255764505

255764505

polysialic acid capsule expression protein

GeneID in NCBI database:8209846Locus tag:CLIBASIA_03650
Protein GI in NCBI database:255764505Protein Accession:YP_003065248.2
Gene range:+(803890, 804915)Protein Length:341aa
Gene description:polysialic acid capsule expression protein
COG prediction:[M] Predicted sugar phosphate isomerase involved in capsule formation
KEGG prediction:polysialic acid capsule expression protein; K06041 arabinose-5-phosphate isomerase [EC:5.3.1.13]
SEED prediction:Arabinose 5-phosphate isomerase (EC 5.3.1.13)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:KDO2-Lipid A biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-
MHFYFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
cccHHHHHHHHcccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHHccccEEEEEccHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHccccEEEEEcccccHHHHHccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHcccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEcccccEEEEEEHHHHHHHHHcccccccHHHHcccccEEEcccccHHHHHHHHHHccccEEEEEccccEEEEEEEHHHHHHHHcc
cccccccccccccEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHccccccccEccccHHccccccccccccEEEEEEccccHHHHHHHHHHHHHccccEEEEccccccHHHHHccEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccccHHHHHcccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHcccccEEEEccccEEEEEEEcccHHHHHccccccccHHHHcccccccccHHHHHHHHHHHHHHccccEEEEEcccccEEEEEcHHHHHHcccc
mhfyfshfksvtrkghslmknSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITgigksghiGSKLASTlastgtpsfFVHAAeashgdlgmitrDDLIIVLSWSGSSDELKAILYYARRFSIpliaitsenksvvacHADIvltlpkepescphglapttSAIMQLAIGDALAIALLEsrnfsendfyvlhpggklgtLFVCAsdvmhsgdsiplvkigcPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFhkdlntlsvedvmiknpkviLEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
mhfyfshfksvtrkghslmknSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKgiitegdifrnFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
MHFYFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRglsslesslqgelsFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQlaigdalaiallESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
************************QCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
MHFYFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
***YFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHFYFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
MHFYFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII
MHFYFSHFKSVTRKGHSLMKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHIGSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFSIPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRNFSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVDEGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLRFGII

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target341 polysialic acid capsule expression protein [Candidatus
254780889 493 inosine 5'-monophosphate dehydrogenase [Candidatus 2e-04
>gi|254780889|ref|YP_003065302.1| inosine 5'-monophosphate dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 493 Back     alignment
 Score = 38.1 bits (87), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 49/174 (28%), Positives = 75/174 (43%), Gaps = 25/174 (14%)

Query: 175 PTTSAIMQLAIGDALAIALLES-------RNFSENDFYV-LHPGGKLGTLFVCASDVMHS 226
           P  SA M       LAIA+ ++       RNFS ++    +H   K             S
Sbjct: 48  PIMSAAMDQVTDSRLAIAMAQAGGLGVIHRNFSPSEQVAQVHQVKKF-----------ES 96

Query: 227 GDSIPLVKIG--CPLIDAITILSEKRFGCVAVVDEG-QKLKGIITEGDIFRNFHKDLNTL 283
           G  +  V I     L DA+ ++ +     + VV+    KL GI+T  D+   F  +    
Sbjct: 97  GMVVNPVTISPYATLADALALMKKYSISGIPVVESDVGKLVGILTNRDV--RFASNAQQ- 153

Query: 284 SVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLMVVDDCQKAIGIVHFLDLLR 337
           +V ++M +N   + +   L  A  LL QH I  L+VVDD    IG++   D+ R
Sbjct: 154 AVGELMTRNLITVKKTVNLENAKALLHQHRIEKLLVVDDDGCCIGLITVKDIER 207

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target341 polysialic acid capsule expression protein [Candidatus
315122735323 polysialic acid capsule expression protein [Candidatus 1 1e-140
218674867331 KpsF/GutQ family protein [Rhizobium etli GR56] Length = 1 1e-106
209550883331 KpsF/GutQ family protein [Rhizobium leguminosarum bv. t 1 1e-103
222087080331 polysialic acid capsule expression protein [Agrobacteri 1 1e-103
241206297331 KpsF/GutQ family protein [Rhizobium leguminosarum bv. t 1 1e-102
116253816331 arabinose 5-phosphate isomerase [Rhizobium leguminosaru 1 1e-102
190893387331 arabinose 5-phosphate isomerase (involved in capsule fo 1 1e-100
327189614331 arabinose 5-phosphate isomerase protein (involved in ca 1 1e-100
218459106331 arabinose 5-phosphate isomerase protein (involved in ca 1 1e-100
163867471330 sugar isomerase [Bartonella tribocorum CIP 105476] Leng 1 2e-99
>gi|315122735|ref|YP_004063224.1| polysialic acid capsule expression protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 323 Back     alignment and organism information
 Score =  504 bits (1297), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 257/322 (79%), Positives = 288/322 (89%)

Query: 19  MKNSTVQCALRSIIAEKRGLSSLESSLQGELSFQFHCAVEKIKAIKGRVVITGIGKSGHI 78
           M N  +Q AL+SI  EK+GLSSLESSL GELS  F  AVEKIKAI+GRVV+TGIGKSGHI
Sbjct: 1   MSNLAIQSALQSIEIEKKGLSSLESSLLGELSSHFSRAVEKIKAIRGRVVVTGIGKSGHI 60

Query: 79  GSKLASTLASTGTPSFFVHAAEASHGDLGMITRDDLIIVLSWSGSSDELKAILYYARRFS 138
           GSKLAST ASTGTPSFFVHAAEA+HGDLGMIT+DD+II LSWSG S+ELKAIL +ARRFS
Sbjct: 61  GSKLASTFASTGTPSFFVHAAEANHGDLGMITQDDVIIALSWSGESNELKAILCHARRFS 120

