254780836

254780836

putative type I restriction-modification system DNA methylase

GeneID in NCBI database:8209847Locus tag:CLIBASIA_03655
Protein GI in NCBI database:254780836Protein Accession:YP_003065249.1
Gene range:+(805395, 807419)Protein Length:674aa
Gene description:putative type I restriction-modification system DNA methylase
COG prediction:[V] Type I restriction-modification system methyltransferase subunit
KEGG prediction:putative type I restriction-modification system DNA methylase; K03427 type I restriction enzyme M protein [EC:2.1.1.72]
SEED prediction:Type I restriction-modification system, DNA-methyltransferase subunit M (EC 2.1.1.72)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Restriction-Modification System;
Type I Restriction-Modification
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670----
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMATE
cccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHccccccccHHHHHHHHHHcccHHHHHHHHHHHccHHHHHHHHcccccHHcccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHccHHHHcccccccccEEEcccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHcccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccHHHcccccccccHHHHHHHHHHHHHHcccccccEEEEEEccccccccccccHHHHHHHHHHHcccEEEEEEcccccccccccEEEEEEEEccccccccccEEEEEHHHHcccHHccccccccccHHHHHHHHHHHHHcccccccccccHHHHHHccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccHHHHcccccccccHHHHHHHHHcccccHHHHHHHHHHHcccccEEEEccccccEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHccc
cccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHccccccEEcccccHHHHHccHHHHHHHHHHHHHHcHHHHHHHHHcccccHHHHHHcHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccHHHccccccccEEEEccccccHHHHHHHHHHHHHHcccccccccEEEEcccccHHHHHHHHHHHHHccccHHHHHcccccccccccccccccccccccEEEEccccccccccccHccccHHcccccccccccccccccccHHHHHHHHHHcccccccccEEEEEEcccccccccccccHHHHHHHHHHHcHHHHEEEcccHHcccccccEEEEEEEccccHHccccEEEEEcHHHHHHHHccccccccccHHHHHHHHHHHHHHccccccEEEcHHHHHHcccEEccccEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccccHHccccccccHHHHccccccccHHHHHHHHHHcccccccccEcccccccccccEEEEEEEEEcccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHcc
MTEFTGSAASLANFIWKNAEdlwgdfkhtdfgkvilpFTLLRRLECALEPTRSAVREKYLAfggsnidlESFVKVAgysfyntseyslstlgstntrNNLESYIASFSDNAKaifedfdfsSTIARLEKAGLLYKICKnfsgielhpdtvpdrvMSNIYEHLIRRfgsevsegaedfmtprDVVHLATALlldpddalfkespgmirtlydptcgtggfltdamnhvadcgshhkippilvphgqelepetHAVCVAGMLIRrlesdprrdlskniqqgstlskdlftgkrfhyclsnppfgkkweKDKDAVEKehkngelgrfgpglpkisdgsMLFLMHLANklelppngggraaivlsssplfngragsgeSEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRnegkkrriinddQRRQILDIYVsrengkfsrmldyrtfgyrrikvlrplrmsfildktglARLEADItwrklsplhqsfWLDILKPMMqqiypygwaesFVKESIKSNEAKTLKVKASKSFIVAFINAfgrkdpradpvtdvngewipdtnlteyenvpyleSIQDYFVrevsphvpdayidkiFIDEKDKEIGRVGYEINFNRffyqyqpsrklqDIDAELKGVEAQIATLLEEMATE
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAfggsnidleSFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFsgielhpdtvpDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIrrlesdprrdlskniqqgstlskdlftgkRFHYCLSNPPFGKKWEKDKDAVEKEhkngelgrfgpglPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWIlsnrkteerrgkvqlinatdlwtsirnegkkrriinddqrrqildiyvsrengkfsrmldyrtfgyrrikvlrplrmsfildKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINafgrkdpradpvtdvngewipdtnlteyENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMATE
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHlatallldpddalFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKrriinddqrrqildiYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMATE
*********SLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNG******SEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWT**********IINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDV***WIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMA**
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLF********SEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMATE
*****GSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMAT*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKxxxxxxxxxxxxxxxxxxxxxMATE
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMATE
MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNIDLESFVKVAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIKVLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKESIKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESIQDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKGVEAQIATLLEEMATE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target674 putative type I restriction-modification system DNA met
152969515675 DNA methylase M, host modification [Klebsiella pneumoni 1 0.0
152973655684 putative type I restriction-modification system DNA met 1 0.0
78357909675 type I restriction-modification system DNA methylase [D 1 0.0
152998551675 N-6 DNA methylase [Shewanella baltica OS185] Length = 6 1 0.0
310830281673 type I restriction-modification system DNA methylase, p 1 0.0
260427933673 N-6 DNA methylase [Citreicella sp. SE45] Length = 673 1 0.0
21243627685 type I restriction-modification system DNA methylase [X 1 0.0
110681176677 type I restriction-modification system DNA methylase, p 1 0.0
169634729671 putative type I restriction-modification system DNA met 1 0.0
229520169660 type I restriction-modification system DNA-methyltransf 1 0.0
>gi|152969515|ref|YP_001334624.1| DNA methylase M, host modification [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 675 Back     alignment and organism information
 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/675 (78%), Positives = 593/675 (87%), Gaps = 1/675 (0%)

Query: 1   MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYL 60
           M EFTGSAAS A+FIWKNAEDLWGDFKHTDFGK+ILPFTLLRRLECALEPTR AVRE + 
Sbjct: 1   MNEFTGSAASQADFIWKNAEDLWGDFKHTDFGKIILPFTLLRRLECALEPTREAVREAHD 60

Query: 61  AFGGSNIDLESFVK-VAGYSFYNTSEYSLSTLGSTNTRNNLESYIASFSDNAKAIFEDFD 119
           AF  ++++L++ ++  A Y FYNTSEYSL TLGST TR NLE YIA FSDNA+AIFE+F+
Sbjct: 61  AFKDADVELDTILRSTAEYPFYNTSEYSLGTLGSTKTRRNLEDYIALFSDNARAIFEEFE 120

