254780832

254780832

putative potassium uptake transport system protein

GeneID in NCBI database:8209843Locus tag:CLIBASIA_03625
Protein GI in NCBI database:254780832Protein Accession:YP_003065245.1
Gene range:+(792781, 794667)Protein Length:628aa
Gene description:putative potassium uptake transport system protein
COG prediction:[P] K+ transporter
KEGG prediction:kup; putative potassium uptake transport system protein; K03549 KUP system potassium uptake protein
SEED prediction:Kup system potassium uptake protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Potassium homeostasis;
Glutathione-regulated potassium-efflux system and associated functions
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM12 TM-Helix
TOPPRED12 TM-Helix
HMMTOP11 TM-Helix
MEMSAT12 TM-Helix
MEMSAT_SVM12 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------63
MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
ccccccccccccccHHHHHHHHcccEEccccccHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHEEccccccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccHHHHHHHHcccEEEccccccEEHHHHHHHHHHHHHHccccccccEEEEccHHHHHHHHHHHHHHHccccccHHHHHccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHEEHHHHHHHHHHHHHHHHHHHHccccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccccccEEEHHHHHHHHHHHHHHHHHccccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHcccccccccEEEEEEccccccccHHHHHHHHHcccccEEEEEEEEEEcccccccHHHEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHcccccccccEEEEEEEEEEEcccccccHHHHHHHHHHHHHccccHHHHcccccccEEEEEEEEEc
ccccccccccccccHHHHHHHHccEEEccccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHccccccHEEEEEEEHcHHHHcccccccHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHcHHHHHHHHHHcccEEEEEEEHHEEEcccHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcHHHHHHccHHHHcccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEEccHHHcccEEcHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHcccEEHHHHHcccccHHHHHHccccccccccEEEEEEcccccccHHHHHHHccccccEEEEEEEEEEEEcccccccHccEEEEEEccccEEEEEEEEcccccccHHHHHHHHHHccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHccccccHcEcccccEEEEEEEEEc
mntqtedlqknspnpfyLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLagsalfigdsmvtpALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQshgtkgvacfFSPIMVAWLLMITVSGLIhisddwgilaafnpMYALHMVFGKGTISLVVLGSVFLTITGAEALYADlghfgrkpiQYAWMVIFPALAINYLGQgalvlsnpeaikdpfymmfggwflpFAVLTATCATVIASQAVITGTFSLARQAIHlgflprmkifftsetfkgqvflpsinLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKvldggytpLLIASLCIIVMWTWRRGTNLLSTltrhadipiHSFIISIenssqqvpgtaifltsdsqavpDALLQNIKHNRILHEQNIILTintanqpripkekRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNglkfeimntsfylgrrklvptsragmpnwqDHLFIMLStyaedpsdyfhlpanRVVEIVSHVNI
mntqtedlqknspnPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILtintanqpripKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGIlsllalllKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFiilialgilvllfmlQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINlflfvgvllfvigfRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
*****************LMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHS**IS**N**QQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
*********KNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
************PNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI
MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALYADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVPGTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFSRVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIMLSTYAEDPSDYFHLPANRVVEIVSHVNI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target628 putative potassium uptake transport system protein [Can
315122331626 putative potassium uptake transport system protein [Can 1 0.0
116250696632 potassium uptake transport system protein [Rhizobium le 1 0.0
241203298632 K potassium transporter [Rhizobium leguminosarum bv. tr 1 0.0
209548114632 K potassium transporter [Rhizobium leguminosarum bv. tr 1 0.0
86356507632 potassium transporter protein [Rhizobium etli CFN 42] L 1 0.0
86359804632 potassium transporter protein [Rhizobium etli CFN 42] L 1 0.0
190890572632 potassium transporter protein [Rhizobium etli CIAT 652] 1 0.0
222085039633 potassium transporter protein [Agrobacterium radiobacte 1 0.0
150395669630 K potassium transporter [Sinorhizobium medicae WSM419] 1 0.0
190404460632 rcorf116 [Agrobacterium rhizogenes] Length = 632 1 0.0
>gi|315122331|ref|YP_004062820.1| putative potassium uptake transport system protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 626 Back     alignment and organism information
 Score = 1047 bits (2707), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/628 (84%), Positives = 582/628 (92%), Gaps = 2/628 (0%)