Query: 139 IPLIAITSENKSVVACHADIVLTLPKEPESCPHGLAPTTSAIMQLAIGDALAIALLESRN 198
           IPLIAITSENKS+VACHADIVL LPKEPE+CP+GLAPTTS IMQLAIGDALA+AL+E+ N
Sbjct: 121 IPLIAITSENKSIVACHADIVLKLPKEPEACPYGLAPTTSTIMQLAIGDALAMALMEAEN 180

Query: 199 FSENDFYVLHPGGKLGTLFVCASDVMHSGDSIPLVKIGCPLIDAITILSEKRFGCVAVVD 258
           F+ENDFY LHPGGKLG+LF CA+DVMH+G  +PLVK+G  LIDAI +LSEKRFGC+AVVD
Sbjct: 181 FTENDFYALHPGGKLGSLFTCATDVMHTGTRLPLVKMGSLLIDAIPVLSEKRFGCIAVVD 240

Query: 259 EGQKLKGIITEGDIFRNFHKDLNTLSVEDVMIKNPKVILEDTLLTVAMQLLRQHNISVLM 318
           E Q+LKGI+TEGDIFRNF K+LN L+VED+M KNPKVI EDTLLTV+MQ L+QHNISVLM
Sbjct: 241 EDQRLKGIVTEGDIFRNFRKNLNVLTVEDIMTKNPKVISEDTLLTVSMQFLKQHNISVLM 300

