254780842

254780842

2-octaprenyl-6-methoxyphenyl hydroxylase

GeneID in NCBI database:8209854Locus tag:CLIBASIA_03685
Protein GI in NCBI database:254780842Protein Accession:YP_003065255.1
Gene range:+(811269, 812423)Protein Length:384aa
Gene description:2-octaprenyl-6-methoxyphenyl hydroxylase
COG prediction:[H] [C] 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases
KEGG prediction:2-octaprenyl-6-methoxyphenyl hydroxylase; K03185 2-octaprenyl-6-methoxyphenol hydroxylase [EC:1.14.13.-]
SEED prediction:hypothetical protein
Pathway involved in KEGG:Ubiquinone and other terpenoid-quinone biosynthesis [PATH:las00130]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380----
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL
ccEEEEEEEcccHHHHHHHHHHHHcccEEEEEcccccccccccccccHHHHHHHHHcccHHHHHHcccccccEEEEcccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHcccEEEcccEEEEEEEcccEEEEEEccccEEEEEEEEEcccccHHHHHHccccccccccccEEEEEEEEccccccccEEEEEccccEEEEEEccccEEEEEEEEccccHHHHHcccHHHHHHHHHHHccccccccEEccccEEEEEccccccccccccEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcccHHHHHHHHHcccccc
cccEEEEEEcccHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHHHHHHHcccHHHHHHHcccccccEEEEcccccccccEEEEcHHHcccHHcccHHcHHHHHHHHHHHHHHccccEEccHHHHHHHcccccEEEEEccccEEEEEEEEEcccccHHHHHHccccccccccccEEEEEEEcccccccccEEEEEcccccEEEcccccccEEEEEcccHHHHHHHHHccHHHHHHHHHHHHccccccEEEcccccccccHHHHHHHHHcccEEEEccHHHcccHcccccccccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHccccHHHHHHHHHHccccc
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQdiaepvssfrlvditdrlitapdaifhsseigldafgynipnhVLMESFAekisqdpliHCFDALANEIQIGEEEVTILLSTGQQIVGQFligsdgrnssvrrqmgygenkwsypqKALVLNFqhsmphngrcvefhkslgtitqiplreNFSSLVWIMESQeadfyyklpVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSgmishcfgkKRVVLVGEaahalppicgqglnlSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGtdlfnrslfsryplLQILRAGTFHllkrvtplrhQVMRQSLFLRDL
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQfligsdgrnsSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHllkrvtplrhqvmrqslflrdl
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL
*NHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLR**
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL
*NHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL
MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVWDFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQKALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIARRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGTFHLLKRVTPLRHQVMRQSLFLRDL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Li
254780168380 monooxygenase FAD-binding protein [Candidatus Libe 9e-08
254780675481 dihydrolipoamide dehydrogenase [Candidatus Liberib 8e-04
254780283321 thioredoxin reductase (NADPH) protein [Candidatus 0.011
>gi|254780168|ref|YP_003064581.1| monooxygenase FAD-binding protein [Candidatus Liberibacter asiaticus str. psy62] Length = 380 Back     alignment
 Score = 49.7 bits (117), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 83/376 (22%), Positives = 141/376 (37%), Gaps = 35/376 (9%)

Query: 7   IIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGID-FLKEINVWDFLQD 65
           +IIG+G++G   A     +G  + ++  +  L D    + +       LK I + D L+D
Sbjct: 1   MIIGAGISGLTLAASLGHRGIQSCVLEKKDQLSDSGFGIQISPNASRILKRIGILDQLED 60

Query: 66  IAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYN--------IPNHVLMESFAEKI 117
           I         ++  D +  +   +   S      +  N        +  H L +     I
Sbjct: 61  I--------WIEPEDFVFRSGSTLKELSRFSCKNYSRNNWGGIYGVVKRHTLQKILLNHI 112

Query: 118 SQDPLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWS 177
              PL      L     I   + T +     Q     L+G+DG NS++R  +      +S
Sbjct: 113 QTQPLAR----LHLSTHITHPDCTQISKINNQ-KPDLLVGADGLNSNIRHYIDTQPITFS 167

Query: 178 YPQKALVLNFQHSMPH--NGRCVE-FHKSLGTITQIPLRE-NFSSLVWIMESQEADFYYK 233
                  L  Q++ P   + + V  F      +   PLRE N  ++V++           
Sbjct: 168 GDVVLRCLIPQNNAPEFIDFQSVNIFFGPDSHLVTYPLREDNTINMVFVSSKHTLKDISF 227

Query: 234 LPVNEI-----ARRLEQYLYPVIGKIEVVTDVQIFQL-SGMISHCFGKKRVVLVGEAAHA 287
           L  +EI      + L  +   +I  I  + D  ++ L      H   KK  VL+G+AAH 
Sbjct: 228 LKRSEIHKEWFVKHLTNWHQEIIQLILQINDTHLYPLFECECKHWHNKKNAVLIGDAAHT 287

Query: 288 LPPICGQGLNLSMRDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLF 347
           L P   QG N+++ D   L  L   +  +  A  + Y  + R   +KRI      N+ LF
Sbjct: 288 LLPFAAQGANMAIEDAYALSYLLGKK--TIPAAISAYQKV-RAVRVKRIRYRTKLNQLLF 344

