254780843

254780843

glucose/galactose transporter

GeneID in NCBI database:8209855Locus tag:CLIBASIA_03690
Protein GI in NCBI database:254780843Protein Accession:YP_003065256.1
Gene range:-(812428, 813690)Protein Length:420aa
Gene description:glucose/galactose transporter
COG prediction:[G] Fucose permease
KEGG prediction:glucose/galactose transporter; K02429 MFS transporter, FHS family, L-fucose permease
SEED prediction:glucose/galactose transporter
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM12 TM-Helix
TOPPRED12 TM-Helix
HMMTOP12 TM-Helix
MEMSAT8 TM-Helix
MEMSAT_SVM12 TM-Helix
PHOBIUS12 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420
MKDTIARNIQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFEQNTP
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccc
cccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHccccccHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccc
MKDTIARNIQCTKIYIFILFFLFggitslnsilvpklqnsFSLTYLQAMLVEAIFFSCyfffsipagmfiqRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPfisllgdpntavSRLTFAQFFNSLGTAIFPYIGSVLMlgnlaspntsMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQrnsfadhkrnhISFLKtldilanprftMGAVCIFLYVGAEVAIGSIMANYLMRHDtlhldgisagQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASasledqasggsgiicttisggviiplgvGYLVDIASLRDAMFVPAVCYIIIAIYGIYCcykennfeqntp
mkdtiarniQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFEQNTP
MKDTIARNIQCTKiyifilfflfggiTSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQAsggsgiicttisggviiPLGVGYLVDIASLRDAMFVPAVcyiiiaiygiyccyKENNFEQNTP
***********TKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCW**********************LANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCC***********
MKDTIARNIQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFEQNTP
****IARNIQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFE****
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxx
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiHHHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKDTIARNIQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFEQNTP
MKDTIARNIQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFEQNTP
MKDTIARNIQCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMFIQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISLLGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADTMKDYQTDTARVISQMYLVLAIILFLATWLCWMQRNSFADHKRNHISFLKTLDILANPRFTMGAVCIFLYVGAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCAFATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTTISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYCCYKENNFEQNTP

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target420 glucose/galactose transporter [Candidatus Liberibacter
226942575429 glucose/galactose transporter protein [Azotobacter vine 1 1e-107
315122732309 glucose/galactose transporter [Candidatus Liberibacter 1 1e-107
254419961441 glucose/galactose transporter WARNING subfamily [Brevun 1 1e-106
182680194428 glucose/galactose transporter [Beijerinckia indica subs 1 1e-103
302384036428 glucose/galactose transporter [Brevundimonas subvibrioi 1 1e-102
326387605445 glucose/galactose transporter [Novosphingobium nitrogen 1 6e-94
326385929476 glucose/galactose transporter [Novosphingobium nitrogen 1 1e-91
103486881431 glucose/galactose transporter [Sphingopyxis alaskensis 1 3e-90
307293929433 glucose/galactose transporter [Sphingobium chlorophenol 1 1e-87
149185767473 glucose/galactose transporter [Erythrobacter sp. SD-21] 1 7e-81
>gi|226942575|ref|YP_002797648.1| glucose/galactose transporter protein [Azotobacter vinelandii DJ] Length = 429 Back     alignment and organism information
 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 207/401 (51%), Positives = 269/401 (67%), Gaps = 2/401 (0%)

Query: 10  QCTKIYIFILFFLFGGITSLNSILVPKLQNSFSLTYLQAMLVEAIFFSCYFFFSIPAGMF 69
           Q   +Y+F LFF+FGG+TSLN +LVPKL++ FSL+Y +AMLV++ FF  YF  SIPAG+ 
Sbjct: 22  QRLSLYVFALFFIFGGLTSLNDVLVPKLKDLFSLSYTEAMLVQSAFFFAYFVASIPAGLL 81

Query: 70  IQRYGYIKGICTGLLIMSLGCILFTATIEITTFKVFLIALCILAIGVVIIQVALNPFISL 129
           I R GY+K    GLL M+ GC++F      T F  FL AL ILA+GV  +QV  NP +SL
Sbjct: 82  ISRIGYMKAAVVGLLTMAAGCLMFIPATLSTLFPAFLGALFILAVGVTTVQVVANPLLSL 141

Query: 130 LGDPNTAVSRLTFAQFFNSLGTAIFPYIGSVLMLGNLASPNTSMLADT-MKDYQTDTARV 188
           LG  +TA SRLT  Q FNSLGT + PYIG++L+LG L   + S L+   +  +    A V
Sbjct: 142 LGPGSTAHSRLTLGQGFNSLGTTVAPYIGAILILGALNEVDPSTLSGAELSAFLAHEASV 201