Query: 120 FSSTIARLEKAGLLYKICKNFSGIELHPDTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMT 179
           F +T+ RLEKAGLLYKIC+NF+ I+LHPD VPDRVMSNIYEHLIRRFG+EV+EGAEDFMT
Sbjct: 121 FGNTVIRLEKAGLLYKICQNFAKIDLHPDVVPDRVMSNIYEHLIRRFGAEVNEGAEDFMT 180

Query: 180 PRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHHKIPPI 239
           PRD+VHLATALLLDPDDALF+ SPG+IRTLYDPTCGTGGFLTDAMNHV D G+  KIPP+
Sbjct: 181 PRDIVHLATALLLDPDDALFEASPGLIRTLYDPTCGTGGFLTDAMNHVGDYGNRDKIPPV 240

Query: 240 LVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNP 299
           LVPHGQELEPETHAVCVAGMLIRRLESDP RDLSKNI+QGSTLS D F G+RFHYCLSNP
Sbjct: 241 LVPHGQELEPETHAVCVAGMLIRRLESDPGRDLSKNIRQGSTLSNDQFAGERFHYCLSNP 300

Query: 300 PFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIV 359
           PFGKKWEKDK AVE EHK GELGRFGPGLPKISDGSMLFLMHLA+KLELP NGGGRAAIV
Sbjct: 301 PFGKKWEKDKTAVEAEHKKGELGRFGPGLPKISDGSMLFLMHLASKLELPINGGGRAAIV 360

Query: 360 LSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTEERR 419
           LS SPLFNG A SGESEIRRWLLE+DLIEAIVALPTDLFFRTNIATYLWILSN+K +ER+
Sbjct: 361 LSGSPLFNGGAASGESEIRRWLLEDDLIEAIVALPTDLFFRTNIATYLWILSNKKPQERK 420

Query: 420 GKVQLINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGYRRIK 479
           GKVQLINATDLWTSIRNEG KRRI++D+QRRQILDIY + E G  SRMLDYRTFGYRRI+
Sbjct: 421 GKVQLINATDLWTSIRNEGNKRRIVSDEQRRQILDIYAAGETGALSRMLDYRTFGYRRIR 480

Query: 480 VLRPLRMSFILDKTGLARLEADITWRKLSPLHQSFWLDILKPMMQQIYPYGWAESFVKES 539
           VLRPLRM+  LDK G+ RLEA+  W KLS  HQ+FW + LKP++ Q  PY WAE+FV  S
Sbjct: 481 VLRPLRMTLELDKVGMERLEAEAAWEKLSDAHQTFWREALKPLIGQTQPYSWAETFVSNS 540

Query: 540 IKSNEAKTLKVKASKSFIVAFINAFGRKDPRADPVTDVNGEWIPDTNLTEYENVPYLESI 599
           IKS+EAK LKVK++K+ I A INAFG KDP+A+PVTD NGE +PDT+LT+YENVPYLE I
Sbjct: 541 IKSDEAKQLKVKSNKTLITALINAFGHKDPKAEPVTDSNGELVPDTDLTDYENVPYLEDI 600

Query: 600 QDYFVREVSPHVPDAYIDKIFIDEKDKEIGRVGYEINFNRFFYQYQPSRKLQDIDAELKG 659
            DYF REV PHVPDA++D+ F D +D ++GRVGYEINFNRFFYQYQP RKL DID +LK 
Sbjct: 601 DDYFAREVLPHVPDAWLDESFTDARDGQLGRVGYEINFNRFFYQYQPPRKLHDIDEDLKQ 660