Query: 319 VVDDCQKAIGIVHFLDLLRFGI 340
           VVD  QK IGIVHFLDLLRFGI
Sbjct: 301 VVDANQKIIGIVHFLDLLRFGI 322


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218674867|ref|ZP_03524536.1| KpsF/GutQ family protein [Rhizobium etli GR56] Length = 331 Back     alignment and organism information
>gi|209550883|ref|YP_002282800.1| KpsF/GutQ family protein [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 331 Back     alignment and organism information
>gi|222087080|ref|YP_002545615.1| polysialic acid capsule expression protein [Agrobacterium radiobacter K84] Length = 331 Back     alignment and organism information
>gi|241206297|ref|YP_002977393.1| KpsF/GutQ family protein [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 331 Back     alignment and organism information
>gi|116253816|ref|YP_769654.1| arabinose 5-phosphate isomerase [Rhizobium leguminosarum bv. viciae 3841] Length = 331 Back     alignment and organism information
>gi|190893387|ref|YP_001979929.1| arabinose 5-phosphate isomerase (involved in capsule formation) [Rhizobium etli CIAT 652] Length = 331 Back     alignment and organism information
>gi|327189614|gb|EGE56764.1| arabinose 5-phosphate isomerase protein (involved in capsule formation) [Rhizobium etli CNPAF512] Length = 331 Back     alignment and organism information
>gi|218459106|ref|ZP_03499197.1| arabinose 5-phosphate isomerase protein (involved in capsule formation) [Rhizobium etli Kim 5] Length = 331 Back     alignment and organism information
>gi|163867471|ref|YP_001608670.1| sugar isomerase [Bartonella tribocorum CIP 105476] Length = 330 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target341 polysialic acid capsule expression protein [Candidatus
PRK10892326 PRK10892, PRK10892, D-arabinose 5-phosphate isomerase; 2e-75
PRK11543321 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Prov 1e-66
TIGR00393268 TIGR00393, kpsF, KpsF/GutQ family protein 1e-73
cd05014128 cd05014, SIS_Kpsf, KpsF-like protein 3e-44
pfam01380131 pfam01380, SIS, SIS domain 4e-20
COG1737281 COG1737, RpiR, Transcriptional regulators [Transcriptio 5e-16
cd05013139 cd05013, SIS_RpiR, RpiR-like protein 6e-13
cd05008126 cd05008, SIS_GlmS_GlmD_1, SIS (Sugar ISomerase) domain 2e-09
cd05005179 cd05005, SIS_PHI, Hexulose-6-phosphate isomerase (PHI) 1e-07
COG2222340 COG2222, AgaS, Predicted phosphosugar isomerases [Cell 6e-07
COG0449597 COG0449, GlmS, Glucosamine 6-phosphate synthetase, cont 6e-06
COG2103298 COG2103, COG2103, Predicted sugar phosphate isomerase [ 3e-05
cd05007257 cd05007, SIS_Etherase, N-acetylmuramic acid 6-phosphate 3e-05
PRK14101638 PRK14101, PRK14101, bifunctional glucokinase/RpiR famil 4e-05
TIGR00274291 TIGR00274, TIGR00274, N-acetylmuramic acid 6-phosphate 6e-05
TIGR03127179 TIGR03127, RuMP_HxlB, 6-phospho 3-hexuloisomerase 3e-04
PRK12570296 PRK12570, PRK12570, N-acetylmuramic acid-6-phosphate et 0.001
cd04604114 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two 3e-30
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 8e-16
cd04623113 cd04623, CBS_pair_10, The CBS domain, named after human 1e-13
COG2524294 COG2524, COG2524, Predicted transcriptional regulator, 1e-12
cd04611111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contain 2e-12
cd04624112 cd04624, CBS_pair_11, The CBS domain, named after human 3e-12
COG0517117 COG0517, COG0517, FOG: CBS domain [General function pre 4e-12
cd04607113 cd04607, CBS_pair_NTP_transferase_assoc, This cd contai 5e-12
cd04585122 cd04585, CBS_pair_ACT_assoc2, This cd contains two tand 1e-11
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tandem re 4e-11
cd04605110 cd04605, CBS_pair_MET2_assoc, This cd contains two tand 5e-11
cd04587113 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd cont 5e-11
cd04622113 cd04622, CBS_pair_9, The CBS domain, named after human 6e-11
cd04588110 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd con 2e-10
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after human 8e-10
cd04620115 cd04620, CBS_pair_7, The CBS domain, named after human 9e-10
cd04631125 cd04631, CBS_pair_18, The CBS domain, named after human 9e-10
cd04586135 cd04586, CBS_pair_BON_assoc, This cd contains two tande 1e-09
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogen 1e-09
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two tande 3e-09
cd04800111 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd con 3e-09
cd04615113 cd04615, CBS_pair_2, The CBS domain, named after human 4e-09
cd04638106 cd04638, CBS_pair_25, The CBS domain, named after human 8e-09
TIGR01302 450 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehyd 8e-09
cd04583109 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains tw 2e-08
cd04595110 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains 4e-08
cd04613114 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains 4e-08
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains 4e-08
pfam00478 467 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase dom 6e-08
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after human 1e-07
cd04643116 cd04643, CBS_pair_30, The CBS domain, named after human 1e-07
cd04599105 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two ta 2e-07
cd04636132 cd04636, CBS_pair_23, The CBS domain, named after human 3e-07
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two tande 4e-07
cd04602114 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem 5e-07
cd04802112 cd04802, CBS_pair_3, The CBS domain, named after human 5e-07
cd04603111 cd04603, CBS_pair_KefB_assoc, This cd contains two tand 1e-06
cd04635122 cd04635, CBS_pair_22, The CBS domain, named after human 1e-06
PTZ00314 495 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogen 1e-06
cd04633121 cd04633, CBS_pair_20, The CBS domain, named after human 2e-06
cd04629114 cd04629, CBS_pair_16, The CBS domain, named after human 2e-06
cd04609110 cd04609, CBS_pair_PALP_assoc2, This cd contains two tan 2e-06
cd04626111 cd04626, CBS_pair_13, The CBS domain, named after human 2e-06
cd04801114 cd04801, CBS_pair_M50_like, This cd contains two tandem 2e-06
TIGR01186363 TIGR01186, proV, glycine betaine/L-proline transport AT 2e-06
cd04634143 cd04634, CBS_pair_21, The CBS domain, named after human 3e-06
COG2905 610 COG2905, COG2905, Predicted signal-transduction protein 3e-06
TIGR01137454 TIGR01137, cysta_beta, cystathionine beta-synthase 3e-06
cd04606109 cd04606, CBS_pair_Mg_transporter, This cd contains two 4e-06
cd04621135 cd04621, CBS_pair_8, The CBS domain, named after human 4e-06
cd04596108 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tan 6e-06
cd04619114 cd04619, CBS_pair_6, The CBS domain, named after human 8e-06
COG2239 451 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS 2e-05
COG4109 432 COG4109, COG4109, Predicted transcriptional regulator c 4e-05
COG3620187 COG3620, COG3620, Predicted transcriptional regulator w 5e-05
KOG1764381 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin 7e-05
cd0461496 cd04614, CBS_pair_1, The CBS domain, named after human 1e-04
cd04639111 cd04639, CBS_pair_26, The CBS domain, named after human 1e-04
cd04590111 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two 2e-04
cd04617118 cd04617, CBS_pair_4, The CBS domain, named after human 2e-04
cd04589111 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd cont 3e-04
