254780841

254780841

phosphatidylcholine synthase protein

GeneID in NCBI database:8209853Locus tag:CLIBASIA_03680
Protein GI in NCBI database:254780841Protein Accession:YP_003065254.1
Gene range:-(810312, 811052)Protein Length:246aa
Gene description:phosphatidylcholine synthase protein
COG prediction:[I] Phosphatidylserine synthase
KEGG prediction:phosphatidylcholine synthase protein; K01004 phosphatidylcholine synthase [EC:2.7.8.24]
SEED prediction:Phosphatidylcholine synthase (EC 2.7.8.24)
Pathway involved in KEGG:Glycerophospholipid metabolism [PATH:las00564]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM5 TM-Helix
TOPPRED7 TM-Helix
HMMTOP8 TM-Helix
MEMSAT6 TM-Helix
MEMSAT_SVM6 TM-Helix
PHOBIUS8 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240------
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKRQY
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccHHHHcHHHHHHHHccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHEEHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccc
migkmnyknfshkrvSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIdgfdgpiarKMRVkevlpnwsgdtldNIIDYLTYVVLPAFALYqsnllgnstgsSVAAGMMVISSSIYYAYTnmkteehffsgfpaVWNMVVFSLIALNASVLVSTIVITTSVILtfvpvnflhpirvvrlrPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIfpnlgkkrqy
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQifpnlgkkrqy
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNAsvlvstivittsviltFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKRQY
***************SAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQI**********
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKRQY
****MNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLG*****
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooo
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxx
iiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
iiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKRQY
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKRQY
MIGKMNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIYYAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRVVRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKRQY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target246 phosphatidylcholine synthase protein [Candidatus Liberi
254780578298 phosphatidylserine synthase [Candidatus Liberibact 0.035
>gi|254780578|ref|YP_003064991.1| phosphatidylserine synthase [Candidatus Liberibacter asiaticus str. psy62] Length = 298 Back     alignment
 Score = 30.0 bits (66), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 48/109 (44%), Gaps = 14/109 (12%)

Query: 52  LALIIDGFDGPIARKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNL-LGNSTGS 110
           +A  +DG DG IAR M          G  LD++ D + + V P+   Y + L   ++ G 
Sbjct: 90  VAAFLDGIDGRIARFMEATSKF----GAQLDSLADVINFGVAPSLVTYIAVLRQAHAFGW 145

Query: 111 SVAAGMMVISSSIYYAYTNMKTE--------EHFFSGFPAVWNMVVFSL 151
           S+A  M  I+ S+  A  N+  +          +F G PA    ++  L
Sbjct: 146 SIAL-MYTIAISLRLARFNIMNDCDEKDNWKSEYFVGVPAPLGAILLML 193

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target246 phosphatidylcholine synthase protein [Candidatus Liberi
315122734241 phosphatidylcholine synthase [Candidatus Liberibacter s 1 1e-114
218663701242 phosphatidylcholine synthase protein [Rhizobium etli IE 1 6e-88
86357698242 phosphatidylcholine synthase protein [Rhizobium etli CF 1 8e-88
159184920241 phosphatidylcholine synthase [Agrobacterium tumefaciens 1 9e-88
325293179250 phosphatidylcholine synthase [Agrobacterium sp. H13-3] 1 2e-86
222085955241 phosphatidylcholine synthase protein [Agrobacterium rad 1 2e-85
209549310242 phosphatidylcholine synthase [Rhizobium leguminosarum b 1 3e-85
218671822242 putative transmembrane phosphatidylcholine synthase [Rh 1 3e-85
190891723242 phosphatidylcholine synthase [Rhizobium etli CIAT 652] 1 4e-85
218516018242 phosphatidylcholine synthase protein [Rhizobium etli 8C 1 5e-85
>gi|315122734|ref|YP_004063223.1| phosphatidylcholine synthase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 241 Back     alignment and organism information
 Score =  416 bits (1070), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 206/242 (85%), Positives = 221/242 (91%), Gaps = 1/242 (0%)

Query: 5   MNYKNFSHKRVSAFSVHILTAFGSFIAFLGVTAAAQYRIVDMFWWLGLALIIDGFDGPIA 64
           MNY+NFS K + AFSVHILTA GSF AFLGV AAAQYR+VDMFWW+GLALIIDGFDGPIA
Sbjct: 1   MNYRNFSSKCIGAFSVHILTACGSFCAFLGVIAAAQYRLVDMFWWIGLALIIDGFDGPIA 60

Query: 65  RKMRVKEVLPNWSGDTLDNIIDYLTYVVLPAFALYQSNLLGNSTGSSVAAGMMVISSSIY 124
           RKMRVKEVLPNWSGDTLDNI+DYLTYV+LPAFALYQSNLL +STGSS+AAGM+VISS+IY
Sbjct: 61  RKMRVKEVLPNWSGDTLDNIVDYLTYVILPAFALYQSNLL-DSTGSSIAAGMIVISSAIY 119