Query: 1   MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIG 60
           MNT  EDLQKN+ NPFYLMFESIGVVYGDIGTSVLYAFKEALKT  MNHT LV R EVIG
Sbjct: 1   MNTCREDLQKNNRNPFYLMFESIGVVYGDIGTSVLYAFKEALKT--MNHTSLVGRVEVIG 58

Query: 61  LVSLMIWVLTIVVTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSAL 120
           LVSLMIW+LTI+VTIKY+LLLLRADN GEGGILSLLALLLKKIP+ S +LI LGL G AL
Sbjct: 59  LVSLMIWILTIIVTIKYVLLLLRADNGGEGGILSLLALLLKKIPQHSNILIVLGLIGFAL 118

Query: 121 FIGDSMVTPALSVLSAVEGVRYIAPELDNFIILIALGILVLLFMLQSHGTKGVACFFSPI 180
           FIGD+MVTPALSVLSAVEG+RYI PELD FIILIALGIL+LLFM+QSHGT+G+ACFFSPI
Sbjct: 119 FIGDTMVTPALSVLSAVEGIRYIMPELDGFIILIALGILILLFMIQSHGTQGIACFFSPI 178

Query: 181 MVAWLLMITVSGLIHISDDWGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAEALY 240
           MV WLLMIT+SGLIHISDDWGILAAFNP+YAL+MV GKG++SL+VL SVFLTITGAEALY
Sbjct: 179 MVIWLLMITISGLIHISDDWGILAAFNPLYALYMVVGKGSVSLLVLASVFLTITGAEALY 238

Query: 241 ADLGHFGRKPIQYAWMVIFPALAINYLGQGALVLSNPEAIKDPFYMMFGGWFLPFAVLTA 300
           ADLGHFGRKPIQYAWM+IFPAL INYLGQGALVL+NPEAI DPFYMMF GWFLPFA+L A
Sbjct: 239 ADLGHFGRKPIQYAWMIIFPALTINYLGQGALVLANPEAIADPFYMMFAGWFLPFAILMA 298

Query: 301 TCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLF 360
           TCATVIASQAVITGTFSL RQAIHLGFLP MKIFFTSET KGQ+FLPSINLF+F+GV++F
Sbjct: 299 TCATVIASQAVITGTFSLTRQAIHLGFLPPMKIFFTSETLKGQMFLPSINLFMFLGVMVF 358

Query: 361 VIGFRHSESLVAAYGISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLG 420
           VIGF++SESLV+AYGISVSGTMVISTIMFSVF  V WKWK+SKVIIF+ PLL IEMTFLG
Sbjct: 359 VIGFKNSESLVSAYGISVSGTMVISTIMFSVFSRVYWKWKLSKVIIFILPLLLIEMTFLG 418

Query: 421 ANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLSTLTRHADIPIHSFIISIENSSQQVP 480
           ANL +  D GY PLLIA+L I++MWTW RGTNLLSTLTRH DIP+ SFI+SIE SSQ+VP
Sbjct: 419 ANLLRFFDRGYVPLLIATLFIVIMWTWIRGTNLLSTLTRHTDIPVQSFILSIEKSSQKVP 478

Query: 481 GTAIFLTSDSQAVPDALLQNIKHNRILHEQNIILTINTANQPRIPKEKRFVCEKISEHFS 540
           GTAIFLTSDS+AVPDALLQNIKHN +LHEQNIILTINTANQPR+PKE+RF+CEKISE FS
Sbjct: 479 GTAIFLTSDSEAVPDALLQNIKHNHVLHEQNIILTINTANQPRLPKEERFICEKISESFS 538

Query: 541 RVELFFGYMEEQNVSQALAELRNNGLKFEIMNTSFYLGRRKLVPTSRAGMPNWQDHLFIM 600
           R++LFFGYMEEQNVSQALA+LRNNGLKFEIMNTSFYLGRRKLVP SR+GMPNWQD+LFIM
Sbjct: 539 RIQLFFGYMEEQNVSQALADLRNNGLKFEIMNTSFYLGRRKLVPISRSGMPNWQDNLFIM 598

