254780831

254780831

hypothetical protein CLIBASIA_03620

GeneID in NCBI database:8209842Locus tag:CLIBASIA_03620
Protein GI in NCBI database:254780831Protein Accession:YP_003065244.1
Gene range:+(791462, 792487)Protein Length:341aa
Gene description:hypothetical protein
COG prediction:[D] ATPases involved in chromosome partitioning
KEGG prediction:hypothetical protein; K03593 ATP-binding protein involved in chromosome partitioning
SEED prediction:Scaffold protein for [4Fe-4S] cluster assembly ApbC, MRP-like
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
cccccHHHHHHHHHHccccccccccccccccccEEEcccEEEEEEEEcccccHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEEccccccHHHHHHHHHHHHHHccccEEEEEcccccccHHHHHcccccccccHHHHcccccccccEEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHHccEEEEEccccHHHHHHHHHHHHHHHHccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEEEEcccHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHHHHc
cccccHHHHHHHHHHccccccccccEEcccEEEEEEcccEEEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccccccccccEEEEEEEcEcccccHHHHHHHHHHHHHHccccEEEEEcccccccccHHcccccccccccccEEccHHHccEEEEEEEEEccccccEEEccHHHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHccccccEEEEEEcHHHHHHHHHHHHHHHHHHccccEEEEEEccEEEEccccccccccccccHHHHHHHHccccEEccccccccHcccccccccEEEccccHHHHHHHHHHHHHHHHHHc
MNQILKNQIVDSlkvlsipgeknniVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTenknppqqrnnlnVKKFVAVasgkggvgksTTVVNIACALknkgknvaildadvygpsipkLLKIsgkveisdkkflkpkenyGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFllidmppgtgdahLTIAqkiplsgvvivstpqdlaLIDVKRAISMYQKMNIPIIGMIENMSYFlasdtgkkydlfgnggarfeaekigipflesvpfdmdvrvlsdLGIPIVVHNMNSATSEIYQEISDRIQQFFV
mnqilknqivdslkvlsipgEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTEnknppqqrnnlnVKKFVAVAsgkggvgkstTVVNIACALKNKGKNVAILDADVYGPSIPKLLKisgkveisdkkflkpkenygIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNvkkfvavasgkggvgksttvvNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
****LKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVV*******************FVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKI***********LKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
**QILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV
MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRSNAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTPQDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPFLESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target341 hypothetical protein CLIBASIA_03620 [Candidatus Liberib
254780881101 Mrp protein [Candidatus Liberibacter asiaticus str 2e-53
254780491101 Mrp protein [Candidatus Liberibacter asiaticus str 2e-53
254780806265 chromosome partitioning protein A [Candidatus Libe 2e-06
>gi|254780881|ref|YP_003065294.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment
 Score =  201 bits (510), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS
Sbjct: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101
           NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
Sbjct: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101

>gi|254780491|ref|YP_003064904.1| Mrp protein [Candidatus Liberibacter asiaticus str. psy62] Length = 101 Back     alignment
 Score =  201 bits (510), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 101/101 (100%), Positives = 101/101 (100%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS
Sbjct: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101
           NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA
Sbjct: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQRNNLNVKKFVAVA 101

>gi|254780806|ref|YP_003065219.1| chromosome partitioning protein A [Candidatus Liberibacter asiaticus str. psy62] Length = 265 Back     alignment
 Score = 44.7 bits (104), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 65/118 (55%), Gaps = 21/118 (17%)

Query: 96  KFVAVASGKGGVGKSTTVVNIACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKK 155
           + + +A+ KGGVGK+TT +N++ AL   G+NV ++D D  G +   L      +E+ D+K
Sbjct: 7   RIITIANQKGGVGKTTTAINLSTALAAIGENVLLIDLDPQGNASTGL-----GIELYDRK 61

Query: 156 FLKPKENYGIKIMSMASLVDENVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPG 213
           +     +Y + I       ++N+  I    ++Q+AI ++  +++   +D L I+M  G
Sbjct: 62  Y----SSYDLLIE------EKNINQI----LIQTAIPNL--SIIPSTMDLLGIEMILG 103

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target341 hypothetical protein CLIBASIA_03620 [Candidatus Liberib
315122330348 hypothetical protein CKC_02910 [Candidatus Liberibacter 1 1e-155
150395667384 hypothetical protein Smed_0442 [Sinorhizobium medicae W 1 1e-101
15964583384 putative MRP protein homolog ATP-binding [Sinorhizobium 1 1e-101
227821020383 putative ATP-binding Mrp family protein [Sinorhizobium 1 1e-101
153007409389 hypothetical protein Oant_0064 [Ochrobactrum anthropi A 1 1e-101
23500972387 mrp-like protein [Brucella suis 1330] Length = 387 1 1e-100
225626603394 protein of unknown function DUF59 [Brucella ceti str. C 1 1e-100
148560560394 mrp-like protein [Brucella ovis ATCC 25840] Length = 39 1 1e-100
306846369387 mrp-related protein [Brucella sp. BO1] Length = 387 1 1e-100
225851598387 hypothetical protein BMEA_A0058 [Brucella melitensis AT 1 1e-99
>gi|315122330|ref|YP_004062819.1| hypothetical protein CKC_02910 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 348 Back     alignment and organism information
 Score =  550 bits (1418), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 265/345 (76%), Positives = 301/345 (87%), Gaps = 4/345 (1%)

Query: 1   MNQILKNQIVDSLKVLSIPGEKNNIVEMQRLSEIFIVHNTVYLSITVPHTIAHQLQSLRS 60
           MNQ ++ QI+D+LK+L IPGE  NIV+M+RLS I IV NT YLSITVPH +A QLQSLR 
Sbjct: 1   MNQNIEQQILDALKILYIPGETINIVDMKRLSNICIVQNTAYLSITVPHNLAQQLQSLRL 60