Query: 660 VEAQIATLLEEMATE 674
           VEA+IA LL E+A+E
Sbjct: 661 VEAEIAALLAEVASE 675


Species: Klebsiella pneumoniae
Genus: Klebsiella
Family: Enterobacteriaceae
Order: Enterobacteriales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|152973655|ref|YP_001338695.1| putative type I restriction-modification system DNA methylase [Klebsiella pneumoniae subsp. pneumoniae MGH 78578] Length = 684 Back     alignment and organism information
>gi|78357909|ref|YP_389358.1| type I restriction-modification system DNA methylase [Desulfovibrio desulfuricans subsp. desulfuricans str. G20] Length = 675 Back     alignment and organism information
>gi|152998551|ref|YP_001355472.1| N-6 DNA methylase [Shewanella baltica OS185] Length = 675 Back     alignment and organism information
>gi|310830281|ref|YP_003965381.1| type I restriction-modification system DNA methylase, putative [Ketogulonicigenium vulgare Y25] Length = 673 Back     alignment and organism information
>gi|260427933|ref|ZP_05781912.1| N-6 DNA methylase [Citreicella sp. SE45] Length = 673 Back     alignment and organism information
>gi|21243627|ref|NP_643209.1| type I restriction-modification system DNA methylase [Xanthomonas axonopodis pv. citri str. 306] Length = 685 Back     alignment and organism information
>gi|110681176|ref|YP_684183.1| type I restriction-modification system DNA methylase, putative [Roseobacter denitrificans OCh 114] Length = 677 Back     alignment and organism information
>gi|169634729|ref|YP_001708465.1| putative type I restriction-modification system DNA methylase (HsdM) [Acinetobacter baumannii SDF] Length = 671 Back     alignment and organism information
>gi|229520169|ref|ZP_04409596.1| type I restriction-modification system DNA-methyltransferase subunit M [Vibrio cholerae TM 11079-80] Length = 660 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target674 putative type I restriction-modification system DNA met
pfam02384312 pfam02384, N6_Mtase, N-6 DNA Methylase 1e-45
TIGR00497501 TIGR00497, hsdM, type I restriction system adenine meth 2e-22
pfam1216192 pfam12161, HsdM_N, HsdM N-terminal domain 1e-07
COG0286489 COG0286, HsdM, Type I restriction-modification system m 7e-51
>gnl|CDD|111293 pfam02384, N6_Mtase, N-6 DNA Methylase Back     alignment and domain information
>gnl|CDD|129588 TIGR00497, hsdM, type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>gnl|CDD|152596 pfam12161, HsdM_N, HsdM N-terminal domain Back     alignment and domain information
>gnl|CDD|30634 COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 674 putative type I restriction-modification system DNA met
COG0286489 HsdM Type I restriction-modification system methyltrans 100.0
TIGR00497516 hsdM type I restriction-modification system, M subunit; 100.0
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 100.0
TIGR02987603 met_A_Alw26 type II restriction m6 adenine DNA methyltr 99.77
COG1041347 Predicted DNA modification methylase [DNA replication, 99.37
COG4889 1518 Predicted helicase [General function prediction only] 99.27
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.79
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 98.41
PHA02056279 putative methyltransferase 98.03
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 97.33
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 97.17
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 97.06
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 97.04
COG0827381 Adenine-specific DNA methylase [DNA replication, recomb 96.86
COG1092393 Predicted SAM-dependent methyltransferases [General fun 96.67
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 96.64
PTZ00338296 dimethyladenosine transferase; Provisional 95.91
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 95.75
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 99.49
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 99.21
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.33
KOG3420185 consensus 97.98
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 97.68
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 97.63
KOG2904328 consensus 97.4
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 97.39
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 97.37
PRK06202233 hypothetical protein; Provisional 97.3
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 97.01
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 96.97
PRK11727326 putative SAM-dependent methyltransferase; Provisional 96.85
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 96.57
KOG2187534 consensus 96.56
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 96.44
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 96.21
COG2520341 Predicted methyltransferase [General function predictio 96.19
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 96.19
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 95.95
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 95.93
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 95.61
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 95.41
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 95.21
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 94.74
COG3129292 Predicted SAM-dependent methyltransferase [General func 94.66
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 94.5
PRK05785225 hypothetical protein; Provisional 93.56
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 93.46
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 93.33
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 92.49
PRK11036256 putative metallothionein SmtA; Provisional 91.69
pfam1216192 HsdM_N HsdM N-terminal domain. This domain is found at 99.42
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.04
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.86
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 98.73
PRK10901428 16S rRNA methyltransferase B; Provisional 96.76
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 96.52
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 96.26
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 95.69
KOG1540296 consensus 95.07
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 94.73
PRK11933471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 94.15
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 92.02
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 98.96
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 98.92
KOG2671421 consensus 98.65
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.39
pfam03848192 TehB Tellurite resistance protein TehB. 90.79
pfam05175170 MTS Methyltransferase small domain. This domain is foun 98.95
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.86
COG4123248 Predicted O-methyltransferase [General function predict 98.42
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 98.37
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 98.06
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 97.78
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 97.31
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 96.6
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 95.36
KOG1270282 consensus 94.89
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 94.84
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.67
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 97.09
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 90.27
pfam07669106 Eco57I Eco57I restriction endonuclease. Homologues of t 98.42
pfam11599249 AviRa RRNA methyltransferase AviRa. This family of prot 98.22
pfam01555221 N6_N4_Mtase DNA methylase. Members of this family are D 96.92
PRK07402196 precorrin-6B methylase; Provisional 95.03
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 94.96
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 97.58
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 97.45
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 96.36
PRK08317241 hypothetical protein; Provisional 97.37
PRK10258251 biotin biosynthesis protein BioC; Provisional 95.93
COG4106257 Tam Trans-aconitate methyltransferase [General function 93.49
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 93.37
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 97.14
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 96.77
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 95.33
PRK11524284 putative methyltransferase; Provisional 96.42
PRK13699227 putative methylase; Provisional 96.31
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 92.15
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 91.36
PRK09522531 bifunctional anthranilate synthase/anthranilate phospho 90.28
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>TIGR00497 hsdM type I restriction-modification system, M subunit; InterPro: IPR004546 There are four classes of restriction endonucleases: types I, II,III and IV Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329 Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4889 Predicted helicase [General function prediction only] Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PHA02056 putative methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>COG0827 Adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase; Provisional Back     alignment and domain information
>PRK00274 ksgA dimethyladenosine transferase; Reviewed Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>KOG3420 consensus Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam10672 Methyltrans_SAM S-adenosylmethionine-dependent methyltransferase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB; InterPro: IPR011825 This family consists of RNA methyltransferases designated RumB, formerly YbjF Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>pfam00398 RrnaAD Ribosomal RNA adenine dimethylase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>COG3129 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam12161 HsdM_N HsdM N-terminal domain Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>pfam08241 Methyltransf_11 Methyltransferase domain Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>pfam08242 Methyltransf_12 Methyltransferase domain Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>pfam07669 Eco57I Eco57I restriction endonuclease Back     alignment and domain information
>pfam11599 AviRa RRNA methyltransferase AviRa Back     alignment and domain information
>pfam01555 N6_N4_Mtase DNA methylase Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR01177 TIGR01177 conserved hypothetical protein TIGR01177; InterPro: IPR005885 This family of largely hypothetical proteins is found exclusively in the Archaea and contain a putative RNA methylase domain Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; InterPro: IPR001566 This protein family was first proposed to be RNA methyltransferases by homology to the TrmA family Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target674 putative type I restriction-modification system DNA met
3khk_A544 Crystal Structure Of Type-I Restriction-Modificatio 6e-75
2y7c_B529 Atomic Model Of The Ocr-Bound Methylase Complex Fro 6e-54
2ar0_A541 Crystal Structure Of Type I Restriction Enzyme Ecok 1e-50
2okc_A445 Crystal Structure Of Type I Restriction Enzyme Stys 7e-42
3lkd_A542 Crystal Structure Of The Type I Restriction-Modific 2e-70
>gi|284055706|pdb|3KHK|A Chain A, Crystal Structure Of Type-I Restriction-Modification System Methylation Subunit (Mm_0429) From Methanosarchina Mazei. Length = 544 Back     alignment and structure
 Score =  287 bits (734), Expect = 6e-75,   Method: Composition-based stats.
 Identities = 94/518 (18%), Positives = 176/518 (33%), Gaps = 95/518 (18%)