cd04642126 cd04642, CBS_pair_29, The CBS domain, named after human 3e-04
cd04608124 cd04608, CBS_pair_PALP_assoc, This cd contains two tand 4e-04
cd04641120 cd04641, CBS_pair_28, The CBS domain, named after human 4e-04
cd04592133 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two 0.001
PRK07807 479 PRK07807, PRK07807, inosine 5-monophosphate dehydrogena 0.001
cd04610107 cd04610, CBS_pair_ParBc_assoc, This cd contains two tan 0.003
cd04632128 cd04632, CBS_pair_19, The CBS domain, named after human 0.003
COG3448382 COG3448, COG3448, CBS-domain-containing membrane protei 0.003
pfam0057157 pfam00571, CBS, CBS domain 4e-08
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent inorga 4e-05
cd02205113 cd02205, CBS_pair, The CBS domain, named after human CB 2e-04
cd04600124 cd04600, CBS_pair_HPP_assoc, This cd contains two tande 4e-04
KOG2550 503 KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reduct 4e-04
cd04597113 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two ta 5e-04
smart0011649 smart00116, CBS, Domain in cystathionine beta-synthase 7e-04
COG0517117 COG0517, COG0517, FOG: CBS domain [General function pre 0.001
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogen 0.002
cd04601110 cd04601, CBS_pair_IMPDH, This cd contains two tandem re 0.003
COG3448382 COG3448, COG3448, CBS-domain-containing membrane protei 0.003
cd0479587 cd04795, SIS, SIS domain 4e-07
cd05017119 cd05017, SIS_PGI_PMI_1, The members of this protein fam 3e-04
pfam0057157 pfam00571, CBS, CBS domain 1e-06
cd04803122 cd04803, CBS_pair_15, The CBS domain, named after human 6e-06
smart0011649 smart00116, CBS, Domain in cystathionine beta-synthase 4e-05
PRK14869 546 PRK14869, PRK14869, putative manganese-dependent inorga 2e-04
cd04637122 cd04637, CBS_pair_24, The CBS domain, named after human 0.002
cd04584121 cd04584, CBS_pair_ACT_assoc, This cd contains two tande 0.002
PRK05567 486 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogen 0.002
cd04612111 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains 0.004
PRK11337292 PRK11337, PRK11337, DNA-binding transcriptional repress 5e-06
PRK11302284 PRK11302, PRK11302, DNA-binding transcriptional regulat 0.004
PRK07107 502 PRK07107, PRK07107, inosine 5-monophosphate dehydrogena 9e-05
KOG1764381 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kin 4e-04
PRK11557278 PRK11557, PRK11557, putative DNA-binding transcriptiona 1e-04
COG0794202 COG0794, GutQ, Predicted sugar phosphate isomerase invo 6e-55
>gnl|CDD|182814 PRK10892, PRK10892, D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|183186 PRK11543, gutQ, D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>gnl|CDD|129488 TIGR00393, kpsF, KpsF/GutQ family protein Back     alignment and domain information
>gnl|CDD|88409 cd05014, SIS_Kpsf, KpsF-like protein Back     alignment and domain information
>gnl|CDD|144827 pfam01380, SIS, SIS domain Back     alignment and domain information
>gnl|CDD|31923 COG1737, RpiR, Transcriptional regulators [Transcription] Back     alignment and domain information
>gnl|CDD|88408 cd05013, SIS_RpiR, RpiR-like protein Back     alignment and domain information
>gnl|CDD|88405 cd05008, SIS_GlmS_GlmD_1, SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>gnl|CDD|88402 cd05005, SIS_PHI, Hexulose-6-phosphate isomerase (PHI) Back     alignment and domain information
>gnl|CDD|32404 COG2222, AgaS, Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|30798 COG0449, GlmS, Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|32286 COG2103, COG2103, Predicted sugar phosphate isomerase [General function prediction only] Back     alignment and domain information
>gnl|CDD|88404 cd05007, SIS_Etherase, N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>gnl|CDD|184507 PRK14101, PRK14101, bifunctional glucokinase/RpiR family transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|129375 TIGR00274, TIGR00274, N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>gnl|CDD|132171 TIGR03127, RuMP_HxlB, 6-phospho 3-hexuloisomerase Back     alignment and domain information
>gnl|CDD|183600 PRK12570, PRK12570, N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>gnl|CDD|73104 cd04604, CBS_pair_KpsF_GutQ_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with KpsF/GutQ domains in the API [A5P (D-arabinose 5-phosphate) isomerase] protein Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73122 cd04623, CBS_pair_10, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|32593 COG2524, COG2524, Predicted transcriptional regulator, contains C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|73111 cd04611, CBS_pair_PAS_GGDEF_DUF1_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with a PAS domain, a GGDEF (DiGuanylate-Cyclase (DGC) domain, and a DUF1 domain downstream Back     alignment and domain information
>gnl|CDD|73123 cd04624, CBS_pair_11, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|30863 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|73107 cd04607, CBS_pair_NTP_transferase_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain associated with the NTP (Nucleotidyl transferase) domain downstream Back     alignment and domain information
>gnl|CDD|73085 cd04585, CBS_pair_ACT_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73101 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|73105 cd04605, CBS_pair_MET2_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the MET2 domain Back     alignment and domain information
>gnl|CDD|73087 cd04587, CBS_pair_CAP-ED_DUF294_PBI_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|73121 cd04622, CBS_pair_9, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73088 cd04588, CBS_pair_CAP-ED_DUF294_assoc_arch, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the archaeal CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73119 cd04620, CBS_pair_7, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73129 cd04631, CBS_pair_18, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73086 cd04586, CBS_pair_BON_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the BON (bacterial OsmY and nodulation domain) domain Back     alignment and domain information
>gnl|CDD|180134 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|73142 cd04800, CBS_pair_CAP-ED_DUF294_PBI_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with either the CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain or the PB1 (Phox and Bem1p) domain Back     alignment and domain information
>gnl|CDD|73115 cd04615, CBS_pair_2, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73136 cd04638, CBS_pair_25, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|162293 TIGR01302, IMP_dehydrog, inosine-5'-monophosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|73083 cd04583, CBS_pair_ABC_OpuCA_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the ABC transporter OpuCA Back     alignment and domain information
>gnl|CDD|73095 cd04595, CBS_pair_DHH_polyA_Pol_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with an upstream DHH domain which performs a phosphoesterase function and a downstream polyA polymerase domain Back     alignment and domain information
>gnl|CDD|73113 cd04613, CBS_pair_SpoIVFB_EriC_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|144171 pfam00478, IMPDH, IMP dehydrogenase / GMP reductase domain Back     alignment and domain information