Query: 61  NAQQIIQNIPTVKNAVVTLTENKNPPQQ----RNNLNVKKFVAVASGKGGVGKSTTVVNI 116
           NAQQI+QNIP +KNAVVTLTENK+ P       N L +   +A+ASGKGGVGKSTT VN+
Sbjct: 61  NAQQIVQNIPQIKNAVVTLTENKSKPILDPIIENKLKINALIAIASGKGGVGKSTTAVNL 120

Query: 117 ACALKNKGKNVAILDADVYGPSIPKLLKISGKVEISDKKFLKPKENYGIKIMSMASLVDE 176
           ACALKNK KNVAILDAD+YGPSIPKLL++SGK EI +KK LKP ENYGIKIMSMASLVD+
Sbjct: 121 ACALKNKNKNVAILDADIYGPSIPKLLQLSGKAEILEKKILKPMENYGIKIMSMASLVDD 180

Query: 177 NVAMIWRGPMVQSAIMHMLHNVVWGQLDFLLIDMPPGTGDAHLTIAQKIPLSGVVIVSTP 236
           NVAMIWRGPMVQSAIMHM  NV WGQLDFLLIDMPPGTGDAHLT+AQKIPLSGVVIVSTP
Sbjct: 181 NVAMIWRGPMVQSAIMHMFQNVSWGQLDFLLIDMPPGTGDAHLTVAQKIPLSGVVIVSTP 240

Query: 237 QDLALIDVKRAISMYQKMNIPIIGMIENMSYFLASDTGKKYDLFGNGGARFEAEKIGIPF 296
           QDLALIDVKRAI+MYQKM +PIIG+IENMSYF+ SDTGK+YDLFGNGG R EAEK+GIPF
Sbjct: 241 QDLALIDVKRAINMYQKMKVPIIGIIENMSYFVTSDTGKRYDLFGNGGVRAEAEKMGIPF 300

Query: 297 LESVPFDMDVRVLSDLGIPIVVHNMNSATSEIYQEISDRIQQFFV 341
           LES+PFDMDVR+LSDLGIPIV+ N NS  S++YQ+ISDRIQ++ +
Sbjct: 301 LESIPFDMDVRILSDLGIPIVIDNPNSVVSKMYQKISDRIQEYLL 345