Query: 601 LSTYAEDPSDYFHLPANRVVEIVSHVNI 628
           +  YAEDPSDYF+LPANRVVEIVSHVNI
Sbjct: 599 MFAYAEDPSDYFYLPANRVVEIVSHVNI 626


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116250696|ref|YP_766534.1| potassium uptake transport system protein [Rhizobium leguminosarum bv. viciae 3841] Length = 632 Back     alignment and organism information
>gi|241203298|ref|YP_002974394.1| K potassium transporter [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 632 Back     alignment and organism information
>gi|209548114|ref|YP_002280031.1| K potassium transporter [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 632 Back     alignment and organism information
>gi|86356507|ref|YP_468399.1| potassium transporter protein [Rhizobium etli CFN 42] Length = 632 Back     alignment and organism information
>gi|86359804|ref|YP_471695.1| potassium transporter protein [Rhizobium etli CFN 42] Length = 632 Back     alignment and organism information
>gi|190890572|ref|YP_001977114.1| potassium transporter protein [Rhizobium etli CIAT 652] Length = 632 Back     alignment and organism information
>gi|222085039|ref|YP_002543568.1| potassium transporter protein [Agrobacterium radiobacter K84] Length = 633 Back     alignment and organism information
>gi|150395669|ref|YP_001326136.1| K potassium transporter [Sinorhizobium medicae WSM419] Length = 630 Back     alignment and organism information
>gi|190404460|ref|YP_001961091.1| rcorf116 [Agrobacterium rhizogenes] Length = 632 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target628 putative potassium uptake transport system protein [Can
PRK10745622 PRK10745, trkD, potassium transport protein Kup; Provis 1e-161
COG3158627 COG3158, Kup, K+ transporter [Inorganic ion transport a 0.0
pfam02705731 pfam02705, K_trans, K+ potassium transporter 1e-127
TIGR00794688 TIGR00794, kup, potassium uptake protein 1e-123
PLN00150779 PLN00150, PLN00150, potassium ion transporter family pr 6e-89
PLN00148 785 PLN00148, PLN00148, potassium transporter; Provisional 3e-77
PLN00151852 PLN00151, PLN00151, potassium transporter; Provisional 7e-81
PLN00149779 PLN00149, PLN00149, potassium transporter; Provisional 1e-69
>gnl|CDD|182693 PRK10745, trkD, potassium transport protein Kup; Provisional Back     alignment and domain information
>gnl|CDD|32972 COG3158, Kup, K+ transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|145714 pfam02705, K_trans, K+ potassium transporter Back     alignment and domain information
>gnl|CDD|129876 TIGR00794, kup, potassium uptake protein Back     alignment and domain information
>gnl|CDD|165718 PLN00150, PLN00150, potassium ion transporter family protein; Provisional Back     alignment and domain information
>gnl|CDD|177752 PLN00148, PLN00148, potassium transporter; Provisional Back     alignment and domain information
>gnl|CDD|177754 PLN00151, PLN00151, potassium transporter; Provisional Back     alignment and domain information
>gnl|CDD|177753 PLN00149, PLN00149, potassium transporter; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 628 putative potassium uptake transport system protein [Can
PRK10745622 trkD potassium transport protein Kup; Provisional 100.0
COG3158627 Kup K+ transporter [Inorganic ion transport and metabol 100.0
pfam02705731 K_trans K+ potassium transporter. This is a family of K 100.0
TIGR00794814 kup potassium uptake protein; InterPro: IPR003855 This 100.0
PRK10644445 arginine:agmatin antiporter; Provisional 99.66
COG0531466 PotE Amino acid transporters [Amino acid transport and 99.6
PRK10249458 phenylalanine transporter; Provisional 99.02
PRK10836489 lysine transporter; Provisional 98.65
KOG1286554 consensus 98.48
COG0833541 LysP Amino acid transporters [Amino acid transport and 96.78
PRK11021410 inner membrane protein YjeH; Provisional 99.59
pfam00324473 AA_permease Amino acid permease. 98.88
TIGR03428475 ureacarb_perm permease, urea carboxylase system. A numb 98.62
PRK10197446 gamma-aminobutyrate transporter; Provisional 98.57
TIGR00909451 2A0306 amino acid transporter; InterPro: IPR004758 Amin 97.81