Query: 348 SRYPLLQILRAGTFHL 363
             +    + R     L
Sbjct: 345 HMHRPASLFRNAGLRL 360

>gi|254780675|ref|YP_003065088.1| dihydrolipoamide dehydrogenase [Candidatus Liberibacter asiaticus str. psy62] Length = 481 Back     alignment
 Score = 36.2 bits (82), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 18/29 (62%), Positives = 23/29 (79%)

Query: 4  FDVIIIGSGLAGSVAAIGAAKKGFLTALV 32
          +D+I+IGSG AG VAAI AA+ GF  A+V
Sbjct: 5  YDIILIGSGPAGYVAAIRAAQLGFKVAIV 33

>gi|254780283|ref|YP_003064696.1| thioredoxin reductase (NADPH) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 321 Back     alignment
 Score = 32.7 bits (73), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 26/79 (32%), Positives = 37/79 (46%), Gaps = 8/79 (10%)

Query: 5   DVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQD---LRTTMLMGEGIDFLKEINVWD 61
           DVI++G G   +  A+  AK      +V  RS L+    L+  + +   IDFL +  V D
Sbjct: 148 DVIVVGGGNTAAEEALHLAKIARRVTIVHRRSSLRSEKILQEKLFLQSNIDFLFDTEVVD 207

Query: 62  FLQDIAEP-----VSSFRL 75
            +  I EP     VS  RL
Sbjct: 208 VIGSIPEPPLFPSVSGVRL 226

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Li
315122733384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Li 1 1e-158
190891671403 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 1 4e-90
209549239403 2-octaprenyl-6-methoxyphenyl hydroxylase [Rhizobium leg 1 7e-90
15889098402 2-octaprenyl-6-methoxyphenyl hydroxylase [Agrobacterium 1 8e-88
241204555403 2-octaprenyl-6-methoxyphenyl hydroxylase [Rhizobium leg 1 8e-87
116252048403 2-octaprenyl-6-methoxyphenyl hydroxylase [Rhizobium leg 1 1e-86
325293180402 2-octaprenyl-6-methoxyphenol hydroxylase [Agrobacterium 1 2e-86
15965426425 2-octaprenyl-6-methoxyphenyl hydroxylase [Sinorhizobium 1 7e-85
307310600403 Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ 1 7e-85
222085954400 2-octaprenyl-6-methoxyphenol hydroxylase protein [Agrob 1 9e-85
>gi|315122733|ref|YP_004063222.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 384 Back     alignment and organism information
 Score =  563 bits (1450), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 273/384 (71%), Positives = 321/384 (83%)

Query: 1   MNHFDVIIIGSGLAGSVAAIGAAKKGFLTALVSPRSFLQDLRTTMLMGEGIDFLKEINVW 60
           MN FDVIIIG GL G +AA+G+A+KG LTA VSP S  QDLRTTMLM EGI FLK+I VW
Sbjct: 1   MNRFDVIIIGGGLIGFIAALGSARKGLLTAFVSPSSSFQDLRTTMLMNEGIGFLKDIEVW 60

Query: 61  DFLQDIAEPVSSFRLVDITDRLITAPDAIFHSSEIGLDAFGYNIPNHVLMESFAEKISQD 120
           + +Q IAEPVSSF+LVDIT  LI APDA+F S+EIGLDAFGYNIPNH LME   E ISQ+
Sbjct: 61  NSIQHIAEPVSSFKLVDITGYLIKAPDAVFQSTEIGLDAFGYNIPNHALMEVLDEVISQN 120

Query: 121 PLIHCFDALANEIQIGEEEVTILLSTGQQIVGQFLIGSDGRNSSVRRQMGYGENKWSYPQ 180
            LIHCF+A A+++++ E+EV++ LSTG+QI+G+ L+GSDGRNS VRRQMG+ + KWSY Q
Sbjct: 121 SLIHCFNASADKVKVEEKEVSVTLSTGEQIIGRLLVGSDGRNSLVRRQMGFRQKKWSYSQ 180

Query: 181 KALVLNFQHSMPHNGRCVEFHKSLGTITQIPLRENFSSLVWIMESQEADFYYKLPVNEIA 240
           KALVLNF+HS PHNG CVE HK LGT+TQIP+  N SSLVWIMESQEADFY KLP NEI+
Sbjct: 181 KALVLNFKHSKPHNGLCVELHKPLGTVTQIPMGGNCSSLVWIMESQEADFYLKLPWNEIS 240

Query: 241 RRLEQYLYPVIGKIEVVTDVQIFQLSGMISHCFGKKRVVLVGEAAHALPPICGQGLNLSM 300
           RRLEQYL+  +GKIEV+T+VQ F LSGMIS+C GK RVVL+GEAAHALPPICGQGLNLS+
Sbjct: 241 RRLEQYLFSAVGKIEVITEVQGFPLSGMISYCLGKNRVVLIGEAAHALPPICGQGLNLSI 300

Query: 301 RDVIILLNLFQSEHMSFRAIGNRYHAMRRGDIIKRIVGTDLFNRSLFSRYPLLQILRAGT 360
           RD+I+LL+L Q    SF+ IGNR+H++R GD+IKR V TDLFNRSLF  YPLLQILR GT
Sbjct: 301 RDIIVLLDLLQENKSSFQNIGNRFHSIRCGDVIKRTVFTDLFNRSLFVNYPLLQILRTGT 360