Query: 8   AASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNI 67
              L N +W+ A+ L  +    ++  V+L    L+ +  A E  +  + E +      NI
Sbjct: 10  LNDLDNQLWRAADKLRSNLDAANYKHVVLGLIFLKYVSDAFEERQQELTELFQKDDDDNI 69

Query: 68  ---------DLESFVKV------------AGYSFYNTSEYSLSTLGS------------- 93
                      E++ +                 F+       + L               
Sbjct: 70  YYLPREDYDSDEAYQQAIAEELEIGDYYTEKNVFWVPKTARWNKLRDVITLPTGSVIWQD 129

Query: 94  ---TNTR--------NNLESYIASFSDNAKAIFEDFDFSSTIARLEKAGLLYKICKNFSG 142
               + +        +N    I   +   K I               A  L  +   FS 
Sbjct: 130 EQGEDVKLRSVSWLIDNAFDDIEKANPKLKGILNRISQYQL-----DADKLIGLINEFSL 184

Query: 143 IELHP--------DTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDP 194
              +         +     ++ ++YE+ + +F     +    + TP+ +V L   +L   
Sbjct: 185 TSFNNPEYNGEKLNLKSKDILGHVYEYFLGQFALAEGKQGGQYYTPKSIVTLIVEML--- 241

Query: 195 DDALFKESPGMIRTLYDPTCGTGGFLTDAMNHVA-----DCGSHHKIPPILVPHGQELEP 249
                         +YDP  G+GGF   +   +         +  +    +  +GQE  P
Sbjct: 242 --------EPYKGRVYDPAMGSGGFFVSSDKFIEKHANVKHYNASEQKKQISVYGQESNP 293

Query: 250 ETHAVCVAGMLIRRLESDPRRDLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGK-KWEKD 308
            T  +    M+IR ++ +  +      +   +   D     R  + ++NPPF    W  +
Sbjct: 294 TTWKLAAMNMVIRGIDFNFGK------KNADSFLDDQHPDLRADFVMTNPPFNMKDWWHE 347

Query: 309 KDAVEKEHKNGELGRFGPGLPKISDGSMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNG 368
           K A +        G      P   + +  +++H+   L      G  A ++ + S   N 
Sbjct: 348 KLADDPRWTINTNGEKRILTPPTGNANFAWMLHMLYHLAPT---GSMALLLANGSMSSNT 404

Query: 369 RAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTE-----ERRGKVQ 423
                E EIR+ L+E DL+E +VALP  LF  T I   +W L+  K       +RRG+V 
Sbjct: 405 NN---EGEIRKTLVEQDLVECMVALPGQLFTNTQIPACIWFLTKDKNAKNGKRDRRGQVL 461

Query: 424 LINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSREN 461
            I+A  L           R   D+  +++ D + + + 
Sbjct: 462 FIDARKLGYMKDRV---LRDFKDEDIQKLADTFHNWQQ 496


gi|322812245|pdb|2Y7C|B Chain B, Atomic Model Of The Ocr-Bound Methylase Complex From The Type I Restriction-Modification Enzyme Ecoki (M2s1). Based On Fitting Into Em Map 1534. Length = 529 Back     alignment and structure
>gi|75766307|pdb|2AR0|A Chain A, Crystal Structure Of Type I Restriction Enzyme Ecoki M Protein (Ec 2.1.1.72) (M.Ecoki) Length = 541 Back     alignment and structure
>gi|126031631|pdb|2OKC|A Chain A, Crystal Structure Of Type I Restriction Enzyme Stysji M Protein (Np_813429.1) From Bacteroides Thetaiotaomicron Vpi-5482 At 2.20 A Resolution Length = 445 Back     alignment and structure
>gi|288563204|pdb|3LKD|A Chain A, Crystal Structure Of The Type I Restriction-Modification System Methyltransferase Subunit From Streptococcus Thermophilus, Northeast Structural Genomics Consortium Target Sur80 Length = 542 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target674 putative type I restriction-modification system DNA met
3lkd_A542 Type I restriction-modification system methyltransferas 4e-61
3khk_A544 Type I restriction-modification system methylation subu 6e-57
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein; str 7e-34
2okc_A445 Type I restriction enzyme stysji M protein; NP_813429.1 4e-30
2f8l_A344 Hypothetical protein LMO1582; 16411011, structural geno 2e-26
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransferase 1e-18
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Length = 542 Back     alignment and structure
 Score =  231 bits (589), Expect = 4e-61
 Identities = 113/497 (22%), Positives = 196/497 (39%), Gaps = 65/497 (13%)

Query: 1   MTEFTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREK-- 58
           M+E T ++ SL   +W +A+ L       D+   +L     + L   +    +   E+  
Sbjct: 1   MSETTQTSQSLYQALWNSADVLRSKMDANDYKSYLLGMVFYKYLSDKMLFFVAETMEEET 60

Query: 59  ---------YLAFGGSNIDLESFVKVA--GYSFYNTSEYSLSTLGS--TNTRNNLESYIA 105
                    Y  +       E  + V     S+    + + + L     +    LE    
Sbjct: 61  ESLDEALAVYRKYYEDEETHEDLLAVITDEMSYAIHPDLTFTALVERVNDGSFQLEDLAQ 120

Query: 106 SFSDNAKA------IFEDFDFSST---IARLEKAGLLYKICKNFSGIELHPDTVPDRVMS 156
            F D  ++      +FED D  S        ++   +  + K  + +++        ++ 
Sbjct: 121 GFRDIEQSDELYENLFEDIDLYSKKLGATPQKQNQTVAAVMKELAVLDVAGH--AGDMLG 178

