved in resistance 94.36
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 94.33
PRK11144352 modC molybdate transporter ATP-binding protein; Provisi 94.2
cd03240204 ABC_Rad50 The catalytic domains of Rad50 are similar to 94.19
cd02117212 NifH_like This family contains the NifH (iron protein) 94.15
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 94.14
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 94.14
PRK13231264 nitrogenase reductase-like protein; Reviewed 94.12
pfam01935218 DUF87 Domain of unknown function DUF87. The function of 94.11
COG3839338 MalK ABC-type sugar transport systems, ATPase component 94.1
pfam02283166 CobU Cobinamide kinase / cobinamide phosphate guanyltra 94.1
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 94.08
PRK12402337 replication factor C small subunit 2; Reviewed 94.06
pfam00308219 Bac_DnaA Bacterial dnaA protein. 94.05
PRK10875 607 recD exonuclease V subunit alpha; Provisional 94.0
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component of a 93.99
PRK13539206 cytochrome c biogenesis protein CcmA; Provisional 93.98
PRK00440318 rfc replication factor C small subunit; Reviewed 93.95
TIGR00073225 hypB hydrogenase accessory protein HypB; InterPro: IPR0 93.94
CHL00072271 chlL photochlorophyllide reductase subunit L 93.94
pfam06745231 KaiC KaiC. This family represents a conserved region wi 93.92
KOG0781587 consensus 93.9
cd01394218 radB RadB. The archaeal protein radB shares similarity 93.89
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 93.83
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.01
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.97
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.62
PRK12337492 2-phosphoglycerate kinase; Provisional 97.23
CHL00181287 cbbX CbbX; Provisional 96.46
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 96.24
pfam06309127 Torsin Torsin. This family consists of several eukaryot 96.06
KOG2170344 consensus 95.44
COG1117253 PstB ABC-type phosphate transport system, ATPase compon 95.4
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 95.32
COG4988559 CydD ABC-type transport system involved in cytochrome b 95.27
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 94.9
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 94.81
pfam02456370 Adeno_IVa2 Adenovirus IVa2 protein. IVa2 protein can in 94.71
KOG2228 408 consensus 94.61
TIGR01448 769 recD_rel helicase, RecD/TraA family; InterPro: IPR00634 94.3
COG4962355 CpaF Flp pilus assembly protein, ATPase CpaF [Intracell 93.84
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 97.16
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 96.58
KOG0780 483 consensus 96.62
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.42
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 95.7
CHL00095823 clpC Clp protease ATP binding subunit 94.35
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 94.33
TIGR01447 753 recD exodeoxyribonuclease V, alpha subunit; InterPro: I 96.53
KOG2749415 consensus 94.54
PRK13545 549 tagH teichoic acids export protein ATP-binding subunit; 96.16
KOG1384 348 consensus 95.84
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 96.1
PTZ00265 1467 multidrug resistance protein (mdr1); Provisional 96.05
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, comp 95.68
COG5192 1077 BMS1 GTP-binding protein required for 40S ribosome biog 95.58
PRK10938490 putative molybdenum transport ATP-binding protein ModF; 95.5
PRK11288 501 araG L-arabinose transporter ATP-binding protein; Provi 95.34
pfam00931285 NB-ARC NB-ARC domain. 95.11
PRK09700 510 D-allose transporter ATP-binding protein; Provisional 94.83
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 94.81
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-like (P 94.65
cd03271261 ABC_UvrA_II The excision repair protein UvrA domain II; 94.62
cd03270226 ABC_UvrA_I The excision repair protein UvrA domain I; N 94.57
KOG2655 366 consensus 94.05
PRK10982491 galactose/methyl galaxtoside transporter ATP-binding pr 94.67
>PRK05439 pantothenate kinase; Provisional Back     alignment and domain information
>COG1072 CoaA Panthothenate kinase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00554 panK_bact pantothenate kinase; InterPro: IPR004566 Pantothenate kinase (2 Back     alignment and domain information
>TIGR01425 SRP54_euk signal recognition particle protein SRP54; InterPro: IPR006325 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>cd02025 PanK Pantothenate kinase (PanK) catalyzes the phosphorylation of pantothenic acid to form 4'-phosphopantothenic, which is the first of five steps in coenzyme A (CoA) biosynthetic pathway Back     alignment and domain information