Query: 361 FHLLKRVTPLRHQVMRQSLFLRDL 384
           FH+L  + PLR Q+MRQSLFLRDL
Sbjct: 361 FHMLNTIKPLRQQIMRQSLFLRDL 384


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891671|ref|YP_001978213.1| 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase [Rhizobium etli CIAT 652] Length = 403 Back     alignment and organism information
>gi|209549239|ref|YP_002281156.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 403 Back     alignment and organism information
>gi|15889098|ref|NP_354779.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Agrobacterium tumefaciens str. C58] Length = 402 Back     alignment and organism information
>gi|241204555|ref|YP_002975651.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 403 Back     alignment and organism information
>gi|116252048|ref|YP_767886.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Rhizobium leguminosarum bv. viciae 3841] Length = 403 Back     alignment and organism information
>gi|325293180|ref|YP_004279044.1| 2-octaprenyl-6-methoxyphenol hydroxylase [Agrobacterium sp. H13-3] Length = 402 Back     alignment and organism information
>gi|15965426|ref|NP_385779.1| 2-octaprenyl-6-methoxyphenyl hydroxylase [Sinorhizobium meliloti 1021] Length = 425 Back     alignment and organism information
>gi|307310600|ref|ZP_07590247.1| Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family [Sinorhizobium meliloti BL225C] Length = 403 Back     alignment and organism information
>gi|222085954|ref|YP_002544486.1| 2-octaprenyl-6-methoxyphenol hydroxylase protein [Agrobacterium radiobacter K84] Length = 400 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Li
PRK07494388 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydrox 1e-111
TIGR01988385 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxyl 1e-73
TIGR01984382 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxy 1e-46
PRK07364415 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydrox 8e-43
PRK07608388 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase 5e-39
PRK08849384 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4 2e-37
PRK07333403 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydrox 8e-34
PRK05732395 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydrox 5e-33
PRK06617374 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydrox 5e-33
PRK08850405 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydrox 8e-31
PRK08020391 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-ben 2e-29
TIGR01989437 TIGR01989, COQ6, Ubiquinone biosynthesis mono0xygenase 9e-29
PRK08013400 PRK08013, PRK08013, oxidoreductase; Provisional 1e-28
PRK09126392 PRK09126, PRK09126, hypothetical protein; Provisional 7e-25
PRK08773392 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4 8e-24
KOG3855481 KOG3855, KOG3855, KOG3855, Monooxygenase involved in co 2e-18
KOG2614420 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase a 6e-16
PRK05714405 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4 7e-15
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy p 1e-12
COG0654387 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase 2e-59
PRK06753373 PRK06753, PRK06753, hypothetical protein; Provisional 6e-13
PRK07045388 PRK07045, PRK07045, putative monooxygenase; Reviewed 6e-06
PRK06847375 PRK06847, PRK06847, hypothetical protein; Provisional 1e-05
PRK07190 487 PRK07190, PRK07190, hypothetical protein; Provisional 3e-04
KOG1298509 KOG1298, KOG1298, KOG1298, Squalene monooxygenase [Lipi 0.001
PLN02985514 PLN02985, PLN02985, squalene monooxygenase 0.001
PRK06996398 PRK06996, PRK06996, hypothetical protein; Provisional 3e-12
pfam01494349 pfam01494, FAD_binding_3, FAD binding domain 7e-09
PLN02927 668 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin 1e-05
COG1249454 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase com 4e-06
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehy 4e-06
PRK06370463 PRK06370, PRK06370, mercuric reductase; Validated 9e-06
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 1e-05
PRK05249461 PRK05249, PRK05249, soluble pyridine nucleotide transhy 2e-05
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subun 3e-05
PRK06416462 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Rev 3e-05
PRK06327475 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Val 3e-05
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase subun 3e-05
pfam01134391 pfam01134, GIDA, Glucose inhibited division protein A 6e-05
TIGR01350461 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase 6e-05
COG1053 562 COG1053, SdhA, Succinate dehydrogenase/fumarate reducta 8e-05
PRK06292460 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Val 1e-04
KOG1335506 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogena 2e-04
pfam07992277 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide 2e-04
TIGR01812 566 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or f 2e-04
PRK07818466 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Rev 2e-04
PRK05192 618 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminome 2e-04
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, large sub 7e-04
PRK06467471 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Rev 7e-04
PRK07843 557 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase 7e-04
TIGR03378419 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydr 9e-04
COG0445 621 COG0445, GidA, NAD/FAD-utilizing enzyme apparently invo 0.002
PRK08626 657 PRK08626, PRK08626, fumarate reductase flavoprotein sub 0.002
COG2081408 COG2081, COG2081, Predicted flavoproteins [General func 0.003
PRK07803 626 PRK07803, sdhA, succinate dehydrogenase flavoprotein su 0.003
PRK12834 549 PRK12834, PRK12834, putative FAD-binding dehydrogenase; 0.003
COG0492305 COG0492, TrxB, Thioredoxin reductase [Posttranslational 0.004
PRK06184 502 PRK06184, PRK06184, hypothetical protein; Provisional 4e-06
PRK06183 538 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxyla 2e-04
PRK06834 488 PRK06834, PRK06834, hypothetical protein; Provisional 4e-04
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase family 8e-04
PRK08163396 PRK08163, PRK08163, salicylate hydroxylase; Provisional 0.001
COG3075421 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydroge 0.002