Query: 157 NIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPDDALFKESPGMIRTLYDPTCGT 216
           + YE+LI +F ++  + A +F TP+ V  L T +     +           TLYD T G+
Sbjct: 179 DAYEYLIGQFATDSGKKAGEFYTPQPVAKLMTQIAFLGRE------DKQGFTLYDATMGS 232

Query: 217 GGFLTDAMNHVADCGSHHKIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRRDLSKNI 276
           G  L +A  +     +       +V  GQEL   T+ +    M++  +  + +      +
Sbjct: 233 GSLLLNAKRYSRQPQT-------VVYFGQELNTSTYNLARMNMILHGVPIENQF-----L 280

Query: 277 QQGSTLSKDLFT--GKRFHYCLSNPPFGKKWEKDKDAVEKEHKNGELGRFGPGLPKISDG 334
               TL +D  T     F   L NPP+  KW      ++              L   S  
Sbjct: 281 HNADTLDEDWPTQEPTNFDGVLMNPPYSAKWSASSGFMDDPRF-----SPFGKLAPKSKA 335

Query: 335 SMLFLMHLANKLELPPNGGGRAAIVLSSSPLFNGRAGSGESEIRRWLLENDLIEAIVALP 394
              FL+H    L+      G  AIVL    LF G A   E  IR+ LLE   I+ ++ LP
Sbjct: 336 DFAFLLHGYYHLKQDN---GVMAIVLPHGVLFRGNA---EGTIRKALLEEGAIDTVIGLP 389

Query: 395 TDLFFRTNIATYLWILSNRKTEERRGKVQLINATDLWTSIRNEGKKRRIINDDQRRQILD 454
            ++FF T+I T + IL   +T      V  I+A+  +    ++GK + I+ D    +IL+
Sbjct: 390 ANIFFNTSIPTTVIILKKNRTNR---DVYFIDASKEF----DKGKNQNIMTDAHIEKILN 442