PRK10580457 proY putative proline-specific permease; Provisional 99.52
PRK10238456 aromatic amino acid transporter; Provisional 99.52
PRK11387465 S-methylmethionine transporter; Provisional 99.47
PRK10746461 putative transport protein YifK; Provisional 99.05
KOG1287479 consensus 98.19
KOG1289550 consensus 92.88
TIGR00911546 2A0308 L-type amino acid transporter; InterPro: IPR0047 92.75
PRK10435435 cadB lysine/cadaverine antiporter; Provisional 99.51
PRK11357445 frlA putative fructoselysine transporter; Provisional 99.47
COG1113462 AnsP Gamma-aminobutyrate permease and related permeases 97.73
PRK10655438 potE putrescine transporter; Provisional 99.47
PRK11049469 D-alanine/D-serine/glycine permease; Provisional 99.28
pfam01490405 Aa_trans Transmembrane amino acid transporter protein. 93.28
>PRK10745 trkD potassium transport protein Kup; Provisional Back     alignment and domain information
>COG3158 Kup K+ transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam02705 K_trans K+ potassium transporter Back     alignment and domain information
>TIGR00794 kup potassium uptake protein; InterPro: IPR003855 This is a family of K+ potassium transporters that are conserved across phyla, having both bacterial (KUP) , yeast (HAK) , and plant (AtKT) sequences as members Back     alignment and domain information
>PRK10644 arginine:agmatin antiporter; Provisional Back     alignment and domain information
>COG0531 PotE Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10249 phenylalanine transporter; Provisional Back     alignment and domain information
>PRK10836 lysine transporter; Provisional Back     alignment and domain information
>KOG1286 consensus Back     alignment and domain information
>COG0833 LysP Amino acid transporters [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11021 inner membrane protein YjeH; Provisional Back     alignment and domain information
>pfam00324 AA_permease Amino acid permease Back     alignment and domain information
>TIGR03428 ureacarb_perm permease, urea carboxylase system Back     alignment and domain information
>PRK10197 gamma-aminobutyrate transporter; Provisional Back     alignment and domain information
>TIGR00909 2A0306 amino acid transporter; InterPro: IPR004758 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PRK10580 proY putative proline-specific permease; Provisional Back     alignment and domain information
>PRK10238 aromatic amino acid transporter; Provisional Back     alignment and domain information
>PRK11387 S-methylmethionine transporter; Provisional Back     alignment and domain information
>PRK10746 putative transport protein YifK; Provisional Back     alignment and domain information
>KOG1287 consensus Back     alignment and domain information
>KOG1289 consensus Back     alignment and domain information
>TIGR00911 2A0308 L-type amino acid transporter; InterPro: IPR004760 Amino acid permeases are integral membrane proteins involved in the transport of amino acids into the cell Back     alignment and domain information
>PRK10435 cadB lysine/cadaverine antiporter; Provisional Back     alignment and domain information
>PRK11357 frlA putative fructoselysine transporter; Provisional Back     alignment and domain information
>COG1113 AnsP Gamma-aminobutyrate permease and related permeases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10655 potE putrescine transporter; Provisional Back     alignment and domain information
>PRK11049 D-alanine/D-serine/glycine permease; Provisional Back     alignment and domain information
>pfam01490 Aa_trans Transmembrane amino acid transporter protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target628 putative potassium uptake transport system protein [Can
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis,plant 0.003
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure
 Score = 38.8 bits (89), Expect = 0.003
 Identities = 12/40 (30%), Positives = 17/40 (42%), Gaps = 15/40 (37%)

Query: 100 LKKIPKRSTVLIALGLAGS-ALFIGDSMVTPALSVLSAVE 138
           LKK            L  S  L+  DS   PAL++ + +E
Sbjct: 22  LKK------------LQASLKLYADDS--APALAIKATME 47