>gnl|CDD|181001 PRK07494, PRK07494, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|162642 TIGR01988, Ubi-OHases, Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>gnl|CDD|162640 TIGR01984, UbiH, 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>gnl|CDD|180946 PRK07364, PRK07364, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181057 PRK07608, PRK07608, ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>gnl|CDD|181564 PRK08849, PRK08849, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|180935 PRK07333, PRK07333, 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|180227 PRK05732, PRK05732, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|168629 PRK06617, PRK06617, 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181565 PRK08850, PRK08850, 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|181199 PRK08020, ubiF, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>gnl|CDD|162643 TIGR01989, COQ6, Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>gnl|CDD|181197 PRK08013, PRK08013, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181663 PRK09126, PRK09126, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|181552 PRK08773, PRK08773, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|39059 KOG3855, KOG3855, KOG3855, Monooxygenase involved in coenzyme Q (ubiquinone) biosynthesis [Coenzyme transport and metabolism, Energy production and conversion] Back     alignment and domain information
>gnl|CDD|37825 KOG2614, KOG2614, KOG2614, Kynurenine 3-monooxygenase and related flavoprotein monooxygenases [Energy production and conversion, General function prediction only] Back     alignment and domain information
>gnl|CDD|168201 PRK05714, PRK05714, 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|30989 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|30999 COG0654, UbiH, 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|168661 PRK06753, PRK06753, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|136171 PRK07045, PRK07045, putative monooxygenase; Reviewed Back     alignment and domain information
>gnl|CDD|180727 PRK06847, PRK06847, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180870 PRK07190, PRK07190, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|36512 KOG1298, KOG1298, KOG1298, Squalene monooxygenase [Lipid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178566 PLN02985, PLN02985, squalene monooxygenase Back     alignment and domain information
>gnl|CDD|180788 PRK06996, PRK06996, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|144912 pfam01494, FAD_binding_3, FAD binding domain Back     alignment and domain information
>gnl|CDD|178515 PLN02927, PLN02927, antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>gnl|CDD|31441 COG1249, Lpd, Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180019 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|180546 PRK06370, PRK06370, mercuric reductase; Validated Back     alignment and domain information
>gnl|CDD|144475 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|179973 PRK05249, PRK05249, soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|163151 TIGR03140, AhpF, alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>gnl|CDD|180558 PRK06416, PRK06416, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|180529 PRK06327, PRK06327, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185217 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|144651 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|162312 TIGR01350, lipoamide_DH, dihydrolipoamide dehydrogenase Back     alignment and domain information
>gnl|CDD|31253 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180516 PRK06292, PRK06292, dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|36549 KOG1335, KOG1335, KOG1335, Dihydrolipoamide dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|149204 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|162542 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>gnl|CDD|181132 PRK07818, PRK07818, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|179960 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>gnl|CDD|33432 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180579 PRK06467, PRK06467, dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|181140 PRK07843, PRK07843, 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|132421 TIGR03378, glycerol3P_GlpB, glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>gnl|CDD|30794 COG0445, GidA, NAD/FAD-utilizing enzyme apparently involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|181507 PRK08626, PRK08626, fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|32264 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183782 PRK12834, PRK12834, putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|30838 COG0492, TrxB, Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|180450 PRK06184, PRK06184, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180449 PRK06183, mhpA, 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>gnl|CDD|180718 PRK06834, PRK06834, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|162668 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|181262 PRK08163, PRK08163, salicylate hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|32889 COG3075, GlpB, Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 384 2-octaprenyl-6-methoxyphenyl hydroxylase [Candidatus Li
TIGR01988445 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/Ub 100.0
PRK07494386 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 100.0
PRK08013400 hypothetical protein; Provisional 100.0
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 100.0
PRK08948392 consensus 100.0
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 100.0
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 100.0
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 100.0
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional 100.0
TIGR01984425 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterP 100.0
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validated 100.0
PRK08774402 consensus 100.0
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxy 100.0
PRK09126392 hypothetical protein; Provisional 100.0
PRK07608389 hypothetical protein; Provisional 100.0