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73141 cd04643, CBS_pair_30, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73099 cd04599, CBS_pair_GGDEF_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the GGDEF (DiGuanylate-Cyclase (DGC)) domain Back     alignment and domain information
>gnl|CDD|73134 cd04636, CBS_pair_23, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|73102 cd04602, CBS_pair_IMPDH_2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|73144 cd04802, CBS_pair_3, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73103 cd04603, CBS_pair_KefB_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the KefB (Kef-type K+ transport systems) domain which is involved in inorganic ion transport and metabolism Back     alignment and domain information
>gnl|CDD|73133 cd04635, CBS_pair_22, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|185550 PTZ00314, PTZ00314, inosine-5'-monophosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|73131 cd04633, CBS_pair_20, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73127 cd04629, CBS_pair_16, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73109 cd04609, CBS_pair_PALP_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|73125 cd04626, CBS_pair_13, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73143 cd04801, CBS_pair_M50_like, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with the metalloprotease peptidase M50 Back     alignment and domain information
>gnl|CDD|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>gnl|CDD|73132 cd04634, CBS_pair_21, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|32729 COG2905, COG2905, Predicted signal-transduction protein containing cAMP-binding and CBS domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162220 TIGR01137, cysta_beta, cystathionine beta-synthase Back     alignment and domain information
>gnl|CDD|73106 cd04606, CBS_pair_Mg_transporter, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domain in the magnesium transporter, MgtE Back     alignment and domain information
>gnl|CDD|73120 cd04621, CBS_pair_8, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73096 cd04596, CBS_pair_DRTGG_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|73118 cd04619, CBS_pair_6, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|32420 COG2239, MgtE, Mg/Co/Ni transporter MgtE (contains CBS domain) [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|33866 COG4109, COG4109, Predicted transcriptional regulator containing CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|33419 COG3620, COG3620, Predicted transcriptional regulator with C-terminal CBS domains [Transcription] Back     alignment and domain information
>gnl|CDD|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|73114 cd04614, CBS_pair_1, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73137 cd04639, CBS_pair_26, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73090 cd04590, CBS_pair_CorC_HlyC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the CorC_HlyC domain Back     alignment and domain information
>gnl|CDD|73116 cd04617, CBS_pair_4, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73089 cd04589, CBS_pair_CAP-ED_DUF294_assoc_bac, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the bacterial CAP_ED (cAMP receptor protein effector domain) family of transcription factors and the DUF294 domain Back     alignment and domain information
>gnl|CDD|73140 cd04642, CBS_pair_29, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73108 cd04608, CBS_pair_PALP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the pyridoxal-phosphate (PALP) dependent enzyme domain upstream Back     alignment and domain information
>gnl|CDD|73139 cd04641, CBS_pair_28, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73092 cd04592, CBS_pair_EriC_assoc_euk, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the EriC CIC-type chloride channels in eukaryotes Back     alignment and domain information
>gnl|CDD|181127 PRK07807, PRK07807, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|73110 cd04610, CBS_pair_ParBc_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a ParBc (ParB-like nuclease) domain downstream Back     alignment and domain information
>gnl|CDD|73130 cd04632, CBS_pair_19, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|144238 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|73081 cd02205, CBS_pair, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73100 cd04600, CBS_pair_HPP_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with the HPP motif domain Back     alignment and domain information
>gnl|CDD|37761 KOG2550, KOG2550, KOG2550, IMP dehydrogenase/GMP reductase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|73097 cd04597, CBS_pair_DRTGG_assoc2, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains associated with a DRTGG domain upstream Back     alignment and domain information
>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|30863 COG0517, COG0517, FOG: CBS domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|180134 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|73101 cd04601, CBS_pair_IMPDH, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the inosine 5' monophosphate dehydrogenase (IMPDH) protein Back     alignment and domain information
>gnl|CDD|33251 COG3448, COG3448, CBS-domain-containing membrane protein [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|88401 cd04795, SIS, SIS domain Back     alignment and domain information
>gnl|CDD|88412 cd05017, SIS_PGI_PMI_1, The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information
>gnl|CDD|144238 pfam00571, CBS, CBS domain Back     alignment and domain information
>gnl|CDD|73145 cd04803, CBS_pair_15, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|128426 smart00116, CBS, Domain in cystathionine beta-synthase and other proteins Back     alignment and domain information
>gnl|CDD|184871 PRK14869, PRK14869, putative manganese-dependent inorganic pyrophosphatase; Provisional Back     alignment and domain information
>gnl|CDD|73135 cd04637, CBS_pair_24, The CBS domain, named after human CBS, is a small domain originally identified in cystathionine beta-synthase and is subsequently found in a wide range of different proteins Back     alignment and domain information
>gnl|CDD|73084 cd04584, CBS_pair_ACT_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in the acetoin utilization proteins in bacteria Back     alignment and domain information
>gnl|CDD|180134 PRK05567, PRK05567, inosine 5'-monophosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|73112 cd04612, CBS_pair_SpoIVFB_EriC_assoc, This cd contains two tandem repeats of the cystathionine beta-synthase (CBS pair) domains in association with either the SpoIVFB domain (sporulation protein, stage IV cell wall formation, F locus, promoter-distal B) or the chloride channel protein EriC Back     alignment and domain information
>gnl|CDD|183089 PRK11337, PRK11337, DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>gnl|CDD|183082 PRK11302, PRK11302, DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information
>gnl|CDD|180842 PRK07107, PRK07107, inosine 5-monophosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36975 KOG1764, KOG1764, KOG1764, 5'-AMP-activated protein kinase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183195 PRK11557, PRK11557, putative DNA-binding transcriptional regulator; Provisional Back     alignment and domain information