Query: 125 YAYTNMKTEEHFFSGFPAVWNMVVFSLIALNASVLVSTIVITTSVILTFVPVNFLHPIRV 184
           YAYTNMKTEEHFFSGFPAVWNMVVF LIALNASV+VSTIVI TS ILTF PVNFLHPIRV
Sbjct: 120 YAYTNMKTEEHFFSGFPAVWNMVVFFLIALNASVIVSTIVIATSTILTFAPVNFLHPIRV 179

Query: 185 VRLRPLNFFVFVCWCLLGFYALISNFQVCRWFSFAFSVCGIYLYSIGAILQIFPNLGKKR 244
           VRLRPLN FV  CW  LG YAL+SNFQV  WF F+FS+CGIYLYSIGAILQIFPNLGKKR
Sbjct: 180 VRLRPLNVFVLFCWSSLGVYALLSNFQVPYWFFFSFSLCGIYLYSIGAILQIFPNLGKKR 239

Query: 245 QY 246
            +
Sbjct: 240 NH 241


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218663701|ref|ZP_03519631.1| phosphatidylcholine synthase protein [Rhizobium etli IE4771] Length = 242 Back     alignment and organism information
>gi|86357698|ref|YP_469590.1| phosphatidylcholine synthase protein [Rhizobium etli CFN 42] Length = 242 Back     alignment and organism information
>gi|159184920|ref|NP_354778.2| phosphatidylcholine synthase [Agrobacterium tumefaciens str. C58] Length = 241 Back     alignment and organism information
>gi|325293179|ref|YP_004279043.1| phosphatidylcholine synthase [Agrobacterium sp. H13-3] Length = 250 Back     alignment and organism information
>gi|222085955|ref|YP_002544487.1| phosphatidylcholine synthase protein [Agrobacterium radiobacter K84] Length = 241 Back     alignment and organism information
>gi|209549310|ref|YP_002281227.1| phosphatidylcholine synthase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 242 Back     alignment and organism information
>gi|218671822|ref|ZP_03521491.1| putative transmembrane phosphatidylcholine synthase [Rhizobium etli GR56] Length = 242 Back     alignment and organism information
>gi|190891723|ref|YP_001978265.1| phosphatidylcholine synthase [Rhizobium etli CIAT 652] Length = 242 Back     alignment and organism information
>gi|218516018|ref|ZP_03512858.1| phosphatidylcholine synthase protein [Rhizobium etli 8C-3] Length = 242 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target246 phosphatidylcholine synthase protein [Candidatus Liberi
pfam0106696 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltra 7e-06
COG1183234 COG1183, PssA, Phosphatidylserine synthase [Lipid metab 3e-33
>gnl|CDD|144601 pfam01066, CDP-OH_P_transf, CDP-alcohol phosphatidyltransferase Back     alignment and domain information
>gnl|CDD|31376 COG1183, PssA, Phosphatidylserine synthase [Lipid metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 246 phosphatidylcholine synthase protein [Candidatus Liberi
COG1183234 PssA Phosphatidylserine synthase [Lipid metabolism] 100.0
TIGR00473174 pssA CDP-diacylglycerol--serine O-phosphatidyltransfera 100.0
pfam0106696 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase. Al 99.65
COG0558192 PgsA Phosphatidylglycerophosphate synthase [Lipid metab 99.49
PRK10832182 phosphatidylglycerophosphate synthetase; Provisional 99.27
KOG2877 389 consensus 98.93
PTZ00307 417 ethanolamine phosphotransferase; Provisional 98.81
KOG3240218 consensus 98.58
COG5050 384 EPT1 sn-1,2-diacylglycerol ethanolamine- and cholinepho 98.48
KOG1617243 consensus 98.98
TIGR00560217 pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phospha 98.84
>COG1183 PssA Phosphatidylserine synthase [Lipid metabolism] Back     alignment and domain information
>TIGR00473 pssA CDP-diacylglycerol--serine O-phosphatidyltransferase; InterPro: IPR004533 This enzyme, CDP-diacylglycerol--serine O-phosphatidyltransferase, is involved in phospholipid biosynthesis catalyzing the reaction CDP-diacylglycerol + L-serine = CMP + L-1-phosphatidylserine Back     alignment and domain information
>pfam01066 CDP-OH_P_transf CDP-alcohol phosphatidyltransferase Back     alignment and domain information
>COG0558 PgsA Phosphatidylglycerophosphate synthase [Lipid metabolism] Back     alignment and domain information
>PRK10832 phosphatidylglycerophosphate synthetase; Provisional Back     alignment and domain information
>KOG2877 consensus Back     alignment and domain information
>PTZ00307 ethanolamine phosphotransferase; Provisional Back     alignment and domain information
>KOG3240 consensus Back     alignment and domain information
>COG5050 EPT1 sn-1,2-diacylglycerol ethanolamine- and cholinephosphotranferases [Lipid metabolism] Back     alignment and domain information
>KOG1617 consensus Back     alignment and domain information
>TIGR00560 pgsA CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase; InterPro: IPR004570 CDP-diacylglycerol--glycerol-3-phosphate 3-phosphatidyltransferase (2 Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00