Query: 455 IYVSRENG-KFSRMLDY 470
            Y SRE+  KF+ +  +
Sbjct: 443 AYKSREDIDKFAHLASF 459


>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Length = 544 Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 Length = 541 Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, structural genomics; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Length = 445 Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; 16411011, structural genomics, PSI, protein structure initiative, joint center for structural genomics; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Length = 344 Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5- methylpyrimidin-2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Length = 421 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target674 putative type I restriction-modification system DNA met
3khk_A544 Type I restriction-modification system methylation subu 100.0
3lkd_A542 Type I restriction-modification system methyltransferas 100.0
2okc_A445 Type I restriction enzyme stysji M protein; NP_813429.1 100.0
2ar0_A541 M.ecoki, type I restriction enzyme ecoki M protein; str 100.0
2f8l_A344 Hypothetical protein LMO1582; 16411011, structural geno 100.0
2ih2_A421 Modification methylase TAQI; DNA, DNA methyltransferase 100.0
1ne2_A200 Hypothetical protein TA1320; structural genomics, conse 99.17
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, structura 98.25
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxylating); 98.22
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwi 98.21
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, meth 97.53
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modifi 97.14
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA bind 96.85
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, rossmann 96.76
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopurine me 96.67
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ERMC', 96.63
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeMet, b 96.59
3fpf_A298 Mtnas, putative uncharacterized protein; thermonicotian 96.45
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like fold 96.01
3fut_A271 Dimethyladenosine transferase; methyltransferase, dimet 95.9
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O- methyltransferase; C/D 95.81
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research cente 99.57
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta sheet, 99.38
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dimethyl 98.7
2qm3_A373 Predicted methyltransferase; putative methyltransferase 98.62
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase, str 98.54
1ws6_A171 Methyltransferase; structural genomics, riken structura 98.51
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine modifi 98.5
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase; met 98.49
2esr_A177 Methyltransferase; structural genomics, hypothetical pr 98.46
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, tRNA m 98.39
2frn_A278 Hypothetical protein PH0793; structural genomics, PSI, 98.39
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent meth 98.34
2fpo_A202 Methylase YHHF; structural genomics, putative methyltra 98.25
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus thermoph 98.21
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, structu 98.2
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwich, b 98.17
2b78_A385 Hypothetical protein SMU.776; structure genomics, methy 98.15
2yxd_A183 Probable cobalt-precorrin-6Y C(15)- methyltransferase [ 97.48
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoaspartyl 97.41
1nkv_A256 Hypothetical protein YJHP; structural genomics, PSI, pr 97.34
3ocj_A305 Putative exported protein; structural genomics, PSI-2, 97.31
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; methyt 97.28
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltransfer 97.07
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferase; tRN 96.86
1zq9_A285 Probable dimethyladenosine transferase; SGC, structural 96.76
2h1r_A299 Dimethyladenosine transferase, putative; SGC toronto di 96.62
1nw3_A416 Histone methyltransferase DOT1L; HDOT1, histone lysine 96.37
3gru_A295 Dimethyladenosine transferase; rossman fold, ribosomal 96.14
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; metal 96.07
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; ross 95.97
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NMR {St 95.82
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- methy 95.42
1p91_A269 Ribosomal RNA large subunit methyltransferase A; RLMA, 95.22
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-adenosyl 94.36
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O- methyltransferas 94.3
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossman-typ 92.58
3ldu_A385 Putative methylase; structural genomics, PSI-2, protein 99.25
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methylase, 99.14
2h00_A254 Methyltransferase 10 domain containing protein; structu 98.45
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, structural 97.45
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative spli 97.2
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; antibiot 97.15
3ll7_A410 Putative methyltransferase; methytransferase, structura 97.06
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycloprop 96.9
2pxx_A215 Uncharacterized protein MGC2408; structural genomics co 96.87
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; protei 96.36
3frh_A253 16S rRNA methylase; methyltransferase domain, helical N 96.24
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta protein, s 95.93
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridium the 95.07
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena vari 94.72
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha/beta 94.21
2p7i_A250 Hypothetical protein; putative methyltransferase, struc 93.81
1or8_A340 Protein arginine N-methyltransferase 1; protein arginin 93.49
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding domain, 93.11
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmethionin 93.0
2fyt_A340 Protein arginine N-methyltransferase 3; structural geno 92.55
1x19_A359 CRTF-related protein; methyltransferase, bacteriochlloc 92.13
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structural ge 91.66
3b3f_A341 Histone-arginine methyltransferase CARM1; protein argin 90.47
2b3t_A276 Protein methyltransferase HEMK; translation termination 99.15
1dus_A194 MJ0882; hypothetical protein, methanococcus jannaschii, 98.91
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; gene d 98.84
3dmg_A381 Probable ribosomal RNA small subunit methyltransferase; 98.74
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxylase; 98.24
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransferase, 98.08
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase; tra 98.01
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltransfe 98.0
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structural g 98.0
1yb2_A275 Hypothetical protein TA0852; structural genomics, methy 97.88
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, 97.8
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, crystal, s 97.66
2b25_A336 Hypothetical protein; structural genomics, methyl trans 97.42
3gu3_A284 Methyltransferase; alpha-beta protein, structural genom 97.36
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent meth 97.0
3f4k_A257 Putative methyltransferase; structural genomics, PSI-2, 96.92
3m33_A226 Uncharacterized protein; structural genomics, PSI-2, pr 96.91
3m6w_A464 RRNA methylase; rRNA methyltransferase, 5-methylcytidin 96.85
3ege_A261 Putative methyltransferase from antibiotic biosynthesis 96.7
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed beta she 96.61
2frx_A479 Hypothetical protein YEBU; rossmann-type S-adenosylmeth 96.58
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococcus h 96.51
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protein; FM 96.43
2aot_A292 HMT, histamine N-methyltransferase; classic methyltrans 96.43
3m4x_A456 NOL1/NOP2/SUN family protein; mtase domain, PUA domain, 95.72
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protein, st 94.66
2ozv_A260 Hypothetical protein ATU0636; structural genomics, pred 99.08
3lpm_A259 Putative methyltransferase; structural genomics, protei 98.79
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adenosyl-m 98.22
1xxl_A239 YCGJ protein; structural genomics, protein structure in 97.88
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messenger 97.69
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methyltransf 97.58
3hnr_A220 Probable methyltransferase BT9727_4108; structural geno 97.51
1ve3_A227 Hypothetical protein PH0226; dimer, riken structural ge 97.4
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransferase, S 97.37
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; HET: S 97.25
2o57_A297 Putative sarcosine dimethylglycine methyltransferase; s 97.16
3e8s_A227 Putative SAM dependent methyltransferase; NP_744700.1, 97.1
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; NP_34 96.94
1wzn_A252 SAM-dependent methyltransferase; structural genomics, r 96.92
3m70_A286 Tellurite resistance protein TEHB homolog; structural g 96.88
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein structure i 96.82
1xva_A292 Glycine N-methyltransferase; HET: SAM; 2.20A {Escherich 96.75
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; struc 96.75
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethionine-d 96.71
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgrc, pr 96.68
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carbohydrat 96.6
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe relat 96.53
2i6g_A199 Putative methyltransferase; 16420133, structural genomi 96.46
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, structura 96.34
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_32134 96.31
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, methyltra 96.23
2gs9_A211 Hypothetical protein TT1324; methyl transferase, struct 96.18
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protein, st 96.18
3i9f_A170 Putative type 11 methyltransferase; structural genomics 96.15
3g5l_A253 Putative S-adenosylmethionine dependent methyltransfera 96.12
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alph 95.94
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent methylt 95.84
1zx0_A236 Guanidinoacetate N-methyltransferase; structural genomi 95.23
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, SAH, S 95.02
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, structu 94.76
3cc8_A230 Putative methyltransferase; NP_977653.1, structural gen 94.75
3ou2_A218 SAM-dependent methyltransferase; O-methyltransferase, S 94.63
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-me 94.6
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleotidyltr 94.42
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann fold m 94.11
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glycopepti 93.79
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural genomics 92.53
1nv8_A284 HEMK protein; class I adoMet-dependent methyltransferas 98.73
3g5t_A299 Trans-aconitate 3-methyltransferase; structural genomic 98.01
1vl5_A260 Unknown conserved protein BH2331; 10174951, hypothetica 97.6
1im8_A244 YECO; methyltransferase, adenosylhomocysteine, structur 97.33
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-adenosy 96.91
3dtn_A234 Putative methyltransferase MM_2633; structural genomics 96.91
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structural ge 98.19
3dh0_A219 SAM dependent methyltransferase; cystal structure, PSI- 97.53
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, transfe 97.26
2i62_A265 Nicotinamide N-methyltransferase; structural genomics, 95.9
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, struct 95.65
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, protein 95.54
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal RNA pr 95.36
2kw5_A202 SLR1183 protein; structural genomics, northeast structu 94.78
2r3s_A335 Uncharacterized protein; methyltransferase domain, stru 94.51
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus 92.79
3dp7_A363 SAM-dependent methyltransferase; structural genomics, p 92.53
3kr9_A225 SAM-dependent methyltransferase; class I rossmann-like 98.03
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; structu 97.46
3lcc_A235 Putative methyl chloride transferase; halide methyltran 97.2
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se-MAD; 97.97
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 specif 95.74
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, structur 94.45
1vlm_A219 SAM-dependent methyltransferase; possible histamine N-m 96.91
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyclic a 96.78
1boo_A323 Protein (N-4 cytosine-specific methyltransferase PVU II 96.5
2zig_A297 TTHA0409, putative modification methylase; methyltransf 96.45
1g60_A260 Adenine-specific methyltransferase MBOIIA; structural g 96.73
3g07_A292 7SK snRNA methylphosphate capping enzyme; structural ge 90.68
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
Probab=100.00  E-value=0  Score=703.25  Aligned_cols=461  Identities=20%  Similarity=0.343  Sum_probs=342.3