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target628 putative potassium uptake transport system protein [Can
3l1l_A445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg 99.72
3gia_A444 Uncharacterized protein MJ0609; membrane protein, trans 99.7
2jln_A501 MHP1; hydantoin, transporter, membrane protein, nucleob 94.09
>3l1l_A Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3lrb_A 3lrc_A 3hqk_A Back     alignment and structure
Probab=99.72  E-value=2.4e-13  Score=103.01  Aligned_cols=354  Identities=13%  Similarity=0.106  Sum_probs=187.7

Q ss_pred             CCCCCHHHHHCCCCHHHHHHHHCCCEECCCCCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             98762244320420599989732304573676678999997147777777789934620488898999999999999988
Q gi|254780832|r    1 MNTQTEDLQKNSPNPFYLMFESIGVVYGDIGTSVLYAFKEALKTTTMNHTLLVERTEVIGLVSLMIWVLTIVVTIKYILL   80 (628)
Q Consensus         1 m~~~~~~~~~~~~~~~~l~~~alGvV~GDIGTSPLY~~~~~~~~~~~~~~~~~~~~~v~G~lSli~Wtl~liv~vKYv~~   80 (628)
                      |+++.++++-+.   +.+..-.+|.+   ||+. ++.........++        .-+++.+-..+.  .+....-|..+
T Consensus         1 m~~~~~~~klg~---~~~~~l~~g~~---iGsG-if~~~~~~~~~g~--------~~~~~~li~~l~--~~~~~~~~~el   63 (445)
T 3l1l_A            1 MSSDADAHKVGL---IPVTLMVSGAI---MGSG-VFLLPANLASTGG--------IAIYGWLVTIIG--ALGLSMVYAKM   63 (445)
T ss_dssp             ------CCCBCH---HHHHHHHHHHH---CSSH-HHHHHHHHHHHCT--------HHHHHHHHHHHH--HHHHHHHHHHH
T ss_pred             CCCCCCCCCCCH---HHHHHHHHHHH---HHHH-HHHHHHHHHHHHH--------HHHHHHHHHHHH--HHHHHHHHHHH
T ss_conf             999877898189---99999999999---9999-9999999999999--------999999999999--99999999999


Q ss_pred             HHHCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCC-C-HHHHHHHH
Q ss_conf             741078998138999999987267554257789999999996500346999999987246642736676-1-28999999
Q gi|254780832|r   81 LLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDN-F-IILIALGI  158 (628)
Q Consensus        81 ~l~adn~GEGGi~aL~sl~~~~~~~~~~~~~~~gligaa~ll~D~iLTpAISVlSavegl~~~~P~l~~-~-~v~iai~i  158 (628)
                      ..+-  ..+||.   |+-.+|..++      ..|.+.+-....+++.+.+.+...+.+.+....|...+ + .....+++
T Consensus        64 ~~~~--p~~Gg~---y~~~~~~~g~------~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  132 (445)
T 3l1l_A           64 SFLD--PSPGGS---YAYARRCFGP------FLGYQTNVLYWLACWIGNIAMVVIGVGYLSYFFPILKDPWVLTITCVVV  132 (445)
T ss_dssp             HHHC--CCTTTH---HHHHHHHSCH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHTTTTCGGGGSHHHHHHHHHHH
T ss_pred             HHHC--CCCCCH---HHHHHHHHCH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHH
T ss_conf             9976--999829---9999999684------8999999999999999998876777520011376567833789999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCC-CCCCCCCCHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99999750001899999845999999999999999865018-74444679689999998374358999989999851087
Q gi|254780832|r  159 LVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHISDD-WGILAAFNPMYALHMVFGKGTISLVVLGSVFLTITGAE  237 (628)
Q Consensus       159 l~~Lf~iq~rGt~~~g~~F~pi~~lwf~~i~~~gi~~i~~~-p~vl~a~~P~~~~~~~~~~~~~g~~~lg~v~La~TG~E  237 (628)
                      +.+...+|.+|.+.+++.....+.+-+..+..+++.+.... +.......+....    .+....+..+...+.|.+|.|
T Consensus       133 ~~~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~~~~~~a~~G~e  208 (445)
T 3l1l_A          133 LWIFVLLNIVGPKMITRVQAVATVLALIPIVGIAVFGWFWFRGETYMAAWNVSGL----GTFGAIQSTLNVTLWSFIGVE  208 (445)
T ss_dssp             HHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHTTSTTCCCCCCCCC---------------HHHHHHHHHHTTTTTT
T ss_pred             HHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHEEEEEEECCCCCCCCCCCCCCC----CCCHHHHHHHHHHHHHHHHHH
T ss_conf             9999999861305566788999999988777520145552058866677787777----750159999999999998698