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150395667|ref|YP_001326134.1| hypothetical protein Smed_0442 [Sinorhizobium medicae WSM419] Length = 384 Back     alignment and organism information
>gi|15964583|ref|NP_384936.1| putative MRP protein homolog ATP-binding [Sinorhizobium meliloti 1021] Length = 384 Back     alignment and organism information
>gi|227821020|ref|YP_002824990.1| putative ATP-binding Mrp family protein [Sinorhizobium fredii NGR234] Length = 383 Back     alignment and organism information
>gi|153007409|ref|YP_001368624.1| hypothetical protein Oant_0064 [Ochrobactrum anthropi ATCC 49188] Length = 389 Back     alignment and organism information
>gi|23500972|ref|NP_697099.1| mrp-like protein [Brucella suis 1330] Length = 387 Back     alignment and organism information
>gi|225626603|ref|ZP_03784642.1| protein of unknown function DUF59 [Brucella ceti str. Cudo] Length = 394 Back     alignment and organism information
>gi|148560560|ref|YP_001258103.1| mrp-like protein [Brucella ovis ATCC 25840] Length = 394 Back     alignment and organism information
>gi|306846369|ref|ZP_07478920.1| mrp-related protein [Brucella sp. BO1] Length = 387 Back     alignment and organism information
>gi|225851598|ref|YP_002731831.1| hypothetical protein BMEA_A0058 [Brucella melitensis ATCC 23457] Length = 387 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target341 hypothetical protein CLIBASIA_03620 [Candidatus Liberib
PRK11670369 PRK11670, PRK11670, antiporter inner membrane protein; 3e-72
cd02037169 cd02037, MRP-like, MRP (Multiple Resistance and pH adap 1e-63
cd02036179 cd02036, MinD, Bacterial cell division requires the for 6e-19
cd03110179 cd03110, Fer4_NifH_child, This protein family's functio 3e-12
CHL00175281 CHL00175, minD, septum-site determining protein; Valida 3e-11
cd02035217 cd02035, ArsA, ArsA ATPase functionas as an efflux pump 3e-09
cd02033329 cd02033, BchX, Chlorophyllide reductase converts chloro 4e-06
TIGR02016296 TIGR02016, BchX, chlorophyllide reductase iron protein 6e-04
COG0489265 COG0489, Mrp, ATPases involved in chromosome partitioni 3e-50
pfam1060981 pfam10609, ParA, ParA/MinD ATPase like 2e-37
COG0455262 COG0455, COG0455, ATPases involved in chromosome partit 1e-17
TIGR01969251 TIGR01969, minD_arch, cell division ATPase MinD, archae 3e-17
COG1149284 COG1149, COG1149, MinD superfamily P-loop ATPase contai 5e-13
COG2894272 COG2894, MinD, Septum formation inhibitor-activating AT 1e-12
TIGR01968261 TIGR01968, minD_bact, septum site-determining protein M 5e-12
COG1192259 COG1192, Soj, ATPases involved in chromosome partitioni 1e-10
COG3640255 COG3640, CooC, CO dehydrogenase maturation factor [Cell 1e-05
cd02040270 cd02040, NifH, NifH gene encodes component II (iron pro 5e-05
KOG3022300 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide 2e-70
pfam01656212 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding 1e-14
TIGR01007204 TIGR01007, eps_fam, capsular exopolysaccharide family 1e-06
cd00550254 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (Ar 2e-04
cd02038139 cd02038, FleN-like, FleN is a member of the Fer4_NifH s 2e-09
cd02042104 cd02042, ParA, ParA and ParB of Caulobacter crescentus 4e-07
cd0198399 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains 1e-05
PHA02518211 PHA02518, PHA02518, ParA-like protein; Provisional 3e-05
PRK13230279 PRK13230, PRK13230, nitrogenase reductase-like protein; 1e-04
TIGR03371246 TIGR03371, cellulose_yhjQ, cellulose synthase operon pr 1e-04
PRK10818270 PRK10818, PRK10818, cell division inhibitor MinD; Provi 2e-04
pfam09140261 pfam09140, MipZ, ATPase MipZ 2e-04
TIGR01287275 TIGR01287, nifH, nitrogenase iron protein 2e-04
cd02034116 cd02034, CooC, The accessory protein CooC, which contai 3e-04
cd02117212 cd02117, NifH_like, This family contains the NifH (iron 3e-04
COG1348278 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorg 3e-04
PRK13185270 PRK13185, chlL, protochlorophyllide reductase iron-sulf 5e-04
pfam00142269 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster bindin 7e-04
cd03115173 cd03115, SRP, The signal recognition particle (SRP) med 0.001
CHL00072290 CHL00072, chlL, photochlorophyllide reductase subunit L 0.001
PRK13849231 PRK13849, PRK13849, putative crown gall tumor protein V 0.001
TIGR03018207 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEPCTERM 0.001
TIGR01281268 TIGR01281, DPOR_bchL, light-independent protochlorophyl 0.001
cd02032267 cd02032, Bchl_like, This family of proteins contains bc 0.002
cd03111106 cd03111, CpaE_like, This protein family consists of pro 0.002
pfam07015231 pfam07015, VirC1, VirC1 protein 0.002
TIGR03499282 TIGR03499, FlhF, flagellar biosynthetic protein FlhF 0.002
>gnl|CDD|183270 PRK11670, PRK11670, antiporter inner membrane protein; Provisional Back     alignment and domain information
>gnl|CDD|73300 cd02037, MRP-like, MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|73299 cd02036, MinD, Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>gnl|CDD|73339 cd03110, Fer4_NifH_child, This protein family's function is unkown Back     alignment and domain information
>gnl|CDD|164554 CHL00175, minD, septum-site determining protein; Validated Back     alignment and domain information
>gnl|CDD|73298 cd02035, ArsA, ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>gnl|CDD|48363 cd02033, BchX, Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>gnl|CDD|162661 TIGR02016, BchX, chlorophyllide reductase iron protein subunit X Back     alignment and domain information
>gnl|CDD|30835 COG0489, Mrp, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|151135 pfam10609, ParA, ParA/MinD ATPase like Back     alignment and domain information
>gnl|CDD|30803 COG0455, COG0455, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|131024 TIGR01969, minD_arch, cell division ATPase MinD, archaeal Back     alignment and domain information
>gnl|CDD|31343 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|32719 COG2894, MinD, Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|131023 TIGR01968, minD_bact, septum site-determining protein MinD Back     alignment and domain information
>gnl|CDD|31385 COG1192, Soj, ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|33438 COG3640, CooC, CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|48369 cd02040, NifH, NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>gnl|CDD|38232 KOG3022, KOG3022, KOG3022, Predicted ATPase, nucleotide-binding [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|145019 pfam01656, CbiA, CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>gnl|CDD|130080 TIGR01007, eps_fam, capsular exopolysaccharide family Back     alignment and domain information