PRK07364413 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 100.0
PRK06996397 hypothetical protein; Provisional 100.0
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated 100.0
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and relat 100.0
TIGR01989481 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterP 100.0
PRK07045388 putative monooxygenase; Reviewed 100.0
PRK06183 554 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validat 100.0
PRK07588391 hypothetical protein; Provisional 100.0
PRK06753373 hypothetical protein; Provisional 100.0
PRK06185409 hypothetical protein; Provisional 100.0
PRK08244 494 hypothetical protein; Provisional 100.0
PRK08163396 salicylate hydroxylase; Provisional 100.0
PRK06475400 salicylate hydroxylase; Provisional 100.0
PRK06834 488 hypothetical protein; Provisional 100.0
PRK08132 549 hypothetical protein; Provisional 100.0
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Members of 100.0
KOG3855481 consensus 100.0
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 100.0
KOG2614420 consensus 100.0
TIGR02360393 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; Inter 100.0
KOG1298509 consensus 99.95
PRK06184 503 hypothetical protein; Provisional 100.0
PRK06847375 hypothetical protein; Provisional 100.0
PRK07190480 hypothetical protein; Provisional 100.0
PRK06126 545 hypothetical protein; Provisional 100.0
pfam01494349 FAD_binding_3 FAD binding domain. This domain is involv 100.0
PRK08294 634 phenol 2-monooxygenase; Provisional 100.0
PRK05868372 hypothetical protein; Validated 100.0
PRK07538413 hypothetical protein; Provisional 100.0
PRK07236386 hypothetical protein; Provisional 100.0
PRK08255 770 salicylyl-CoA 5-hydroxylase; Reviewed 100.0
PRK11445348 putative oxidoreductase; Provisional 99.96
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy production 99.96
PRK10157428 putative oxidoreductase FixC; Provisional 99.95
PRK10015429 hypothetical protein; Provisional 99.94
TIGR02023408 BchP-ChlP geranylgeranyl reductase; InterPro: IPR010253 99.93
TIGR02028401 ChlP geranylgeranyl reductase; InterPro: IPR011774 This 99.85
pfam04820457 Trp_halogenase Tryptophan halogenase. Tryptophan haloge 99.77
TIGR01789392 lycopene_cycl lycopene cyclase; InterPro: IPR008461 Thi 99.04
TIGR01377401 soxA_mon sarcosine oxidase, monomeric form; InterPro: I 98.62
TIGR01320487 mal_quin_oxido malate:quinone-oxidoreductase; InterPro: 97.55
TIGR02032343 GG-red-SF geranylgeranyl reductase family; InterPro: IP 99.94
pfam05834374 Lycopene_cycl Lycopene cyclase protein. This family con 99.82
TIGR01790419 carotene-cycl lycopene cyclase family protein; InterPro 99.64
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [Amino 99.01
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [General fun 98.78
KOG2853509 consensus 98.21
pfam08491276 SE Squalene epoxidase. This domain is found in squalene 99.59
PRK12409410 D-amino acid dehydrogenase small subunit; Provisional 99.47
PRK00711416 D-amino acid dehydrogenase small subunit; Validated 99.3
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine 98.09
TIGR02730506 carot_isom carotene isomerase; InterPro: IPR014101 Memb 97.44
PRK11728400 hypothetical protein; Provisional 99.4
COG2081408 Predicted flavoproteins [General function prediction on 99.38
PRK11259377 solA N-methyltryptophan oxidase; Provisional 99.32
COG0579429 Predicted dehydrogenase [General function prediction on 99.31
pfam03486405 HI0933_like HI0933-like protein. 99.29
pfam01266309 DAO FAD dependent oxidoreductase. This family includes 99.26
PRK01747660 mnmC 5-methylaminomethyl-2-thiouridine methyltransferas 99.25
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 99.11
PRK10262321 thioredoxin reductase; Provisional 99.08
KOG2415 621 consensus 98.98
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 98.97
pfam01946229 Thi4 Thi4 family. This family includes a putative thiam 98.97
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreductase. T 98.95
PRK07233430 hypothetical protein; Provisional 98.92
TIGR01292321 TRX_reduct thioredoxin-disulfide reductase; InterPro: I 98.91
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRP 98.87
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.86
COG2072443 TrkA Predicted flavoprotein involved in K+ transport [I 98.85
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 98.83
pfam00743 532 FMO-like Flavin-binding monooxygenase-like. This family 98.82
PRK05192 621 tRNA uridine 5-carboxymethylaminomethyl modification en 98.81
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy product 98.79
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR03364. T 98.77
KOG2820399 consensus 98.77
PRK11101 545 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; P 98.74
pfam01134391 GIDA Glucose inhibited division protein A. 98.72
KOG1399448 consensus 98.68
PRK06481506 fumarate reductase flavoprotein subunit; Validated 98.67
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.65
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.64
PRK06452 566 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.63
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 98.63
PRK06175433 L-aspartate oxidase; Provisional 98.63
PRK08274456 tricarballylate dehydrogenase; Validated 98.6
PRK06069 582 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.59
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.57
PRK07395 556 L-aspartate oxidase; Provisional 98.51
PRK08275 554 putative oxidoreductase; Provisional 98.49
PRK06263 539 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.43
TIGR01812 636 sdhA_frdA_Gneg succinate dehydrogenase or fumarate redu 98.39
COG0029 518 NadB Aspartate oxidase [Coenzyme metabolism] 98.37
TIGR01372 1026 soxA sarcosine oxidase, alpha subunit family; InterPro: 98.37
PRK08401464 L-aspartate oxidase; Provisional 98.33
TIGR01816 615 sdhA_forward succinate dehydrogenase, flavoprotein subu 98.32
pfam06039489 Mqo Malate:quinone oxidoreductase (Mqo). This family co 98.32
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethylamino 98.3
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.25
TIGR01813487 flavo_cyto_c flavocytochrome c; InterPro: IPR010960 Thi 98.16
PRK07512507 L-aspartate oxidase; Provisional 98.15