Q ss_pred             HHHCCCCCCCCHHHH--HHHHHHHHHHHHHHHHH--HHHHHCCHH-------HHHHHHHHHCCCCHHHHHHHHHHHHHHH
Q ss_conf             874364546711699--99999999999999747--868735924-------5520368727863289999999999999
Q gi|254780832|r  238 ALYADLGHFGRKPIQ--YAWMVIFPALAINYLGQ--GALVLSNPE-------AIKDPFYMMFGGWFLPFAVLTATCATVI  306 (628)
Q Consensus       238 Al~advghF~~~~i~--~aw~~v~~~L~l~y~Gq--~a~ll~~~~-------~~~~~f~~~~p~~~~~~~v~~at~a~iI  306 (628)
                      +..+-.+..+.|..+  .+...........|..-  ......+++       ...+.+....+++..+...+...++..-
T Consensus       209 ~~~~~~~e~k~p~~~~p~a~~~~~~~~~~~y~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  288 (445)
T 3l1l_A          209 SASVAAGVVKNPKRNVPIATIGGVLIAAVCYVLSTTAIMGMIPNAALRVSASPFGDAARMALGDTAGAIVSFCAAAGCLG  288 (445)
T ss_dssp             HHHHGGGGBSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCTTTSCSTTCTHHHHHHHHHCTTHHHHHHHHHHHHHTT
T ss_pred             HHHCCHHHHCCCHHCCCHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCHHHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             85031776317220231433322667889999999899715657775245680089998722430567778988876311


Q ss_pred             HCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCEECHHHHHHHHHHHHHHHHHC------CCHHHHHHHHHHHHHH
Q ss_conf             6030100258999999975998865687038876571100689999999988877732------6888988789999999
Q gi|254780832|r  307 ASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGF------RHSESLVAAYGISVSG  380 (628)
Q Consensus       307 aSqa~isg~Fsl~~qai~l~~~Pr~~i~~tS~~~~gqiYip~In~ll~ia~i~lvl~f------~~s~~L~~aYgi~V~~  380 (628)
                      ...+...+.-++..+..++|.+|+ .+.++++   +..-.+.+ ++..+.+.++.+.+      ...+.+.....++...
T Consensus       289 ~~~~~~~~~sr~~~~~a~dg~lP~-~~~~~~k---~~~P~~ai-i~~~v~~~~~~l~~~~~~~~~~~~~l~~~~~~~~l~  363 (445)
T 3l1l_A          289 SLGGWTLLAGQTAKAAADDGLFPP-IFARVNK---AGTPVAGL-IIVGILMTIFQLSSISPNATKEFGLVSSVSVIFTLV  363 (445)
T ss_dssp             THHHHHHHHHHHHHHHHHTTSSCG-GGGCCCT---TCCCHHHH-HHHHHHHHHHHHSTTSHHHHCCCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCH-HHHCCCC---CCCCHHHH-HHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHH
T ss_conf             055887885266799886497448-8716798---89916799-999999999999998512889999999999999999


Q ss_pred             HHHHHHHHHHH
Q ss_conf             99998999999
Q gi|254780832|r  381 TMVISTIMFSV  391 (628)
Q Consensus       381 tf~lTt~l~~~  391 (628)
                      .+++....+..
T Consensus       364 ~~~~~~~~~~~  374 (445)
T 3l1l_A          364 PYLYTCAALLL  374 (445)
T ss_dssp             HHHHHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             99999999999