>gnl|CDD|73214 cd00550, ArsA_ATPase, Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>gnl|CDD|73301 cd02038, FleN-like, FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>gnl|CDD|73302 cd02042, ParA, ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>gnl|CDD|73290 cd01983, Fer4_NifH, The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>gnl|CDD|134018 PHA02518, PHA02518, ParA-like protein; Provisional Back     alignment and domain information
>gnl|CDD|183903 PRK13230, PRK13230, nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>gnl|CDD|163238 TIGR03371, cellulose_yhjQ, cellulose synthase operon protein YhjQ Back     alignment and domain information
>gnl|CDD|182756 PRK10818, PRK10818, cell division inhibitor MinD; Provisional Back     alignment and domain information
>gnl|CDD|117696 pfam09140, MipZ, ATPase MipZ Back     alignment and domain information
>gnl|CDD|162286 TIGR01287, nifH, nitrogenase iron protein Back     alignment and domain information
>gnl|CDD|73297 cd02034, CooC, The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>gnl|CDD|48371 cd02117, NifH_like, This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>gnl|CDD|31539 COG1348, NifH, Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|183881 PRK13185, chlL, protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|143913 pfam00142, Fer4_NifH, 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>gnl|CDD|48379 cd03115, SRP, The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>gnl|CDD|177011 CHL00072, chlL, photochlorophyllide reductase subunit L Back     alignment and domain information
>gnl|CDD|139909 PRK13849, PRK13849, putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>gnl|CDD|132063 TIGR03018, pepcterm_TyrKin, exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>gnl|CDD|130348 TIGR01281, DPOR_bchL, light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein Back     alignment and domain information
>gnl|CDD|48362 cd02032, Bchl_like, This family of proteins contains bchL and chlL Back     alignment and domain information
>gnl|CDD|73340 cd03111, CpaE_like, This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>gnl|CDD|148565 pfam07015, VirC1, VirC1 protein Back     alignment and domain information
>gnl|CDD|163294 TIGR03499, FlhF, flagellar biosynthetic protein FlhF Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 341 hypothetical protein CLIBASIA_03620 [Candidatus Liberib
PRK11670369 putative ATPase; Provisional 100.0
KOG3022300 consensus 100.0
cd02037169 MRP-like MRP (Multiple Resistance and pH adaptation) is 100.0
cd03110179 Fer4_NifH_child This protein family's function is unkow 100.0
cd02036179 MinD Bacterial cell division requires the formation of 100.0
cd02117212 NifH_like This family contains the NifH (iron protein) 99.97
pfam01656212 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain. Thi 99.97
cd02038139 FleN-like FleN is a member of the Fer4_NifH superfamily 99.96
PRK13705388 plasmid-partitioning protein SopA; Provisional 99.87
PHA02519387 plasmid partition protein SopA; Reviewed 99.85
PRK00090223 bioD dithiobiotin synthetase; Reviewed 98.81
PRK12374231 putative dithiobiotin synthetase; Provisional 98.63
cd03109134 DTBS Dethiobiotin synthetase (DTBS) is the penultimate 98.35
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 98.35
PRK05632 702 phosphate acetyltransferase; Reviewed 98.32
PRK10416499 cell division protein FtsY; Provisional 98.31
TIGR00313 502 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Co 98.22
cd03115173 SRP The signal recognition particle (SRP) mediates the 98.2
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 98.11
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 98.05
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 98.03
PRK00784 492 cobyric acid synthase; Provisional 98.02
COG0132223 BioD Dethiobiotin synthetase [Coenzyme metabolism] 98.01
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 98.0
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.94
TIGR00064284 ftsY signal recognition particle-docking protein FtsY; 97.81
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 97.69
COG0552340 FtsY Signal recognition particle GTPase [Intracellular 97.49
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 97.28
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 97.24
cd04169267 RF3 RF3 subfamily. Peptide chain release factor 3 (RF3) 97.24
cd04170268 EF-G_bact Elongation factor G (EF-G) subfamily. Translo 97.16
COG0857 354 Pta BioD-like N-terminal domain of phosphotransacetylas 96.87
PRK06278482 cobyrinic acid a,c-diamide synthase; Validated 96.74
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 96.69
cd01886270 EF-G Elongation factor G (EF-G) subfamily. Translocatio 96.67
TIGR02237223 recomb_radB DNA repair and recombination protein RadB; 96.67
pfam07755302 DUF1611 Protein of unknown function (DUF1611). This reg 96.59
COG1492 486 CobQ Cobyric acid synthase [Coenzyme metabolism] 94.97
COG3367339 Uncharacterized conserved protein [Function unknown] 93.67
COG0489265 Mrp ATPases involved in chromosome partitioning [Cell d 100.0
CHL00175279 minD septum-site determining protein; Validated 100.0
TIGR01969258 minD_arch cell division ATPase MinD; InterPro: IPR01022 100.0
pfam00142269 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, 100.0
PRK10818270 cell division inhibitor MinD; Provisional 100.0
TIGR01968272 minD_bact septum site-determining protein MinD; InterPr 100.0
cd02040270 NifH NifH gene encodes component II (iron protein) of n 100.0
TIGR03371246 cellulose_yhjQ cellulose synthase operon protein YhjQ. 100.0
COG0455262 flhG Antiactivator of flagellar biosynthesis FleN, an A 100.0
PRK13231264 nitrogenase reductase-like protein; Reviewed 100.0
PRK13230292 nitrogenase reductase-like protein; Reviewed 100.0
COG2894272 MinD Septum formation inhibitor-activating ATPase [Cell 100.0
PRK13232273 nifH nitrogenase reductase; Reviewed 100.0
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 100.0
PRK13233275 nifH nitrogenase reductase; Reviewed 99.98
PRK13235274 nifH nitrogenase reductase; Reviewed 99.97
pfam06564244 YhjQ YhjQ protein. This family consists of several bact 99.97
cd02032267 Bchl_like This family of proteins contains bchL and chl 99.97
PRK13185269 chlL protochlorophyllide reductase iron-sulfur ATP-bind 99.95
PHA02518211 ParA-like protein; Provisional 99.95
CHL00072271 chlL photochlorophyllide reductase subunit L 99.94
PRK13234293 nifH nitrogenase reductase; Reviewed 99.94
PRK13236295 nitrogenase reductase; Reviewed 99.93
COG1192259 Soj ATPases involved in chromosome partitioning [Cell d 99.92
TIGR03453387 partition_RepA plasmid partitioning protein RepA. Membe 99.9
COG3640255 CooC CO dehydrogenase maturation factor [Cell division 99.9