Query: 189 ISQMYLVLAIILFLATWLCWMQRNSFADHKR-NHISFLKTLDILANPRFTMGAVCIFLYV 247
           IS  Y+ +A+I+ L   + W+QRN+    KR   ++    LD+L  PRF  GA CIFLYV
Sbjct: 202 ISNTYVGIALIICLIAAIVWLQRNALKSSKRPERLNPFSALDLLKQPRFAFGAACIFLYV 261

Query: 248 GAEVAIGSIMANYLMRHDTLHLDGISAGQHTAIYWGSAMIGRFIGTWILSRFSAEKTLCA 307
           GAEVAIGS++ +YLM   TLHL    AG+H A YWG AM+GRF+G  ++ R++  K L  
Sbjct: 262 GAEVAIGSLLTDYLMLPTTLHLVAEEAGKHVAFYWGGAMVGRFVGAALMRRYAPGKLLAF 321

Query: 308 FATTACSLVILSSYTTGFISGWSLIAVGLFNSIMFPTIFSLASASLEDQASGGSGIICTT 367
            A TA  L+ LSS +TG ISGWSL+AVGLFNSIMFPTIFSLAS  L ++A+ GSG+IC  
Sbjct: 322 AAGTAIVLISLSSLSTGSISGWSLLAVGLFNSIMFPTIFSLASEGLGERAAEGSGLICCA 381

Query: 368 ISGGVIIPLGVGYLVDIASLRDAMFVPAVCYIIIAIYGIYC 408
           I GG I+P   G+  D+++L  A+ VPA+CY  IA YG Y 
Sbjct: 382 IVGGAIVPPLTGFAADLSTLSLALAVPAICYAGIASYGWYA 422