>PRK09270 frcK putative fructose transport system kinase; Reviewed Back     alignment and domain information
>TIGR00235 udk uridine kinase; InterPro: IPR000764 Uridine kinase (pyrimidine ribonucleoside kinase) is the rate-limiting enzyme in the pyrimidine salvage pathway Back     alignment and domain information
>PRK05480 uridine kinase; Provisional Back     alignment and domain information
>PTZ00301 uridine kinase; Provisional Back     alignment and domain information
>cd02023 UMPK Uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK07429 phosphoribulokinase; Provisional Back     alignment and domain information
>COG0572 Udk Uridine kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>pfam00485 PRK Phosphoribulokinase / Uridine kinase family Back     alignment and domain information
>cd02026 PRK Phosphoribulokinase (PRK) is an enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>cd02028 UMPK_like Uridine monophosphate kinase_like (UMPK_like) is a family of proteins highly similar to the uridine monophosphate kinase (UMPK, EC 2 Back     alignment and domain information
>PRK08233 hypothetical protein; Provisional Back     alignment and domain information
>PRK07667 uridine kinase; Provisional Back     alignment and domain information
>PRK06696 uridine kinase; Validated Back     alignment and domain information
>cd02024 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme involved in the metabolism of nicotinamide adenine dinucleotide (NAD+) Back     alignment and domain information
>KOG4203 consensus Back     alignment and domain information
>COG4240 Predicted kinase [General function prediction only] Back     alignment and domain information
>KOG2702 consensus Back     alignment and domain information
>cd02029 PRK_like Phosphoribulokinase-like (PRK-like) is a family of proteins similar to phosphoribulokinase (PRK), the enzyme involved in the Benson-Calvin cycle in chloroplasts or photosynthetic prokaryotes Back     alignment and domain information
>KOG2878 consensus Back     alignment and domain information
>PRK06547 hypothetical protein; Provisional Back     alignment and domain information
>cd02022 DPCK Dephospho-coenzyme A kinase (DPCK, EC 2 Back     alignment and domain information
>PRK00081 coaE dephospho-CoA kinase; Reviewed Back     alignment and domain information
>pfam01121 CoaE Dephospho-CoA kinase Back     alignment and domain information
>PRK01184 hypothetical protein; Provisional Back     alignment and domain information
>COG3954 PrkB Phosphoribulokinase [Energy production and conversion] Back     alignment and domain information
>PRK08118 topology modulation protein; Reviewed Back     alignment and domain information
>PRK02496 adk adenylate kinase; Provisional Back     alignment and domain information
>cd01428 ADK Adenylate kinase (ADK) catalyzes the reversible phosphoryl transfer from adenosine triphosphates (ATP) to adenosine monophosphates (AMP) and to yield adenosine diphosphates (ADP) Back     alignment and domain information
>PRK00279 adk adenylate kinase; Reviewed Back     alignment and domain information
>KOG3079 consensus Back     alignment and domain information
>KOG3308 consensus Back     alignment and domain information
>cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars Back     alignment and domain information
>COG0237 CoaE Dephospho-CoA kinase [Coenzyme metabolism] Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK07261 topology modulation protein; Provisional Back     alignment and domain information
>TIGR02173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR011892 Proteins in this family are believed to be cytidylate kinase Back     alignment and domain information
>PRK03839 putative kinase; Provisional Back     alignment and domain information
>PRK06217 hypothetical protein; Validated Back     alignment and domain information
>COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] Back     alignment and domain information
>PRK04182 cytidylate kinase; Provisional Back     alignment and domain information
>pfam08433 KTI12 Chromatin associated protein KTI12 Back     alignment and domain information
>PRK08356 hypothetical protein; Provisional Back     alignment and domain information
>COG1102 Cmk Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
<
>PRK06762 hypothetical protein; Provisional Back     alignment and domain information