PRK13869405 plasmid-partitioning protein RepA; Provisional 99.9
TIGR01287278 nifH nitrogenase iron protein; InterPro: IPR005977 The 99.9
cd02033329 BchX Chlorophyllide reductase converts chlorophylls int 99.88
PRK10037250 cell division protein; Provisional 99.88
COG1348278 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion t 99.87
TIGR02016 355 BchX chlorophyllide reductase iron protein subunit X; I 99.87
TIGR01281275 DPOR_bchL light-independent protochlorophyllide reducta 99.85
COG4963366 CpaE Flp pilus assembly protein, ATPase CpaE [Intracell 99.7
PRK01077 451 cobyrinic acid a,c-diamide synthase; Validated 98.34
COG1797 451 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme meta 98.24
PRK13896 432 cobyrinic acid a,c-diamide synthase; Provisional 98.06
TIGR00379 464 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR 97.31
PRK03333 394 coaE dephospho-CoA kinase/unknown domain fusion protein 91.77
cd02035217 ArsA ArsA ATPase functionas as an efflux pump located o 99.95
cd00550254 ArsA_ATPase Oxyanion-translocating ATPase (ArsA). This 99.93
TIGR03029274 EpsG chain length determinant protein tyrosine kinase E 99.92
PRK09841726 cryptic autophosphorylating protein tyrosine kinase Etk 99.91
TIGR01007207 eps_fam capsular exopolysaccharide family; InterPro: IP 99.91
PRK11519720 tyrosine kinase; Provisional 99.9
pfam02374304 ArsA_ATPase Anion-transporting ATPase. This Pfam family 99.72
cd03111106 CpaE_like This protein family consists of proteins simi 99.71
pfam07015231 VirC1 VirC1 protein. This family consists of several ba 99.68
cd02042104 ParA ParA and ParB of Caulobacter crescentus belong to 99.66
PRK13849231 putative crown gall tumor protein VirC1; Provisional 99.64
TIGR00345330 arsA arsenite-activated ATPase (arsA); InterPro: IPR003 99.51
COG0003322 ArsA Predicted ATPase involved in chromosome partitioni 99.5
cd0198399 Fer4_NifH The Fer4_NifH superfamily contains a variety 99.28
TIGR01005778 eps_transp_fam exopolysaccharide transport protein fami 99.23
KOG2825323 consensus 98.68
COG1703323 ArgK Putative periplasmic protein kinase ArgK and relat 98.08
TIGR00347187 bioD dethiobiotin synthase; InterPro: IPR004472 The enz 97.99
cd03114148 ArgK-like The function of this protein family is unkown 97.96
pfam03308267 ArgK ArgK protein. The ArgK protein acts as an ATPase e 97.91
TIGR00750333 lao LAO/AO transport system ATPase; InterPro: IPR005129 97.17
KOG1532366 consensus 96.14
TIGR00337 571 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is 95.68
pfam1060981 ParA ParA/MinD ATPase like. This family contains ATPase 99.93
cd04168237 TetM_like Tet(M)-like subfamily. Tet(M), Tet(O), Tet(W) 96.24
cd01890179 LepA LepA subfamily. LepA belongs to the GTPase family 94.8
TIGR03018207 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosi 99.86
pfam09140261 MipZ ATPase MipZ. MipZ is an ATPase that forms a comple 99.82
cd02034116 CooC The accessory protein CooC, which contains a nucle 99.57
COG3598402 RepA RecA-family ATPase [DNA replication, recombination 94.7
pfam06418275 CTP_synth_N CTP synthase N-terminus. This family consis 92.2
TIGR0294596 SUF_assoc FeS assembly SUF system protein; InterPro: IP 99.73
TIGR03406174 FeS_long_SufT probable FeS assembly SUF system protein 99.69
pfam0188376 DUF59 Domain of unknown function DUF59. This family inc 99.64
COG2151111 PaaD Predicted metal-sulfur cluster biosynthetic enzyme 99.62
TIGR02159152 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; 99.19
KOG3381161 consensus 93.17
COG5133181 Uncharacterized conserved protein [Function unknown] 90.89
TIGR00959 439 ffh signal recognition particle protein; InterPro: IPR0 98.39
COG0541 451 Ffh Signal recognition particle GTPase [Intracellular t 98.21
PRK13505 556 formate--tetrahydrofolate ligase; Provisional 98.18
pfam01268 555 FTHFS Formate--tetrahydrofolate ligase. 98.14
PRK13507 587 formate--tetrahydrofolate ligase; Provisional 98.12
PRK00771433 signal recognition particle protein Srp54; Provisional 98.11
PRK13886241 conjugal transfer protein TraL; Provisional 97.93
PRK09435325 arginine/ornithine transport system ATPase; Provisional 97.79
COG1341398 Predicted GTPase or GTP-binding protein [General functi 97.64
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.57
KOG0780 483 consensus 97.51
PRK13768253 GTPase; Provisional 97.12
pfam03029234 ATP_bind_1 Conserved hypothetical ATP binding protein. 96.84
PRK00313332 lpxK tetraacyldisaccharide 4'-kinase; Provisional 96.03
PRK13506 577 formate--tetrahydrofolate ligase; Provisional 95.98
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 95.77
PRK07667190 uridine kinase; Provisional 95.73
cd03116159 MobB Molybdenum is an essential trace element in the fo 95.33
PRK12377248 putative replication protein; Provisional 95.23
pfam03205122 MobB Molybdopterin guanine dinucleotide synthesis prote 95.21
PRK01906339 tetraacyldisaccharide 4'-kinase; Provisional 95.06
PRK06696227 uridine kinase; Validated 94.95
COG1484254 DnaC DNA replication protein [DNA replication, recombin 94.84
cd00984242 DnaB_C DnaB helicase C terminal domain. The hexameric h 94.81
PRK00652334 lpxK tetraacyldisaccharide 4'-kinase; Reviewed 94.8
PRK09270230 frcK putative fructose transport system kinase; Reviewe 94.79
PRK06749428 replicative DNA helicase; Provisional 94.66
pfam03796186 DnaB_C DnaB-like helicase C terminal domain. The hexame 94.66
KOG0635207 consensus 94.61
pfam05970 418 DUF889 PIF1 helicase. The PIF1 helicase inhibits telome 94.57
PRK10751170 molybdopterin-guanine dinucleotide biosynthesis protein 94.52
PRK03846198 adenylylsulfate kinase; Provisional 94.45
PRK11545177 gntK gluconate kinase 1; Provisional 94.42
COG2759 554 MIS1 Formyltetrahydrofolate synthetase [Nucleotide tran 94.31
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 94.28
) of Arabidopsis thaliana (Mouse-ear cress), mammalian Gephryin (e.g. Q9NQX3 from SWISSPROT) and Drosophila melanogaster (Fruit fly) Cinnamon (P39205 from SWISSPROT) . The MobB domain is similar to that of the urease accessory protein UreG and the hydrogenase accessory protein HypB, both GTP hydrolases involved in loading nickel into the metallocentres of their respective target enzymes. It is involved in the final step of molybdenum-cofactor biosynthesis. While its precise function has not been identified it is thought to be involved in the transfer of a guanine dinucleotide moiety to molybdopterin, as it shows GTP-binding and weak GTPase activity . The MobB protein (P32125 from SWISSPROT) from Escherichia coli, which is comprised of this domain, is a homodimer . Each molecule is composed of two distinct regions - an outer region comprised of 6 beta-strands and three alpha helices, and an inner region comprised of a two-strand beta hairpin followed by an alpha helix. These regions require interaction with the second monomer to allow proper folding to occur. The two monomers are intertwined and form an extensive 16-stranded beta-sheet. While the active site could not be positively identified, the presence of highly conserved residues suggests the substrate binding site occurs in the central solvent channel.; GO: 0005525 GTP binding, 0006777 Mo-molybdopterin cofactor biosynthetic process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00176">TIGR00176165 mobB molybdopterin-guanine dinucleotide biosynthesis pr 94.25