>3gia_A Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
>2jln_A MHP1; hydantoin, transporter, membrane protein, nucleobase-cation-symport-1 family; 2.85A {Microbacterium liquefaciens} PDB: 2jlo_A* 2x79_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target628 putative potassium uptake transport system protein [Can
3gia_A_444 Uncharacterized protein MJ0609; membrane protein, 99.58
3l1l_A_445 Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC 99.49
>3gia_A (A:) Uncharacterized protein MJ0609; membrane protein, transporter, cell membrane, membrane, transmembrane, transport protein; HET: D10 BCN; 2.32A {Methanocaldococcus jannaschii} PDB: 3gi9_C* 3gi8_C Back     alignment and structure
Probab=99.58  E-value=5.7e-10  Score=82.11  Aligned_cols=362  Identities=11%  Similarity=0.031  Sum_probs=194.8

Q ss_pred             HHHHHHHHHHHCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHH
Q ss_conf             99999988741078998138999999987267554257789999999996500346999999987246642736676128
Q gi|254780832|r   73 VTIKYILLLLRADNDGEGGILSLLALLLKKIPKRSTVLIALGLAGSALFIGDSMVTPALSVLSAVEGVRYIAPELDNFII  152 (628)
Q Consensus        73 v~vKYv~~~l~adn~GEGGi~aL~sl~~~~~~~~~~~~~~~gligaa~ll~D~iLTpAISVlSavegl~~~~P~l~~~~v  152 (628)
                      +..-|..+.  .....+||...-   ..+..++.      .|-..+-....++.+..+.......+.+....|.......
T Consensus        55 ~~~~~ael~--~~~p~~gg~~~~---~~~~~g~~------~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  123 (444)
T 3gia_A           55 VAYSYTKLG--AKIVSNAGPIAF---IHKAIGDN------IITGALSILLWMSYVISIALFAKGFAGYFLPLINAPINTF  123 (444)
T ss_dssp             HHHHHHHHH--TTCCCTTTHHHH---HHHHHCSS------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCCHH
T ss_pred             HHHHHHHHH--HHCCCCCCHHHH---HHHHHCHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCC
T ss_conf             999999999--964899709999---99995818------9999999999998877899999999987500023456653


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH---HCCCCCCC--CCCHHHHHHHHHHCCHHHHHHHH
Q ss_conf             99999999999750001899999845999999999999999865---01874444--67968999999837435899998
Q gi|254780832|r  153 LIALGILVLLFMLQSHGTKGVACFFSPIMVAWLLMITVSGLIHI---SDDWGILA--AFNPMYALHMVFGKGTISLVVLG  227 (628)
Q Consensus       153 ~iai~il~~Lf~iq~rGt~~~g~~F~pi~~lwf~~i~~~gi~~i---~~~p~vl~--a~~P~~~~~~~~~~~~~g~~~lg  227 (628)
                      ...+..+........+........+.-...+....+...+....   ........  ...|.....        .+.++.
T Consensus       124 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~--------~~~~~~  195 (444)
T 3gia_A          124 NIAITEIGIVAFFTALNFFGSKAVGRAEFFIVLVKLLILGLFIFAGLITIHPSYVIPDLAPSAVSG--------MIFASA  195 (444)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCGGGTSCCCSHHHHHH--------HHHHHH
T ss_pred             CHHHHHHHHHHHHCEEEEHHHHHHHHHHHHHHHHHHHEEEEEEEEECCCCCCCCCCCCCCCCCCCC--------CHHHHH
T ss_conf             324667666530204420125788888899998866278899761000025765432223455554--------123555


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCHHHHHHH--HHHHHHHHHHHHHHHH-HHHC-CHHH-H---HHH----HHHHCCCCHHHH
Q ss_conf             9999851087874364546711699999--9999999999974786-8735-9245-5---203----687278632899
Q gi|254780832|r  228 SVFLTITGAEALYADLGHFGRKPIQYAW--MVIFPALAINYLGQGA-LVLS-NPEA-I---KDP----FYMMFGGWFLPF  295 (628)
Q Consensus       228 ~v~La~TG~EAl~advghF~~~~i~~aw--~~v~~~L~l~y~Gq~a-~ll~-~~~~-~---~~~----f~~~~p~~~~~~  295 (628)
                      ..+-+.+|.|+..+-.+..++|.-+...  ..........|..-.. .... .++. .   .++    +....+++....
T Consensus       196 ~~~~~~~G~~~~~~~a~E~k~p~k~ip~a~~~~~~~~~~~y~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  275 (444)
T 3gia_A          196 IFFLSYMGFGVITNASEHIENPKKNVPRAIFISILIVMFVYVGVAISAIGNLPIDELIKASENALAVAAKPFLGNLGFLL  275 (444)
T ss_dssp             HGGGGGTHHHHHHTTGGGBSSHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTSCHHHHHHTGGGHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCCHHHHHHCCCHHHHHHHHHHEEEEEEEEEHHHHHHHHHHHCCCCCHHHHCCCCCCCCCCCCCCCCCHHHHH
T ss_conf             43320233100000001110233321210001224530356688987603467233301222222111111223016888