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCHHHCCCEEEHHHHHHHHHHHCCHHHHHHHHHHHHCCCCCCC---------HHHH--
Q ss_conf             10178889999999998740688834308723054899989674123399999999720246889---------6787--
Q gi|254780836|r    4 FTGSAASLANFIWKNAEDLWGDFKHTDFGKVILPFTLLRRLECALEPTRSAVREKYLAFGGSNID---------LESF--   72 (674)
Q Consensus         4 ~~~t~s~L~s~iW~~Ad~LRg~~~~~eY~~~ILp~~~Lrrld~~le~~k~~v~~~~~~~~~~~~~---------~~~~--   72 (674)
                      .+..+++|+++||++||.|||.|++++|++|||||+|||||||+|+++++++.+.+.........         .+.+  
T Consensus         6 ~~~~~~~L~~~lW~~ad~LRg~~d~~~Yk~yIL~llFlK~lsd~~e~~~~~l~~~~~~~~~~~~~~~~~~~~~~~e~~~~   85 (544)
T 3khk_A            6 EQQFLNDLDNQLWRAADKLRSNLDAANYKHVVLGLIFLKYVSDAFEERQQELTELFQKDDDDNIYYLPREDYDSDEAYQQ   85 (544)
T ss_dssp             -CCSHHHHHHHHHHHHHTTCTTCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTTCCCTTCSSCCCGGGCSSHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCHHHCCCEEHHHHHHHHCCHHHHHHHHHHHHHHHCCCCHHHHHHHHHHCCHHHHHHH
T ss_conf             69999999999999999984877778808702157879873185799999999886215522343321220000578888


Q ss_pred             ----------HHHCCCCCCCCCCCCHHHHHHH-HH--HHHHHHHHHHHCH-------HHHHHHHHCC-----HHHHHH--
Q ss_conf             ----------6533896103680368861345-58--9999999975299-------9899987177-----235775--
Q gi|254780836|r   73 ----------VKVAGYSFYNTSEYSLSTLGST-NT--RNNLESYIASFSD-------NAKAIFEDFD-----FSSTIA--  125 (674)
Q Consensus        73 ----------~~~~g~~F~n~s~~~~~~l~~~-~~--~~nl~~yi~gfS~-------nv~dI~~~f~-----f~~~i~--  125 (674)
                                .......|++++.++|..+... +.  .........+.+.       .+..+|+.++     +...+.  
T Consensus        86 ~~~~~~~~~~~~~~~~~f~ip~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ie~~~~~L~~v~~~~  165 (544)
T 3khk_A           86 AIAEELEIGDYYTEKNVFWVPKTARWNKLRDVITLPTGSVIWQDEQGEDVKLRSVSWLIDNAFDDIEKANPKLKGILNRI  165 (544)
T ss_dssp             HHHHHHTCTHHHHTTTCCCCCTTTCHHHHHHCCSSCC----------------CHHHHHHHHHHHHHHHCGGGSSCSCCS
T ss_pred             HHHHHHHHHHHHCCCCCEECCCCCCHHHHHHHHHCCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHCHHHHHHHHHH
T ss_conf             88765400023314664336741356888632303320234432201110144689999999999987686765033211


Q ss_pred             --HHHHCCHHHHHHHHHCCCCCCC--------CCCCCHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHCCCC
Q ss_conf             --4442362899998740245673--------337611443899999999986227665753681799999999731784
Q gi|254780836|r  126 --RLEKAGLLYKICKNFSGIELHP--------DTVPDRVMSNIYEHLIRRFGSEVSEGAEDFMTPRDVVHLATALLLDPD  195 (674)
Q Consensus       126 --~L~~~~~L~~vI~~F~~idL~p--------~~v~n~~mG~iyE~LIrkFae~~~~~aGeffTPR~Vi~Lmv~ll~~~~  195 (674)
                        ..-..+.|..+|..|+.+++..        ...+++.||++||+||++|++.+|+.+|||||||+|++|||+++    
T Consensus       166 ~~~~~~~~~l~~~i~~~~~~~~~~~~~~~~~~~~~~~D~lG~~yE~ll~~~~~~~~k~~G~ffTP~~Iv~lmv~ll----  241 (544)
T 3khk_A          166 SQYQLDADKLIGLINEFSLTSFNNPEYNGEKLNLKSKDILGHVYEYFLGQFALAEGKQGGQYYTPKSIVTLIVEML----  241 (544)
T ss_dssp             SSSCCCHHHHHHHHHHHC------------------CCSHHHHHHHHHHHHHHTTTCCSTTTCCCHHHHHHHHHHH----
T ss_pred             HHCCCCHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCEECCCHHHHHHHHHCC----
T ss_conf             0102767889999875530334541001100145452062899999999998860764765548189999998623----


Q ss_pred             CHHCCCCCCCCEEECCCCCCHHHHHHHHHHHHHHHHHHC-----CCCCCEEEECCCCCHHHHHHHHHHHHHHCCCCCCCC
Q ss_conf             011013877640311766540468999999999853100-----533322550466667889999999898088753345
Q gi|254780836|r  196 DALFKESPGMIRTLYDPTCGTGGFLTDAMNHVADCGSHH-----KIPPILVPHGQELEPETHAVCVAGMLIRRLESDPRR  270 (674)
Q Consensus       196 ~~~~~~~p~~~~tIyDPaCGTGGmL~~a~~~i~~~~~~~-----~~~~~~~lyGQEin~~tyaIak~nMli~g~~~d~~~  270 (674)
                            .|.. .+||||||||||||++|.+|+.+.....     ......++||||+|+.+|+||+|||+|||.+.+   
T Consensus       242 ------~p~~-~~I~DPacGsGgfLi~a~~~i~~~~~~~~~~~~~~~~~~~l~G~Ei~~~~~~la~~nm~l~g~~~~---  311 (544)
T 3khk_A          242 ------EPYK-GRVYDPAMGSGGFFVSSDKFIEKHANVKHYNASEQKKQISVYGQESNPTTWKLAAMNMVIRGIDFN---  311 (544)
T ss_dssp             ------CCCS-EEEEESSCTTCHHHHHHHHHHHHHHHHHTSCHHHHGGGEEEEECCCCHHHHHHHHHHHHHTTCCCB---
T ss_pred             ------CCCC-CCEECCCCCCCHHHHHHHHHHHHHCCCCCCCCHHHHHHCEEECCCCCHHHHHHHHHHHHHCCCCCC---
T ss_conf             ------8998-837037777617899999999982452222202222011061503877999999988986188866---