>gnl|CDD|31137 COG0794, GutQ, Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 341 polysialic acid capsule expression protein [Candidatus
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 100.0
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 100.0
TIGR01135628 glmS glucosamine--fructose-6-phosphate aminotransferase 99.76
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 100.0
TIGR02815374 agaS_fam putative sugar isomerase, AgaS family; InterPr 98.45
KOG0475696 consensus 97.65
COG0794202 GutQ Predicted sugar phosphate isomerase involved in ca 100.0
TIGR03127179 RuMP_HxlB 6-phospho 3-hexuloisomerase. Members of this 100.0
cd05005179 SIS_PHI Hexulose-6-phosphate isomerase (PHI). PHI is a 100.0
COG1737281 RpiR Transcriptional regulators [Transcription] 99.94
PRK13936197 phosphoheptose isomerase; Provisional 99.58
PRK05441273 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewe 99.57
PRK12570296 N-acetylmuramic acid-6-phosphate etherase; Reviewed 99.56
cd05007257 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase. 99.56
cd05014128 SIS_Kpsf KpsF-like protein. KpsF is an arabinose-5-phos 100.0
pfam01380131 SIS SIS domain. SIS (Sugar ISomerase) domains are found 99.88
cd05013139 SIS_RpiR RpiR-like protein. RpiR contains a SIS (Sugar 99.83
cd05008126 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 f 99.76
cd05710120 SIS_1 A subgroup of the SIS domain. SIS (Sugar ISomeras 99.67
COG2222340 AgaS Predicted phosphosugar isomerases [Cell envelope b 99.66
cd05006177 SIS_GmhA Phosphoheptose isomerase is a member of the SI 99.61
PRK00414192 gmhA phosphoheptose isomerase; Reviewed 99.58
PRK13938196 phosphoheptose isomerase; Provisional 99.56
TIGR00441186 gmhA phosphoheptose isomerase; InterPro: IPR004515 Phos 99.49
COG0279176 GmhA Phosphoheptose isomerase [Carbohydrate transport a 99.45
PRK02947247 hypothetical protein; Provisional 99.39
cd05017119 SIS_PGI_PMI_1 The members of this protein family contai 99.3
PRK08674328 bifunctional phosphoglucose/phosphomannose isomerase; V 99.26
COG4821243 Uncharacterized protein containing SIS (Sugar ISomerase 99.21
PRK00331604 glucosamine--fructose-6-phosphate aminotransferase; Rev 98.65
cd05009153 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 f 98.38
PTZ00295691 glucosamine-fructose-6-phosphate aminotransferase; Prov 97.97
COG0449597 GlmS Glucosamine 6-phosphate synthetase, contains amido 97.96
COG2222340 AgaS Predicted phosphosugar isomerases [Cell envelope b 97.8
cd05010151 SIS_AgaS_like AgaS-like protein. AgaS contains a SIS (S 97.54
pfam00342483 PGI Phosphoglucose isomerase. Phosphoglucose isomerase 97.21
PRK11382347 frlB fructoselysine-6-P-deglycase; Provisional 97.12
TIGR01135628 glmS glucosamine--fructose-6-phosphate aminotransferase 96.63
PRK00179525 pgi glucose-6-phosphate isomerase; Reviewed 96.62
PRK11337293 DNA-binding transcriptional repressor RpiR; Provisional 99.94
PRK11302284 DNA-binding transcriptional regulator HexR; Provisional 99.94
PRK11557282 putative DNA-binding transcriptional regulator; Provisi 99.93
PRK13937192 phosphoheptose isomerase; Provisional 99.6
PRK10886196 DnaA initiator-associating protein DiaA; Provisional 99.53
TIGR00274291 TIGR00274 glucokinase regulator homolog; InterPro: IPR0 99.52
COG2103298 Predicted sugar phosphate isomerase [General function p 99.52
KOG1268670 consensus 99.23
pfam10740172 DUF2529 Protein of unknown function (DUF2529). This fam 97.67
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 99.9
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 99.88
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 99.86
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 99.86
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 99.86
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 99.85
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 99.84
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 99.84
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 99.84
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 99.84
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 99.84
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 99.83
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 99.83
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 99.83
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 99.83
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 99.82
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 99.82
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 99.82
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 99.81
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 99.81
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 99.81
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 99.81
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 99.81
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 99.81
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 99.81
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 99.81
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 99.8
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 99.8
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 99.8
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 99.8
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 99.8
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 99.79
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 99.79
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 99.79
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 99.78
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 99.78
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 99.78
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 99.78
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 99.77
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 99.77
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 99.76
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 99.76
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 99.76
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 99.76
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 99.76
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 99.75
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 99.75
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 99.75
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 99.75
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 99.74
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 99.74
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 99.73
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 99.72
COG2524294 Predicted transcriptional regulator, contains C-termina 99.72
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 99.71
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 99.7
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 99.68
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 99.66
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 99.65
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 99.63
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 99.54
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 99.52
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 99.47
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 99.46