Species: Azotobacter vinelandii
Genus: Azotobacter
Family: Pseudomonadaceae
Order: Pseudomonadales
Class: Gammaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|315122732|ref|YP_004063221.1| glucose/galactose transporter [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 309 Back     alignment and organism information
>gi|254419961|ref|ZP_05033685.1| glucose/galactose transporter WARNING subfamily [Brevundimonas sp. BAL3] Length = 441 Back     alignment and organism information
>gi|182680194|ref|YP_001834340.1| glucose/galactose transporter [Beijerinckia indica subsp. indica ATCC 9039] Length = 428 Back     alignment and organism information
>gi|302384036|ref|YP_003819859.1| glucose/galactose transporter [Brevundimonas subvibrioides ATCC 15264] Length = 428 Back     alignment and organism information
>gi|326387605|ref|ZP_08209211.1| glucose/galactose transporter [Novosphingobium nitrogenifigens DSM 19370] Length = 445 Back     alignment and organism information
>gi|326385929|ref|ZP_08207554.1| glucose/galactose transporter [Novosphingobium nitrogenifigens DSM 19370] Length = 476 Back     alignment and organism information
>gi|103486881|ref|YP_616442.1| glucose/galactose transporter [Sphingopyxis alaskensis RB2256] Length = 431 Back     alignment and organism information
>gi|307293929|ref|ZP_07573773.1| glucose/galactose transporter [Sphingobium chlorophenolicum L-1] Length = 433 Back     alignment and organism information
>gi|149185767|ref|ZP_01864082.1| glucose/galactose transporter [Erythrobacter sp. SD-21] Length = 473 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target420 glucose/galactose transporter [Candidatus Liberibacter
TIGR00885410 TIGR00885, fucP, L-fucose:H+ symporter permease 9e-51
PRK10133438 PRK10133, PRK10133, L-fucose transporter; Provisional 5e-50
cd06174352 cd06174, MFS, The Major Facilitator Superfamily (MFS) i 7e-13
COG2223417 COG2223, NarK, Nitrate/nitrite transporter [Inorganic i 2e-06
KOG2504509 KOG2504, KOG2504, KOG2504, Monocarboxylate transporter 3e-06
KOG2533495 KOG2533, KOG2533, KOG2533, Permease of the major facili 0.003
COG0738422 COG0738, FucP, Fucose permease [Carbohydrate transport 7e-69
TIGR01272310 TIGR01272, gluP, glucose/galactose transporter 3e-49
pfam07690345 pfam07690, MFS_1, Major Facilitator Superfamily 5e-12
pfam07690345 pfam07690, MFS_1, Major Facilitator Superfamily 2e-04
PRK03699394 PRK03699, PRK03699, putative transporter; Provisional 4e-04
>gnl|CDD|162089 TIGR00885, fucP, L-fucose:H+ symporter permease Back     alignment and domain information
>gnl|CDD|182260 PRK10133, PRK10133, L-fucose transporter; Provisional Back     alignment and domain information
>gnl|CDD|119392 cd06174, MFS, The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>gnl|CDD|32405 COG2223, NarK, Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|37715 KOG2504, KOG2504, KOG2504, Monocarboxylate transporter [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|37744 KOG2533, KOG2533, KOG2533, Permease of the major facilitator superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|31081 COG0738, FucP, Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162278 TIGR01272, gluP, glucose/galactose transporter Back     alignment and domain information
>gnl|CDD|148990 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|148990 pfam07690, MFS_1, Major Facilitator Superfamily Back     alignment and domain information
>gnl|CDD|179633 PRK03699, PRK03699, putative transporter; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 420 glucose/galactose transporter [Candidatus Liberibacter
PRK10133438 L-fucose transporter; Provisional 100.0
COG0738422 FucP Fucose permease [Carbohydrate transport and metabo 100.0
PRK03699394 hypothetical protein; Provisional 100.0
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT; Pro 100.0
PRK11663434 regulatory protein UhpC; Provisional 100.0
PRK11273452 glpT sn-glycerol-3-phosphate transporter; Provisional 100.0
PRK03545390 sugar efflux transporter; Provisional 100.0
PRK12307426 putative sialic acid transporter; Provisional 100.0
PRK09874406 drug efflux system protein MdtG; Provisional 100.0
PRK03893486 putative sialic acid transporter; Provisional 100.0
PRK10091389 MFS transport protein AraJ; Provisional 100.0
PRK09556463 uhpT sugar phosphate antiporter; Reviewed 100.0
PRK10473392 multidrug efflux system protein MdtL; Provisional 100.0
PRK11652394 emrD multidrug resistance protein D; Provisional 100.0
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 100.0
PRK11043401 inner membrane transport protein YdhC; Provisional 100.0
PRK05122395 major facilitator superfamily transporter; Provisional 100.0
PRK12382393 hypothetical protein; Provisional 100.0
TIGR00885427 fucP L-fucose:H+ symporter permease; InterPro: IPR00527 100.0
TIGR00893427 2A0114 d-galactonate transporter; InterPro: IPR004744 D 100.0
PRK10054395 putative MFS-type transporter YdeE; Provisional 100.0
COG2814394 AraJ Arabinose efflux permease [Carbohydrate transport 100.0
PRK11646400 multidrug resistance protein MdtH; Provisional 100.0
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a large 100.0
PRK10213394 nepI ribonucleoside transporter; Reviewed 100.0
PRK09705393 cynX putative cyanate transporter; Provisional 100.0
pfam00083449 Sugar_tr Sugar (and other) transporter. 100.0
COG2271448 UhpC Sugar phosphate permease [Carbohydrate transport a 100.0
PRK03633381 putative MFS family transporter protein; Provisional 100.0