cd01394218 radB RadB. The archaeal protein radB shares similarity 94.24
COG2403449 Predicted GTPase [General function prediction only] 94.24
COG1072283 CoaA Panthothenate kinase [Coenzyme metabolism] 94.07
PRK05541176 adenylylsulfate kinase; Provisional 93.98
PRK06526254 transposase; Provisional 93.89
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 93.78
COG0529197 CysC Adenylylsulfate kinase and related kinases [Inorga 93.72
cd02028179 UMPK_like Uridine monophosphate kinase_like (UMPK_like) 93.71
PRK07952242 DNA replication protein DnaC; Validated 93.65
PRK09183258 transposase/IS protein; Provisional 93.63
PRK08181269 transposase; Validated 93.51
TIGR03600421 phage_DnaB phage replicative helicase, DnaB family, HK0 93.46
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 93.39
PRK08506473 replicative DNA helicase; Provisional 93.29
cd01122271 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' he 93.25
pfam00485196 PRK Phosphoribulokinase / Uridine kinase family. In Ara 93.23
pfam02606318 LpxK Tetraacyldisaccharide-1-P 4'-kinase. This family c 93.21
cd02023198 UMPK Uridine monophosphate kinase (UMPK, EC 2.7.1.48), 93.19
PRK08939306 primosomal protein DnaI; Reviewed 93.1
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 93.09
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 93.09
TIGR01618229 phage_P_loop phage nucleotide-binding protein; InterPro 93.0
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 92.92
PRK05380 534 pyrG CTP synthetase; Validated 92.91
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 92.9
PRK00889175 adenylylsulfate kinase; Provisional 92.69
PRK08533230 flagellar accessory protein FlaH; Reviewed 92.69
PRK07004460 replicative DNA helicase; Provisional 92.66
COG1663336 LpxK Tetraacyldisaccharide-1-P 4'-kinase [Cell envelope 92.51
PRK05595444 replicative DNA helicase; Provisional 92.36
smart00382148 AAA ATPases associated with a variety of cellular activ 92.28
PRK09165484 replicative DNA helicase; Provisional 92.26
TIGR01054 1843 rgy reverse gyrase; InterPro: IPR005736 DNA topoisomera 92.2
PRK05748448 replicative DNA helicase; Provisional 92.18
cd01124187 KaiC KaiC is a circadian clock protein primarily found 92.02
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 91.79
PRK07263453 consensus 91.57
COG1763161 MobB Molybdopterin-guanine dinucleotide biosynthesis pr 91.54
PRK08082453 consensus 91.37
TIGR01085 494 murE UDP-N-acetylmuramyl-tripeptide synthetases; InterP 91.35
pfam08433266 KTI12 Chromatin associated protein KTI12. This is a fam 91.31
PRK03839180 putative kinase; Provisional 91.26
TIGR03574249 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Members 91.26
PRK05636507 replicative DNA helicase; Provisional 91.18
PRK08116262 hypothetical protein; Validated 91.1
PRK09401 1176 reverse gyrase; Reviewed 91.1
cd02025220 PanK Pantothenate kinase (PanK) catalyzes the phosphory 91.05
COG4088261 Predicted nucleotide kinase [Nucleotide transport and m 90.98
KOG1533290 consensus 90.96
PRK05480209 uridine kinase; Provisional 90.85
PRK08006471 replicative DNA helicase; Provisional 90.79
PRK08840464 replicative DNA helicase; Provisional 90.78
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 90.6
PRK08760476 replicative DNA helicase; Provisional 90.58
PRK09825176 idnK D-gluconate kinase; Provisional 90.48
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 90.47
PRK09302501 circadian clock protein KaiC; Reviewed 90.46
PRK08694468 consensus 90.46
cd02021150 GntK Gluconate kinase (GntK) catalyzes the phosphoryl t 90.03
cd00477 524 FTHFS Formyltetrahydrofolate synthetase (FTHFS) catalyz 98.08
PRK13748 561 putative mercuric reductase; Provisional 92.77
TIGR00416 481 sms DNA repair protein RadA; InterPro: IPR004504 RadA/S 90.64
PRK04220306 2-phosphoglycerate kinase; Provisional 90.61
PRK10867 453 signal recognition particle protein; Provisional 98.07
TIGR01425 453 SRP54_euk signal recognition particle protein SRP54; In 97.6
KOG0781587 consensus 96.26
KOG1534273 consensus 93.79
PRK00741526 prfC peptide chain release factor 3; Provisional 95.96
PRK04690 468 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.01
pfam00931285 NB-ARC NB-ARC domain. 92.71
>PRK11670 putative ATPase; Provisional Back     alignment and domain information
>KOG3022 consensus Back     alignment and domain information
>cd02037 MRP-like MRP (Multiple Resistance and pH adaptation) is a homologue of the Fer4_NifH superfamily Back     alignment and domain information
>cd03110 Fer4_NifH_child This protein family's function is unkown Back     alignment and domain information
>cd02036 MinD Bacterial cell division requires the formation of a septum at mid-cell Back     alignment and domain information
>cd02117 NifH_like This family contains the NifH (iron protein) of nitrogenase, L subunit (BchL/ChlL) of the protochlorophyllide reductase and the BchX subunit of the Chlorophyllide reductase Back     alignment and domain information
>pfam01656 CbiA CobQ/CobB/MinD/ParA nucleotide binding domain Back     alignment and domain information
>cd02038 FleN-like FleN is a member of the Fer4_NifH superfamily Back     alignment and domain information
>PRK13705 plasmid-partitioning protein SopA; Provisional Back     alignment and domain information
>PHA02519 plasmid partition protein SopA; Reviewed Back     alignment and domain information
>PRK00090 bioD dithiobiotin synthetase; Reviewed Back     alignment and domain information
>PRK12374 putative dithiobiotin synthetase; Provisional Back     alignment and domain information
>cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms Back     alignment and domain information
>PRK06731 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK05632 phosphate acetyltransferase; Reviewed Back     alignment and domain information
>PRK10416 cell division protein FtsY; Provisional Back     alignment and domain information
>TIGR00313 cobQ cobyric acid synthase CobQ; InterPro: IPR004459 Cobyric acid synthase (CobQ) catalyses amidations at positions B, D, E, and G on adenosylcobyrinic A,C-diamide in the biosynthesis of cobalamin Back     alignment and domain information
>cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes Back     alignment and domain information