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 99.44
COG0517117 FOG: CBS domain [General function prediction only] 99.4
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 99.28
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 99.18
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic 99.1
KOG1764381 consensus 98.86
COG4535 293 CorC Putative Mg2+ and Co2+ transporter CorC [Inorganic 98.82
KOG2550 503 consensus 98.71
KOG0474762 consensus 98.45
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, is a 98.31
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 98.24
COG4175386 ProV ABC-type proline/glycine betaine transport system, 97.81
KOG2118 498 consensus 95.39
TIGR01303 476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 91.42
PRK00331604 glucosamine--fructose-6-phosphate aminotransferase; Rev 99.79
PTZ00295691 glucosamine-fructose-6-phosphate aminotransferase; Prov 99.76
COG0449597 GlmS Glucosamine 6-phosphate synthetase, contains amido 99.68
TIGR02128338 G6PI_arch bifunctional phosphoglucose/phosphomannose is 99.09
PRK09533 950 bifunctional transaldolase/phosoglucose isomerase; Vali 97.74
COG2905 610 Predicted signal-transduction protein containing cAMP-b 99.68
TIGR01302 476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 99.65
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 99.63
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 99.62
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 99.55
COG3448382 CBS-domain-containing membrane protein [Signal transduc 99.48
TIGR03520408 GldE gliding motility-associated protein GldE. Members 99.43
PRK11573 413 hypothetical protein; Provisional 99.35
COG1253429 TlyC Hemolysins and related proteins containing CBS dom 99.29
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 99.22
KOG1764381 consensus 98.28
TIGR01303 476 IMP_DH_rel_1 IMP dehydrogenase family protein; InterPro 98.22
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 97.41
TIGR01137527 cysta_beta cystathionine beta-synthase; InterPro: IPR00 96.94
TIGR00400 460 mgtE magnesium transporter; InterPro: IPR006669 This is 96.48
cd0479587 SIS SIS domain. SIS (Sugar ISomerase) domains are found 99.57
PRK11382347 frlB fructoselysine-6-P-deglycase; Provisional 99.55
LOAD_sis90 consensus 98.96
PRK03868409 glucose-6-phosphate isomerase; Provisional 98.16
PRK00973454 glucose-6-phosphate isomerase; Provisional 97.98
COG0166446 Pgi Glucose-6-phosphate isomerase [Carbohydrate transpo 97.83
cd05015158 SIS_PGI_1 Phosphoglucose isomerase (PGI) contains two S 97.6
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 99.53
COG4109 432 Predicted transcriptional regulator containing CBS doma 99.52
PRK10070400 glycine betaine transporter ATP-binding subunit; Provis 99.27
TIGR01302 476 IMP_dehydrog inosine-5'-monophosphate dehydrogenase; In 98.1
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 97.71
COG1125309 OpuBA ABC-type proline/glycine betaine transport system 95.11
COG3620187 Predicted transcriptional regulator with C-terminal CBS 99.47
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 98.9
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 98.59
cd04608124 CBS_pair_PALP_assoc This cd contains two tandem repeats 98.56
COG3448382 CBS-domain-containing membrane protein [Signal transduc 98.4
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 98.32
PRK01862583 putative voltage-gated ClC-type chloride channel ClcB; 98.19
cd04592133 CBS_pair_EriC_assoc_euk This cd contains two tandem rep 98.15
TIGR01186372 proV glycine betaine/L-proline transport ATP binding su 97.08
cd04635122 CBS_pair_22 The CBS domain, named after human CBS, is a 98.66
cd04600124 CBS_pair_HPP_assoc This cd contains two tandem repeats 98.65
cd04632128 CBS_pair_19 The CBS domain, named after human CBS, is a 98.6
cd04629114 CBS_pair_16 The CBS domain, named after human CBS, is a 98.6
cd04586135 CBS_pair_BON_assoc This cd contains two tandem repeats 98.58
cd04638106 CBS_pair_25 The CBS domain, named after human CBS, is a 98.56
cd04617118 CBS_pair_4 The CBS domain, named after human CBS, is a 98.55
cd04641120 CBS_pair_28 The CBS domain, named after human CBS, is a 98.54
cd04636132 CBS_pair_23 The CBS domain, named after human CBS, is a 98.53
cd04584121 CBS_pair_ACT_assoc This cd contains two tandem repeats 98.52
cd04582106 CBS_pair_ABC_OpuCA_assoc This cd contains two tandem re 98.5
cd04621135 CBS_pair_8 The CBS domain, named after human CBS, is a 98.5
COG2524294 Predicted transcriptional regulator, contains C-termina 98.5
cd04605110 CBS_pair_MET2_assoc This cd contains two tandem repeats 98.49
cd04594104 CBS_pair_EriC_assoc_archaea This cd contains two tandem 98.49
cd04643116 CBS_pair_30 The CBS domain, named after human CBS, is a 98.49
cd04619114 CBS_pair_6 The CBS domain, named after human CBS, is a 98.49
cd04610107 CBS_pair_ParBc_assoc This cd contains two tandem repeat 98.47
cd04597113 CBS_pair_DRTGG_assoc2 This cd contains two tandem repea 98.47
cd04583109 CBS_pair_ABC_OpuCA_assoc2 This cd contains two tandem r 98.47
cd04640126 CBS_pair_27 The CBS domain, named after human CBS, is a 98.47
cd04637122 CBS_pair_24 The CBS domain, named after human CBS, is a 98.47
cd04634143 CBS_pair_21 The CBS domain, named after human CBS, is a 98.46
cd04593115 CBS_pair_EriC_assoc_bac_arch This cd contains two tande 98.45
cd04615113 CBS_pair_2 The CBS domain, named after human CBS, is a 98.44
cd04585122 CBS_pair_ACT_assoc2 This cd contains two tandem repeats 98.44
cd04623113 CBS_pair_10 The CBS domain, named after human CBS, is a 98.44
cd04613114 CBS_pair_SpoIVFB_EriC_assoc2 This cd contains two tande 98.43
cd04603111 CBS_pair_KefB_assoc This cd contains two tandem repeats 98.42
cd04620115 CBS_pair_7 The CBS domain, named after human CBS, is a 98.42
cd04622113 CBS_pair_9 The CBS domain, named after human CBS, is a 98.42
cd04625112 CBS_pair_12 The CBS domain, named after human CBS, is a 98.41
cd04633121 CBS_pair_20 The CBS domain, named after human CBS, is a 98.39
cd04803122 CBS_pair_15 The CBS domain, named after human CBS, is a 98.39
cd04596108 CBS_pair_DRTGG_assoc This cd contains two tandem repeat 98.39
cd04624112 CBS_pair_11 The CBS domain, named after human CBS, is a 98.37
cd04587113 CBS_pair_CAP-ED_DUF294_PBI_assoc This cd contains two t 98.35
cd0461496 CBS_pair_1 The CBS domain, named after human CBS, is a 98.35
cd04631125 CBS_pair_18 The CBS domain, named after human CBS, is a 98.35
cd04599105 CBS_pair_GGDEF_assoc2 This cd contains two tandem repea 98.34
cd04639111 CBS_pair_26 The CBS domain, named after human CBS, is a 98.33
cd04602114 CBS_pair_IMPDH_2 This cd contains two tandem repeats of 98.33
cd04601110 CBS_pair_IMPDH This cd contains two tandem repeats of t 98.32
cd04588110 CBS_pair_CAP-ED_DUF294_assoc_arch This cd contains two 98.32
cd04642126 CBS_pair_29 The CBS domain, named after human CBS, is a 98.31
cd04627123 CBS_pair_14 The CBS domain, named after human CBS, is a 98.29
cd04609110 CBS_pair_PALP_assoc2 This cd contains two tandem repeat 98.29
cd04802112 CBS_pair_3 The CBS domain, named after human CBS, is a 98.28
cd04612111 CBS_pair_SpoIVFB_EriC_assoc This cd contains two tandem 98.28
cd04607113 CBS_pair_NTP_transferase_assoc This cd contains two tan 98.27
cd04595110 CBS_pair_DHH_polyA_Pol_assoc This cd contains two tande 98.26
COG3620187 Predicted transcriptional regulator with C-terminal CBS 98.26