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of this 98.15
TIGR01373407 soxB sarcosine oxidase, beta subunit family; InterPro: 98.14
TIGR02485467 CobZ_N-term precorrin 3B synthase CobZ; InterPro: IPR01 98.14
TIGR02374 813 nitri_red_nirB nitrite reductase [NAD(P)H], large subun 98.13
PRK05257499 malate:quinone oxidoreductase; Validated 98.12
TIGR00551 546 nadB L-aspartate oxidase; InterPro: IPR005288 L-asparta 98.08
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.06
PRK09897 535 hypothetical protein; Provisional 98.06
PRK07846453 mycothione/glutathione reductase; Reviewed 98.04
PTZ00052541 thioredoxin reductase; Provisional 98.02
PRK05976464 dihydrolipoamide dehydrogenase; Validated 98.02
KOG2665453 consensus 98.01
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 97.97
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihy 97.97
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 97.91
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.85
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 97.83
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.77
PRK09564 443 coenzyme A disulfide reductase; Reviewed 97.76
PRK06370459 mercuric reductase; Validated 97.71
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 97.7
pfam0007082 Pyr_redox Pyridine nucleotide-disulphide oxidoreductase 97.69
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 97.65
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit [Post 97.62
COG4529474 Uncharacterized protein conserved in bacteria [Function 97.61
PRK04965378 nitric oxide reductase; Provisional 97.55
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 97.53
KOG3923342 consensus 97.42
KOG2311 679 consensus 97.37
KOG2852380 consensus 97.31
TIGR01421475 gluta_reduc_1 glutathione-disulfide reductase; InterPro 97.24
KOG2844 856 consensus 97.2
PRK13512438 coenzyme A disulfide reductase; Provisional 97.16
TIGR01176 585 fum_red_Fp fumarate reductase, flavoprotein subunit; In 96.92
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary metabo 96.79
KOG3851446 consensus 96.6
KOG2404477 consensus 96.56
KOG0404322 consensus 96.5
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 96.38
PRK06116450 glutathione reductase; Validated 96.17
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 96.01
KOG1346 659 consensus 94.99
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 94.84
KOG0405478 consensus 94.27
PRK11883452 protoporphyrinogen oxidase; Reviewed 99.22
TIGR03467430 HpnE squalene-associated FAD-dependent desaturase. The 98.99
PRK12416466 protoporphyrinogen oxidase; Provisional 98.95
TIGR02733499 desat_CrtD C-3',4' desaturase CrtD; InterPro: IPR014104 98.7
PTZ00139 622 succinate dehydrogenase (flavoprotein) subunit; Provisi 98.7
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.69
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.68
TIGR01350481 lipoamide_DH dihydrolipoamide dehydrogenase; InterPro: 98.63
PRK07121491 hypothetical protein; Validated 98.6
PRK08626 657 fumarate reductase flavoprotein subunit; Provisional 98.59
PTZ00052 541 thioredoxin reductase; Provisional 98.59
PRK12842 567 putative succinate dehydrogenase; Reviewed 98.57
PRK07803 631 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.55
pfam00890401 FAD_binding_2 FAD binding domain. This family includes 98.53
PRK09077 535 L-aspartate oxidase; Provisional 98.5
PRK09754400 phenylpropionate dioxygenase ferredoxin reductase subun 98.48
PRK12844 552 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.44
PRK12845 566 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.42
PRK06134 579 putative FAD-binding dehydrogenase; Reviewed 98.41
PRK12843 576 putative FAD-binding dehydrogenase; Reviewed 98.37
PRK07208474 hypothetical protein; Provisional 98.35
PRK11749460 putative oxidoreductase; Provisional 98.31
PRK12810472 gltD glutamate synthase subunit beta; Reviewed 98.3
PRK12831464 putative oxidoreductase; Provisional 98.29
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 98.28
PRK12814652 putative NADPH-dependent glutamate synthase small subun 98.27
PRK13984604 putative oxidoreductase; Provisional 98.26
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 98.25
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 98.24
PRK12837 515 3-ketosteroid-delta-1-dehydrogenase; Provisional 98.23
TIGR02734 526 crtI_fam phytoene desaturase; InterPro: IPR014105 Phyto 98.23
PRK12839 574 hypothetical protein; Provisional 98.23
PRK09853 1032 putative selenate reductase subunit YgfK; Provisional 98.21
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 98.21
PRK12778760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 98.19
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amin 98.18
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, ana 98.18
TIGR00031390 UDP-GALP_mutase UDP-galactopyranose mutase; InterPro: I 98.16
PRK12770350 putative glutamate synthase subunit beta; Provisional 98.13
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] 98.11
PRK07843 560 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.1
TIGR01318480 gltD_gamma_fam glutamate synthase, small subunit; Inter 98.09
PRK13512438 coenzyme A disulfide reductase; Provisional 98.08
TIGR01316462 gltA glutamate synthase (NADPH), homotetrameric; InterP 98.08
KOG1335506 consensus 98.02
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 97.99
PRK12835 584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 97.99
PRK13800 894 putative oxidoreductase/HEAT repeat-containing protein; 97.98
PRK12775 993 putative trifunctional 2-polyprenylphenol hydroxylase/g 97.95
PRK12779 944 putative bifunctional glutamate synthase subunit beta/2 97.93
PTZ00153 673 lipoamide dehydrogenase; Provisional 97.9
PRK07804 533 L-aspartate oxidase; Provisional 97.9
COG3349485 Uncharacterized conserved protein [Function unknown] 97.86
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biogenesi 97.84
COG1053 562 SdhA Succinate dehydrogenase/fumarate reductase, flavop 97.8
PRK06854 610 adenylylsulfate reductase; Validated 97.78
PRK08071 510 L-aspartate oxidase; Provisional 97.76
COG1148 622 HdrA Heterodisulfide reductase, subunit A and related p 97.7
COG3573 552 Predicted oxidoreductase [General function prediction o 97.42
COG0493457 GltD NADPH-dependent glutamate synthase beta chain and 97.34
