254780844

254780844

hypothetical protein CLIBASIA_03695

GeneID in NCBI database:8209857Locus tag:CLIBASIA_03695
Protein GI in NCBI database:254780844Protein Accession:YP_003065257.1
Gene range:-(814527, 814868)Protein Length:113aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNyes
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110---
MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHcccccHHHHHHHHHHHHHHcccHHHccccccccccHHHccccccHHHHHHHHHcccccccHHHccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccEEEHEccccccccccccHHHEEEEEcccccccccccccccccccccccccccccHHHHHHccccccccEEEcc
MFLRSACRNLLVCILSIQCLVLFCSEIFafekykapsypttvalnvlsplaplgdgceqlvgatvhsegkkrshdvpsssnqedqrgspspkktknilelfplplpptqyysf
MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGATVHSegkkrshdvpsssnqedqrgspspkktknilelfplplpptqyysf
MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF
******CRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPL********************************************LELFPLPLPP******
MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGAT****************************KTKNILELFPLPLPPTQYYSF
MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGATVH************************PKKTKNILELFPLPLPPTQYYSF
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
MFLRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVGATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYYSF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target113 hypothetical protein CLIBASIA_03695 [Candidatus Liberib
315122731105 hypothetical protein CKC_04915 [Candidatus Liberibacter 1 0.002
>gi|315122731|ref|YP_004063220.1| hypothetical protein CKC_04915 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 105 Back     alignment and organism information
 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 7/109 (6%)

Query: 3   LRSACRNLLVCILSIQCLVLFCSEIFAFEKYKAPSYPTTVALNVLSPLAPLGDGCEQLVG 62
           +R   + ++ C+L +Q    FCS   A + ++  S   T+         PL     Q   
Sbjct: 1   MRFVHKKMIFCVLILQYWAAFCSYSIALQTHEIASESATIGEENF----PLERADGQKEK 56

Query: 63  ATVHSEGKKRSHDVPSSSNQEDQRGSPSPKKTKNILELFPLPLPPTQYY 111
            +  S+    + ++   SN++D +    PK T++IL+ FPLP PP +YY
Sbjct: 57  PSYQSKKDVINKNILVLSNKKDLK---KPKNTESILDTFPLPPPPAKYY 102


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00