Q ss_pred             HHHHHHHHHHHHCCCCCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCEECHHHHHHHHHHHHHHHHHCCCHHHHHHHHH
Q ss_conf             99999999999603010025899999997599886568703887657110068999999998887773268889887899
Q gi|254780832|r  296 AVLTATCATVIASQAVITGTFSLARQAIHLGFLPRMKIFFTSETFKGQVFLPSINLFLFVGVLLFVIGFRHSESLVAAYG  375 (628)
Q Consensus       296 ~v~~at~a~iIaSqa~isg~Fsl~~qai~l~~~Pr~~i~~tS~~~~gqiYip~In~ll~ia~i~lvl~f~~s~~L~~aYg  375 (628)
                      +.+...++.+-..++...+.-+++....++|.+|+. +.+++++.    .  -.+......+++..+.+.+-+.+++++.
T Consensus       276 ~~~~~~~~~~~~~~~~~~~~sR~l~a~ardg~lP~~-~~~~~~~~----~--~~~~~~~~~~~~~~~~~~~~~~l~~~~~  348 (444)
T 3gia_A          276 ISIGALFSISSAMNATIYGGANVAYSLAKDGELPEF-FERKVWFK----S--TEGLYITSALGVLFALLFNMEGVASITS  348 (444)
T ss_dssp             HHHHHHHHHHHHHHHHHTTTHHHHHHHHHHSSCCSS-CCTTSCCS----C--THHHHHHHHHHHHHHHHSCHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEHH-HCCCCCCC----C--CHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             776776630578999998866455435405915411-10147887----7--5146899999999999973999999999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999989999999998358569999999999999999999999985234869999999999999999899999999
Q gi|254780832|r  376 ISVSGTMVISTIMFSVFVHVCWKWKISKVIIFLFPLLSIEMTFLGANLFKVLDGGYTPLLIASLCIIVMWTWRRGTNLLS  455 (628)
Q Consensus       376 i~V~~tf~lTt~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~Kf~~GgW~~lli~~il~~iM~~W~~G~~~~~  455 (628)
                      ++......+......+..+++.+.++............+-+............--........+++.....|++.++...
T Consensus       349 ~~~~~~~~~~~~~~~~lr~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  428 (444)
T 3gia_A          349 AVFMVIYLFVILSHYILIDEVGGRKEIVIFSFIVVLGVFLLLLYYQWITNRFVFYGIIATFIGVLIFEIIYRKVTKRTFS  428 (444)
T ss_dssp             HHHHHHHHHHHHHHHHTHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHCCCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCC
T ss_conf             99999999999999999885277888603899999999999999998615999999999999999999987403463267


Q ss_pred             HHHHH
Q ss_conf             98642
Q gi|254780832|r  456 TLTRH  460 (628)
Q Consensus       456 ~~~~~  460 (628)
                      +..++
T Consensus       429 ~~~~~  433 (444)
T 3gia_A          429 NNMYV  433 (444)
T ss_dssp             GGGTT
T ss_pred             CCCEE
T ss_conf             88443



>3l1l_A (A:) Arginine/agmatine antiporter; TCDB 2.A.3.2.5, ADIC, Arg-bound, amino-acid transport, cell inner membrane, cell membrane, membrane; HET: ARG BNG; 3.00A {Escherichia coli} PDB: 3h5m_A* 3h6b_A 3hqk_A Back     alignment and structure