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 97.27
COG2907447 Predicted NAD/FAD-binding protein [General function pre 97.06
KOG0042 680 consensus 97.05
KOG1800468 consensus 97.0
KOG1238 623 consensus 96.95
KOG03992142 consensus 96.93
PRK09496455 trkA potassium transporter peripheral membrane componen 96.84
PTZ00188506 adrenodoxin reductase; Provisional 96.82
pfam00996439 GDI GDP dissociation inhibitor. 96.71
COG0569225 TrkA K+ transport systems, NAD-binding component [Inorg 96.61
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase; InterPro: IPR0 96.55
TIGR02731454 phytoene_desat phytoene desaturase; InterPro: IPR014102 96.28
TIGR02061 651 aprA adenylylsulfate reductase, alpha subunit; InterPro 96.27
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.26
KOG2960328 consensus 95.5
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.24
COG5044434 MRS6 RAB proteins geranylgeranyltransferase component A 95.19
pfam02254115 TrkA_N TrkA-N domain. This domain is found in a wide va 95.05
TIGR02053 494 MerA mercuric reductase; InterPro: IPR011796 This entry 94.91
KOG4405 547 consensus 94.1
COG0771448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Ce 94.07
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 94.04
PRK07502307 cyclohexadienyl dehydrogenase; Validated 93.76
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-lactate 93.74
KOG2018430 consensus 93.64
PTZ00117313 malate dehydrogenase; Provisional 93.45
KOG1439440 consensus 93.16
PRK08507275 prephenate dehydrogenase; Validated 92.69
PRK00421459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 92.11
KOG2755334 consensus 91.61
PRK06545357 prephenate dehydrogenase; Validated 90.22
PRK13369503 glycerol-3-phosphate dehydrogenase; Provisional 99.17
PRK12266503 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.09
PRK05249465 soluble pyridine nucleotide transhydrogenase; Provision 99.16
pfam01593444 Amino_oxidase Flavin containing amine oxidoreductase. T 98.69
COG1233487 Phytoene dehydrogenase and related proteins [Secondary 98.61
PRK04965378 nitric oxide reductase; Provisional 98.45
PRK09564443 coenzyme A disulfide reductase; Reviewed 98.13
PRK07845467 flavoprotein disulfide reductase; Reviewed 98.11
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.09
PRK13748561 putative mercuric reductase; Provisional 97.89
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.76
COG2509486 Uncharacterized FAD-dependent dehydrogenases [General f 97.69
TIGR02053494 MerA mercuric reductase; InterPro: IPR011796 This entry 97.24
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production and c 96.48
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [Energy 96.08
TIGR03377 516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, ana 95.48
TIGR01424478 gluta_reduc_2 glutathione-disulfide reductase; InterPro 94.1
PTZ00318 514 NADH dehydrogenase; Provisional 93.31
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; Revi 92.73
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductase F s 99.07
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.0
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Provision 98.95
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Provision 98.92
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.86
PRK06116450 glutathione reductase; Validated 98.85
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.83
PRK07818467 dihydrolipoamide dehydrogenase; Reviewed 98.78
PRK05976464 dihydrolipoamide dehydrogenase; Validated 98.77
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.75
PRK06370459 mercuric reductase; Validated 98.73
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 98.72
PRK07845467 flavoprotein disulfide reductase; Reviewed 98.57
PRK07573 638 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.57
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.56
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a gluta 98.51
PRK13748561 putative mercuric reductase; Provisional 98.5
TIGR01317517 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small sub 98.48
PRK05329425 anaerobic glycerol-3-phosphate dehydrogenase subunit B; 98.4
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; Revi 98.38
PRK07846453 mycothione/glutathione reductase; Reviewed 98.34
KOG0029 501 consensus 98.25
PRK12834 549 putative FAD-binding dehydrogenase; Reviewed 98.14
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.1
PRK02106 555 choline dehydrogenase; Validated 98.05
COG1231450 Monoamine oxidase [Amino acid transport and metabolism] 97.86
COG2303 542 BetA Choline dehydrogenase and related flavoproteins [A 97.67
TIGR01438 513 TGR thioredoxin and glutathione reductase; InterPro: IP 97.46
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases 97.4
PRK06467472 dihydrolipoamide dehydrogenase; Reviewed 97.24
KOG0685498 consensus 96.85
KOG4254 561 consensus 96.42
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 96.4
PRK01438481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.24
KOG1336478 consensus 96.2
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.17
PRK06522307 2-dehydropantoate 2-reductase; Reviewed 96.16
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 96.1
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.06
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 96.04
PTZ00318 514 NADH dehydrogenase; Provisional 96.04
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 95.96
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 95.94
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.93
PRK08229341 2-dehydropantoate 2-reductase; Provisional 95.88
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.85
PRK01710458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.84
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.83
PRK09117282 consensus 95.8
TIGR01811 620 sdhA_Bsu succinate dehydrogenase or fumarate reductase, 95.74
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.71
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.69
PRK05708305 2-dehydropantoate 2-reductase; Provisional 95.61
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 95.54
PRK12921306 2-dehydropantoate 2-reductase; Provisional 95.42
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.27