Q ss_pred             CCCCCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCHHHHHHH-HHCCCCCCCCCCCCCCCHHHHHHHHHHHHHHCCC
Q ss_conf             666682347545799986641899981685676531000111234-4226666535777747706599999999961466
Q gi|254780836|r  271 DLSKNIQQGSTLSKDLFTGKRFHYCLSNPPFGKKWEKDKDAVEKE-HKNGELGRFGPGLPKISDGSMLFLMHLANKLELP  349 (674)
Q Consensus       271 ~~~~NI~~GdTL~~d~~~~~kFD~vlaNPPFg~~Wk~~~~~v~~e-~~~~~~~Rf~~glP~~sdg~~lFlqh~i~klk~~  349 (674)
                         .+|..+|+|.+|.+...+||+|++|||||++|.......... ...+..+|+..++|++++++++||||++++|++ 
T Consensus       312 ---~~~~~~d~l~~~~~~~~~fD~Il~NPPfg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Fi~~~l~~Lk~-  387 (544)
T 3khk_A          312 ---FGKKNADSFLDDQHPDLRADFVMTNPPFNMKDWWHEKLADDPRWTINTNGEKRILTPPTGNANFAWMLHMLYHLAP-  387 (544)
T ss_dssp             ---CCSSSCCTTTSCSCTTCCEEEEEECCCSSCCSCCCGGGTTCGGGEECCC--CEECCCCTTCTHHHHHHHHHHTEEE-
T ss_pred             ---CCCCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHHHCCC-
T ss_conf             ---4535675434655655446757506987766555300013545540345643457899874789999999971777-


Q ss_pred             CCCCCEEEEECCCCCCC-CCCCCCCHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCEEEEEEECCCCC-----CCCCCEE
Q ss_conf             57880799973897134-77644326899999988494688831767765578861699999468874-----3488389
Q gi|254780836|r  350 PNGGGRAAIVLSSSPLF-NGRAGSGESEIRRWLLENDLIEAIVALPTDLFFRTNIATYLWILSNRKTE-----ERRGKVQ  423 (674)
Q Consensus       350 ~~~ggr~aIV~ngs~LF-~G~agsGEs~IRk~lie~d~ieaII~LP~~lFynTgI~t~Iwil~k~K~~-----~rkgkV~  423 (674)
                         |||+|+|+|.|+|+ +|++   |..||+||+++++|+|||+||.++|++|||+||||||+|+|+.     +|+|+|+
T Consensus       388 ---~G~~aiIvp~~~l~~~~~~---e~~iR~~Ll~~~~i~aII~LP~~~F~~t~i~t~Ilvl~K~k~~~~~~~~~~~~V~  461 (544)
T 3khk_A          388 ---TGSMALLLANGSMSSNTNN---EGEIRKTLVEQDLVECMVALPGQLFTNTQIPACIWFLTKDKNAKNGKRDRRGQVL  461 (544)
T ss_dssp             ---EEEEEEEEETHHHHCCGGG---HHHHHHHHHHTTCEEEEEECCTTBCCSCSSCEEEEEEESCCSSBTTBCCCTTEEE
T ss_pred             ---CCEEEEEECCCCCCCCCCH---HHHHHHHHHHCCCEEEEEECCHHCCCCCCCCEEEEEEECCCCCCCCCCCCCCCEE
T ss_conf             ---7806999768854367871---7899999996695899972882006899997599999889887665445678389


Q ss_pred             EEECHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHCCCCCCEEEEECCCCCE-EEEEEECCCCCCCCCCHHH
Q ss_conf             9723677657640466442069899999999997210254104744466305-7899720442121008889
Q gi|254780836|r  424 LINATDLWTSIRNEGKKRRIINDDQRRQILDIYVSRENGKFSRMLDYRTFGY-RRIKVLRPLRMSFILDKTG  494 (674)
Q Consensus       424 lIDAs~~~~~~rk~G~Kr~~l~~~~i~~Iv~~y~~f~e~e~ski~~~~~Fgy-~~vtverplr~~~~~~~~~  494 (674)
                      |||||+.+.+   .|+++|.|+++||++|+++|++|++....+ -+..  || +.|+++.-....|.+++.|
T Consensus       462 fidas~~~~~---~~~~~~~l~~~~i~~I~~~~~~~~~~~~~~-~~~~--~~s~~v~~~eI~~ndy~L~~~r  527 (544)
T 3khk_A          462 FIDARKLGYM---KDRVLRDFKDEDIQKLADTFHNWQQEWSEE-NNQA--GFCFSADLALIRKNDFVLTPGR  527 (544)
T ss_dssp             EEECTTCSEE---SSSSCEECCHHHHHHHHHHHHHHHHCCCTT-TCBT--TTEEEEEHHHHHHTTTCCCTTT
T ss_pred             EEECCCCCEE---CCCCCCCCCHHHHHHHHHHHHHHHHCCCCC-CCCC--CEEEEEEHHHHHHCCCEECHHH
T ss_conf             9986545410---576678699999999999999987512322-6757--7489966999997695118675