>pfam00448 SRP54 SRP54-type protein, GTPase domain Back     alignment and domain information
>PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>PRK00784 cobyric acid synthase; Provisional Back     alignment and domain information
>COG0132 BioD Dethiobiotin synthetase [Coenzyme metabolism] Back     alignment and domain information
>PRK12723 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>PRK06995 flhF flagellar biosynthesis regulator FlhF; Validated Back     alignment and domain information
>TIGR00064 ftsY signal recognition particle-docking protein FtsY; InterPro: IPR004390 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>PRK12727 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] Back     alignment and domain information
>PRK12726 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd04169 RF3 RF3 subfamily Back     alignment and domain information
>cd04170 EF-G_bact Elongation factor G (EF-G) subfamily Back     alignment and domain information
>COG0857 Pta BioD-like N-terminal domain of phosphotransacetylase [General function prediction only] Back     alignment and domain information
>PRK06278 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>PRK12724 flagellar biosynthesis regulator FlhF; Provisional Back     alignment and domain information
>cd01886 EF-G Elongation factor G (EF-G) subfamily Back     alignment and domain information
>TIGR02237 recomb_radB DNA repair and recombination protein RadB; InterPro: IPR011939 This family consists exclusively of archaeal RadB protein, a homolog of bacterial RecA, eukaryotic RAD51 (IPR011941 from INTERPRO) and DMC1 (IPR011940 from INTERPRO), and archaeal RadA (IPR011938 from INTERPRO) ,, Back     alignment and domain information
>pfam07755 DUF1611 Protein of unknown function (DUF1611) Back     alignment and domain information
>COG1492 CobQ Cobyric acid synthase [Coenzyme metabolism] Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG0489 Mrp ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>CHL00175 minD septum-site determining protein; Validated Back     alignment and domain information
>TIGR01969 minD_arch cell division ATPase MinD; InterPro: IPR010224 Proper placement of the bacterial cell division site requires the site-specific inactivation of other potential division sites Back     alignment and domain information
>pfam00142 Fer4_NifH 4Fe-4S iron sulfur cluster binding proteins, NifH/frxC family Back     alignment and domain information
>PRK10818 cell division inhibitor MinD; Provisional Back     alignment and domain information
>TIGR01968 minD_bact septum site-determining protein MinD; InterPro: IPR010223 This entry describes the bacterial and chloroplast form of MinD, a multifunctional cell division protein that guides correct placement of the septum Back     alignment and domain information
>cd02040 NifH NifH gene encodes component II (iron protein) of nitrogenase Back     alignment and domain information
>TIGR03371 cellulose_yhjQ cellulose synthase operon protein YhjQ Back     alignment and domain information
>COG0455 flhG Antiactivator of flagellar biosynthesis FleN, an ATPase [Cell motility] Back     alignment and domain information
>PRK13231 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>PRK13230 nitrogenase reductase-like protein; Reviewed Back     alignment and domain information
>COG2894 MinD Septum formation inhibitor-activating ATPase [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13232 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK13233 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13235 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>pfam06564 YhjQ YhjQ protein Back     alignment and domain information
>cd02032 Bchl_like This family of proteins contains bchL and chlL Back     alignment and domain information
>PRK13185 chlL protochlorophyllide reductase iron-sulfur ATP-binding protein; Provisional Back     alignment and domain information
>PHA02518 ParA-like protein; Provisional Back     alignment and domain information
>CHL00072 chlL photochlorophyllide reductase subunit L Back     alignment and domain information
>PRK13234 nifH nitrogenase reductase; Reviewed Back     alignment and domain information
>PRK13236 nitrogenase reductase; Reviewed Back     alignment and domain information
>COG1192 Soj ATPases involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR03453 partition_RepA plasmid partitioning protein RepA Back     alignment and domain information
>COG3640 CooC CO dehydrogenase maturation factor [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK13869 plasmid-partitioning protein RepA; Provisional Back     alignment and domain information
>TIGR01287 nifH nitrogenase iron protein; InterPro: IPR005977 The enzyme responsible for nitrogen fixation, the nitrogenase, shows a high degree of conservation of structure, function, and amino acid sequence across wide phylogenetic ranges Back     alignment and domain information
>cd02033 BchX Chlorophyllide reductase converts chlorophylls into bacteriochlorophylls by reducing the chlorin B-ring Back     alignment and domain information
>PRK10037 cell division protein; Provisional Back     alignment and domain information
>COG1348 NifH Nitrogenase subunit NifH (ATPase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02016 BchX chlorophyllide reductase iron protein subunit X; InterPro: IPR010246 This entry represents the X subunit of the three-subunit enzyme, (bacterio)chlorophyllide reductase , Back     alignment and domain information
>TIGR01281 DPOR_bchL light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein; InterPro: IPR005971 Synonym: dark protochlorophyllide reductase Protochlorophyllide reductase catalyzes the reductive formation of chlorophyllide from protochlorophyllide during biosynthesis of chlorophylls and bacteriochlorophylls Back     alignment and domain information
>COG4963 CpaE Flp pilus assembly protein, ATPase CpaE [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK01077 cobyrinic acid a,c-diamide synthase; Validated Back     alignment and domain information
>COG1797 CobB Cobyrinic acid a,c-diamide synthase [Coenzyme metabolism] Back     alignment and domain information
>PRK13896 cobyrinic acid a,c-diamide synthase; Provisional Back     alignment and domain information
>TIGR00379 cobB cobyrinic acid a,c-diamide synthase; InterPro: IPR004484 This family describes cobyrinic acid a,c-diamide synthase, the cobB (cbiA in Salmonella) protein of cobalamin biosynthesis Back     alignment and domain information
>PRK03333 coaE dephospho-CoA kinase/unknown domain fusion protein; Provisional Back     alignment and domain information