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 95.26
COG1004414 Ugd Predicted UDP-glucose 6-dehydrogenase [Cell envelop 95.21
PRK02472450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.21
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 95.18
PRK07417280 arogenate dehydrogenase; Reviewed 95.18
PRK07660283 consensus 95.14
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 94.94
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.84
PRK06249313 2-dehydropantoate 2-reductase; Provisional 94.75
PRK03806438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.73
KOG4716 503 consensus 94.61
PRK03803448 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.59
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.51
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.4
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 94.34
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductase F s 94.26
PRK01390457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.2
PRK13977 577 myosin-cross-reactive antigen; Provisional 94.15
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.11
PRK06567 1048 putative bifunctional glutamate synthase subunit beta/2 94.11
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.01
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 93.72
PRK03815401 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.7
COG1893307 ApbA Ketopantoate reductase [Coenzyme metabolism] 93.63
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 93.59
PRK06223312 malate dehydrogenase; Reviewed 93.58
cd01337310 MDH_glyoxysomal_mitochondrial Glyoxysomal and mitochond 93.48
TIGR00745332 apbA_panE 2-dehydropantoate 2-reductase; InterPro: IPR0 93.44
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-lactate 93.18
pfam00056142 Ldh_1_N lactate/malate dehydrogenase, NAD binding domai 93.07
TIGR01763308 MalateDH_bact malate dehydrogenase, NAD-dependent; Inte 93.04
pfam06100 500 Strep_67kDa_ant Streptococcal 67 kDa myosin-cross-react 92.99
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like structu 92.95
TIGR00136 630 gidA glucose-inhibited division protein A; InterPro: IP 92.69
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 92.53
PRK01368450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.42
PTZ00325313 malate dehydrogenase; Provisional 92.41
pfam00743532 FMO-like Flavin-binding monooxygenase-like. This family 92.31
PRK05562222 precorrin-2 dehydrogenase; Provisional 92.14
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 91.8
TIGR01810 540 betA choline dehydrogenase; InterPro: IPR011533 Choline 91.45
PRK09288395 purT phosphoribosylglycinamide formyltransferase 2; Val 91.38
PRK12475337 thiamine/molybdopterin biosynthesis MoeB-like protein; 91.29
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 91.15
PRK09424510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 91.0
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like prot 90.98
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 90.94
pfam00899134 ThiF ThiF family. This family contains a repeated domai 90.87
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 90.79
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily of act 90.78
PRK05086312 malate dehydrogenase; Provisional 90.67
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate dehydr 90.5
PTZ00082322 L-lactate dehydrogenase; Provisional 90.34
KOG2304298 consensus 90.31
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 90.3
PRK10675338 UDP-galactose-4-epimerase; Provisional 90.26
TIGR02279 508 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC; I 90.19
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 90.13
TIGR02352357 thiamin_ThiO glycine oxidase ThiO; InterPro: IPR012727 99.07
TIGR00292283 TIGR00292 thiazole biosynthesis enzyme; InterPro: IPR00 98.72
PRK05335434 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 98.07
TIGR00137444 gid gid protein; InterPro: IPR004417 The gid proteins a 97.53
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in tran 96.55
KOG1276491 consensus 97.71
PTZ00153673 lipoamide dehydrogenase; Provisional 96.71
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreduct 96.34
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. This enz 93.46
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 92.79
PRK10262321 thioredoxin reductase; Provisional 91.58
COG0492305 TrxB Thioredoxin reductase [Posttranslational modificat 91.07
pfam07992277 Pyr_redox_2 Pyridine nucleotide-disulphide oxidoreducta 95.06
PRK10669558 putative cation:proton antiport protein; Provisional 91.55
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 91.51
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family; InterPro: IPR010971 This entry represents a family of FAD-dependent hydroxylases (monooxygenases) which are all believed to act in the aerobic ubiquinone biosynthesis pathway Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08013 hypothetical protein; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08948 consensus Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase; InterPro: IPR011295 This entry represents the FAD-dependent monooxygenase responsible for the second hydroxylation step in the aerobic ubiquinone biosynthetic pathway Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08774 consensus Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK07608 hypothetical protein; Provisional Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6; InterPro: IPR000689 Ubiquinone (Q) functions as an electron carrier in the respiratory chain in mitochondria Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>KOG3855 consensus Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>KOG2614 consensus Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase; InterPro: IPR012733 4-hydroxybenzoate 3-monooxygenase is a flavoprotein that converts its substrate to 3,4-dihydroxybenzoate, which subsequently enters the beta-ketioadipate pathway of aromatic degradation, using molecular oxygen and NADPH as shown below Back     alignment and domain information
>KOG1298 consensus Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>pfam01494 FAD_binding_3 FAD binding domain Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information