cd04626111 CBS_pair_13 The CBS domain, named after human CBS, is a 98.25
cd04630114 CBS_pair_17 The CBS domain, named after human CBS, is a 98.23
cd04611111 CBS_pair_PAS_GGDEF_DUF1_assoc This cd contains two tand 98.23
cd04589111 CBS_pair_CAP-ED_DUF294_assoc_bac This cd contains two t 98.23
cd04604114 CBS_pair_KpsF_GutQ_assoc This cd contains two tandem re 98.17
smart0011649 CBS Domain in cystathionine beta-synthase and other pro 98.17
cd04800111 CBS_pair_CAP-ED_DUF294_PBI_assoc2 This cd contains two 98.16
cd04606109 CBS_pair_Mg_transporter This cd contains two tandem rep 98.09
cd04598119 CBS_pair_GGDEF_assoc This cd contains two tandem repeat 97.89
cd02205113 CBS_pair The CBS domain, named after human CBS, is a sm 97.82
PRK07807 479 inositol-5-monophosphate dehydrogenase; Validated 97.82
pfam0057157 CBS CBS domain. CBS domains are small intracellular mod 97.8
PRK05567 486 inositol-5'-monophosphate dehydrogenase; Reviewed 97.66
PRK11543321 gutQ D-arabinose 5-phosphate isomerase; Provisional 97.62
COG2905 610 Predicted signal-transduction protein containing cAMP-b 97.57
cd04590111 CBS_pair_CorC_HlyC_assoc This cd contains two tandem re 97.52
PTZ00314 499 inosine-5'-monophosphate dehydrogenase; Provisional 97.49
PRK10892326 D-arabinose 5-phosphate isomerase; Provisional 97.44
cd04591105 CBS_pair_EriC_assoc_euk_bac This cd contains two tandem 97.16
COG0517117 FOG: CBS domain [General function prediction only] 96.99
COG4109432 Predicted transcriptional regulator containing CBS doma 96.83
TIGR00393272 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR00 96.83
COG2239 451 MgtE Mg/Co/Ni transporter MgtE (contains CBS domain) [I 96.72
pfam00478 467 IMPDH IMP dehydrogenase / GMP reductase domain. This fa 96.65
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-binding pro 96.03
KOG2550 503 consensus 93.26
KOG0474762 consensus 91.41
cd0461898 CBS_pair_5 The CBS domain, named after human CBS, is a 90.81
cd04801114 CBS_pair_M50_like This cd contains two tandem repeats o 98.22
PRK07107 497 inositol-5-monophosphate dehydrogenase; Validated 97.88
TIGR03520408 GldE gliding motility-associated protein GldE. Members 97.29
COG1253429 TlyC Hemolysins and related proteins containing CBS dom 97.24
PRK11573413 hypothetical protein; Provisional 96.91
COG4536423 CorB Putative Mg2+ and Co2+ transporter CorB [Inorganic 94.68
>PRK11543 gutQ D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>PRK10892 D-arabinose 5-phosphate isomerase; Provisional Back     alignment and domain information
>TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase, isomerizing; InterPro: IPR005855 Glucosamine:fructose-6-phosphate aminotransferase (2 Back     alignment and domain information
>TIGR00393 kpsF sugar isomerase, KpsF/GutQ family; InterPro: IPR004800 This is a family of closely related proteins with the phosphosugar-binding domain SIS (Sugar ISomerase) followed by two copies of the CBS (named after Cystathionine Beta Synthase) domain Back     alignment and domain information
>TIGR02815 agaS_fam putative sugar isomerase, AgaS family; InterPro: IPR014180 Some members of this protein family are found in genic regions associated with N-acetyl-galactosamine and galactosamine utilisation and are suggested to be isomerases Back     alignment and domain information
>KOG0475 consensus Back     alignment and domain information
>COG0794 GutQ Predicted sugar phosphate isomerase involved in capsule formation [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03127 RuMP_HxlB 6-phospho 3-hexuloisomerase Back     alignment and domain information
>cd05005 SIS_PHI Hexulose-6-phosphate isomerase (PHI) Back     alignment and domain information
>COG1737 RpiR Transcriptional regulators [Transcription] Back     alignment and domain information
>PRK13936 phosphoheptose isomerase; Provisional Back     alignment and domain information
>PRK05441 murQ N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>PRK12570 N-acetylmuramic acid-6-phosphate etherase; Reviewed Back     alignment and domain information
>cd05007 SIS_Etherase N-acetylmuramic acid 6-phosphate etherase Back     alignment and domain information
>cd05014 SIS_Kpsf KpsF-like protein Back     alignment and domain information
>pfam01380 SIS SIS domain Back     alignment and domain information
>cd05013 SIS_RpiR RpiR-like protein Back     alignment and domain information
>cd05008 SIS_GlmS_GlmD_1 SIS (Sugar ISomerase) domain repeat 1 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>cd05710 SIS_1 A subgroup of the SIS domain Back     alignment and domain information
>COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05006 SIS_GmhA Phosphoheptose isomerase is a member of the SIS (Sugar ISomerase) superfamily Back     alignment and domain information
>PRK00414 gmhA phosphoheptose isomerase; Reviewed Back     alignment and domain information
>PRK13938 phosphoheptose isomerase; Provisional Back     alignment and domain information
>TIGR00441 gmhA phosphoheptose isomerase; InterPro: IPR004515 Phosphoheptose isomerase is involved in lipopolysaccharide biosynthesis, and more specifically in the synthesis of glyceromannoheptose 7-phosphate Back     alignment and domain information
>COG0279 GmhA Phosphoheptose isomerase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK02947 hypothetical protein; Provisional Back     alignment and domain information
>cd05017 SIS_PGI_PMI_1 The members of this protein family contain the SIS (Sugar ISomerase) domain and have both the phosphoglucose isomerase (PGI) and the phosphomannose isomerase (PMI) functions Back     alignment and domain information
>PRK08674 bifunctional phosphoglucose/phosphomannose isomerase; Validated Back     alignment and domain information
>COG4821 Uncharacterized protein containing SIS (Sugar ISomerase) phosphosugar binding domain [General function prediction only] Back     alignment and domain information
>PRK00331 glucosamine--fructose-6-phosphate aminotransferase; Reviewed Back     alignment and domain information
>cd05009 SIS_GlmS_GlmD_2 SIS (Sugar ISomerase) domain repeat 2 found in Glucosamine 6-phosphate synthase (GlmS) and Glucosamine-6-phosphate deaminase (GlmD) Back     alignment and domain information
>PTZ00295 glucosamine-fructose-6-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0449 GlmS Glucosamine 6-phosphate synthetase, contains amidotransferase and phosphosugar isomerase domains [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG2222 AgaS Predicted phosphosugar isomerases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>cd05010 SIS_AgaS_like AgaS-like protein Back     alignment and domain information
>pfam00342 PGI Phosphoglucose isomerase Back     alignment and domain information
>PRK11382 frlB fructoselysine-6-P-deglycase; Provisional Back     alignment and domain information
>TIGR01135 glmS glucosamine--fructose-6-phosphate aminotransferase, isomerizing; InterPro: IPR005855 Glucosamine:fructose-6-phosphate aminotransferase (2 Back     alignment and domain information
>PRK00179 pgi glucose-6-phosphate isomerase; Reviewed Back     alignment and domain information
>PRK11337 DNA-binding transcriptional repressor RpiR; Provisional Back     alignment and domain information
>PRK11302 DNA-binding transcriptional regulator HexR; Provisional Back     alignment and domain information