>cd02035 ArsA ArsA ATPase functionas as an efflux pump located on the inner membrane of the cell Back     alignment and domain information
>cd00550 ArsA_ATPase Oxyanion-translocating ATPase (ArsA) Back     alignment and domain information
>TIGR03029 EpsG chain length determinant protein tyrosine kinase EpsG Back     alignment and domain information
>PRK09841 cryptic autophosphorylating protein tyrosine kinase Etk; Provisional Back     alignment and domain information
>TIGR01007 eps_fam capsular exopolysaccharide family; InterPro: IPR005702 This family describes the capsular exopolysaccharide proteins in bacteria Back     alignment and domain information
>PRK11519 tyrosine kinase; Provisional Back     alignment and domain information
>pfam02374 ArsA_ATPase Anion-transporting ATPase Back     alignment and domain information
>cd03111 CpaE_like This protein family consists of proteins similar to the cpaE protein of the Caulobacter pilus assembly and the orf4 protein of Actinobacillus pilus formation gene cluster Back     alignment and domain information
>pfam07015 VirC1 VirC1 protein Back     alignment and domain information
>cd02042 ParA ParA and ParB of Caulobacter crescentus belong to a conserved family of bacterial proteins implicated in chromosome segregation Back     alignment and domain information
>PRK13849 putative crown gall tumor protein VirC1; Provisional Back     alignment and domain information
>TIGR00345 arsA arsenite-activated ATPase (arsA); InterPro: IPR003348 This ATPase is involved in the removal of arsenate, antimonite, and arsenate from the cell Back     alignment and domain information
>COG0003 ArsA Predicted ATPase involved in chromosome partitioning [Cell division and chromosome partitioning] Back     alignment and domain information
>cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain Back     alignment and domain information
>TIGR01005 eps_transp_fam exopolysaccharide transport protein family; InterPro: IPR005700 The bacterial exopolysaccharide transport protein is part of a large genetic locus which is associated with exopolysaccharide (EPS) biosynthesis Back     alignment and domain information
>KOG2825 consensus Back     alignment and domain information
>COG1703 ArgK Putative periplasmic protein kinase ArgK and related GTPases of G3E family [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00347 bioD dethiobiotin synthase; InterPro: IPR004472 The enzyme is involved in biotin biosynthesis and catalyses the reaction (CO2 + 7,8-diaminononanoate + ATP = dethiobiotin + phosphate + ADP) Back     alignment and domain information
>cd03114 ArgK-like The function of this protein family is unkown Back     alignment and domain information
>pfam03308 ArgK ArgK protein Back     alignment and domain information
>TIGR00750 lao LAO/AO transport system ATPase; InterPro: IPR005129 Bacterial periplasmic transport systems require the function of a specific substrate-binding protein, located in the periplasm, and several cytoplasmic membrane transport components Back     alignment and domain information
>KOG1532 consensus Back     alignment and domain information
>TIGR00337 PyrG CTP synthase; InterPro: IPR004468 CTP synthase is involved in pyrimidine ribonucleotide/ribonucleoside metabolism Back     alignment and domain information
>pfam10609 ParA ParA/MinD ATPase like Back     alignment and domain information
>cd04168 TetM_like Tet(M)-like subfamily Back     alignment and domain information
>cd01890 LepA LepA subfamily Back     alignment and domain information
>TIGR03018 pepcterm_TyrKin exopolysaccharide/PEPCTERM locus tyrosine autokinase Back     alignment and domain information
>pfam09140 MipZ ATPase MipZ Back     alignment and domain information
>cd02034 CooC The accessory protein CooC, which contains a nucleotide-binding domain (P-loop) near the N-terminus, participates in the maturation of the nickel center of carbon monoxide dehydrogenase (CODH) Back     alignment and domain information
>COG3598 RepA RecA-family ATPase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam06418 CTP_synth_N CTP synthase N-terminus Back     alignment and domain information
>TIGR02945 SUF_assoc FeS assembly SUF system protein; InterPro: IPR014291 Iron-sulphur (FeS) clusters are important cofactors for numerous proteins involved in electron transfer, in redox and non-redox catalysis, in gene regulation, and as sensors of oxygen and iron Back     alignment and domain information
>TIGR03406 FeS_long_SufT probable FeS assembly SUF system protein SufT Back     alignment and domain information
>pfam01883 DUF59 Domain of unknown function DUF59 Back     alignment and domain information
>COG2151 PaaD Predicted metal-sulfur cluster biosynthetic enzyme [General function prediction only] Back     alignment and domain information
>TIGR02159 PA_CoA_Oxy4 phenylacetate-CoA oxygenase, PaaJ subunit; InterPro: IPR011883 Phenylacetate-CoA oxygenase is comprised of a five gene complex responsible for the hydroxylation of phenylacetate-CoA (PA-CoA) as the second catabolic step in phenylacetic acid (PA) degradation , Back     alignment and domain information
>KOG3381 consensus Back     alignment and domain information
>COG5133 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00959 ffh signal recognition particle protein; InterPro: IPR004780 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes , Back     alignment and domain information
>COG0541 Ffh Signal recognition particle GTPase [Intracellular trafficking and secretion] Back     alignment and domain information
>PRK13505 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>pfam01268 FTHFS Formate--tetrahydrofolate ligase Back     alignment and domain information
>PRK13507 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information
>PRK00771 signal recognition particle protein Srp54; Provisional Back     alignment and domain information
>PRK13886 conjugal transfer protein TraL; Provisional Back     alignment and domain information
>PRK09435 arginine/ornithine transport system ATPase; Provisional Back     alignment and domain information
>COG1341 Predicted GTPase or GTP-binding protein [General function prediction only] Back     alignment and domain information
>TIGR03499 FlhF flagellar biosynthetic protein FlhF Back     alignment and domain information
>KOG0780 consensus Back     alignment and domain information
>PRK13768 GTPase; Provisional Back     alignment and domain information
>pfam03029 ATP_bind_1 Conserved hypothetical ATP binding protein Back     alignment and domain information
>PRK00313 lpxK tetraacyldisaccharide 4'-kinase; Provisional Back     alignment and domain information
>PRK13506 formate--tetrahydrofolate ligase; Provisional Back     alignment and domain information