TIGR00881404 2A0104 phosphoglycerate transporter family protein; Int 100.0
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion transpo 100.0
PRK10642490 proline/glycine betaine transporter; Provisional 100.0
PRK10077486 xylE D-xylose transporter XylE; Provisional 100.0
PRK09952438 shikimate transporter; Provisional 100.0
PRK10489416 enterobactin exporter EntS; Provisional 100.0
PRK10406432 alpha-ketoglutarate transporter; Provisional 100.0
TIGR00883413 2A0106 MFS transporter, metabolite:H+ symporter (MHS) f 100.0
KOG2533495 consensus 100.0
TIGR00892475 2A0113 monocarboxylate transporter; InterPro: IPR004743 100.0
pfam05977 524 DUF894 Bacterial protein of unknown function (DUF894). 100.0
KOG2504509 consensus 99.98
COG2807395 CynX Cyanate permease [Inorganic ion transport and meta 99.98
PRK09528418 lacY galactoside permease; Reviewed 99.98
TIGR00712468 glpT glycerol-3-phosphate transporter; InterPro: IPR005 99.97
pfam01306413 LacY_symp LacY proton/sugar symporter. This family is c 99.97
KOG0569485 consensus 99.96
TIGR00879572 SP MFS transporter, sugar porter (SP) family; InterPro: 99.96
TIGR00890429 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741 99.95
PRK11902402 ampG muropeptide transporter; Reviewed 99.95
pfam03825400 Nuc_H_symport Nucleoside H+ symporter. 99.94
KOG2615451 consensus 99.94
PRK11195415 major facilitator family transporter; Provisional 99.93
PRK11128383 putative 3-phenylpropionic acid transporter; Provisiona 99.93
TIGR00899377 2A0120 sugar efflux transporter; InterPro: IPR004750 Th 99.93
PRK08633 1150 2-acyl-glycerophospho-ethanolamine acyltransferase; Val 99.92
KOG4686459 consensus 99.91
KOG0252538 consensus 99.91
TIGR00897411 2A0118 polyol permease; InterPro: IPR004748 Proteins in 99.9
TIGR02332412 HpaX 4-hydroxyphenylacetate permease; InterPro: IPR0127 99.89
PRK11010490 ampG muropeptide transporter; Validated 99.87
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 99.87
KOG2563480 consensus 99.82
TIGR00882397 2A0105 oligosaccharide:H+ symporter; InterPro: IPR00057 99.73
TIGR00887557 2A0109 phosphate:H+ symporter; InterPro: IPR004738 In y 99.63
TIGR00889435 2A0110 nucleoside transporter; InterPro: IPR004740 This 99.44
TIGR00902388 2A0127 MFS transporter, phenyl propionate permease (PPP 99.4
TIGR02718391 sider_RhtX_FptX siderophore transporter, RhtX/FptX fami 98.13
TIGR00895413 2A0115 MFS transporter, aromatic acid:H+ symporter (AAH 100.0
PRK10504471 multidrug efflux system protein MdtE; Provisional 100.0
pfam07690345 MFS_1 Major Facilitator Superfamily. 100.0
TIGR00710400 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA s 100.0
TIGR00711501 efflux_EmrB drug resistance MFS transporter, drug:H+ an 100.0
KOG1330493 consensus 99.97
TIGR00891453 2A0112 MFS transporter, sialate:H+ symporter (SHS) fami 99.97
TIGR00900387 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug 99.92
PRK10429473 melibiose:sodium symporter; Provisional 99.88
PRK09848457 glucuronide transporter; Provisional 99.85
COG2211467 MelB Na+/melibiose symporter and related transporters [ 99.8
KOG2816463 consensus 99.69
pfam06963433 FPN1 Ferroportin1 (FPN1). This family represents a cons 98.76
KOG2532466 consensus 100.0
TIGR00894514 2A0114euk Na(+)-dependent inorganic phosphate cotranspo 100.0
TIGR00898557 2A0119 cation transport protein; InterPro: IPR004749 Or 99.97
KOG3764464 consensus 99.93
pfam11700477 ATG22 Vacuole effluxer Atg22 like. Autophagy is a major 99.88
KOG0253528 consensus 99.86
COG2270438 Permeases of the major facilitator superfamily [General 99.81
pfam03209402 PUCC PUCC protein. This protein is required for high-le 99.75
TIGR00896372 CynX cyanate transporter; InterPro: IPR004747 This fami 99.97
KOG0255521 consensus 99.94
PRK09669442 putative symporter YagG; Provisional 99.84
PRK11462460 putative transporter; Provisional 99.82
pfam03092425 BT1 BT1 family. Members of this family are transmembran 99.62
TIGR00903368 2A0129 major facilitator 4 family protein; InterPro: IP 99.58
TIGR00792470 gph sugar (Glycoside-Pentoside-Hexuronide) transporter; 99.48
pfam06609 598 TRI12 Fungal trichothecene efflux pump (TRI12). This fa 99.97
KOG0254513 consensus 99.95
PRK09584500 tppB putative tripeptide transporter permease; Reviewed 99.9
PRK10207490 inner membrane transporter YhiP; Provisional 99.88
PRK12382393 hypothetical protein; Provisional 99.81
PRK11551406 putative 3-hydroxyphenylpropionic transporter MhpT; Pro 99.79
PRK03893486 putative sialic acid transporter; Provisional 99.79
PRK05122395 major facilitator superfamily transporter; Provisional 99.78
PRK09874406 drug efflux system protein MdtG; Provisional 99.78
PRK10642490 proline/glycine betaine transporter; Provisional 99.78
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid transpor 99.78
PRK03633381 putative MFS family transporter protein; Provisional 99.78
PTZ00207 591 hypothetical protein; Provisional 99.77
PRK12307426 putative sialic acid transporter; Provisional 99.74
KOG2325488 consensus 99.73
pfam07690345 MFS_1 Major Facilitator Superfamily. 99.72
PRK11646400 multidrug resistance protein MdtH; Provisional 99.64
PRK10091389 MFS transport protein AraJ; Provisional 99.63
PRK03545390 sugar efflux transporter; Provisional 99.62
PRK10489416 enterobactin exporter EntS; Provisional 99.61
TIGR00883413 2A0106 MFS transporter, metabolite:H+ symporter (MHS) f 99.61
PRK03699394 hypothetical protein; Provisional 99.59
PRK10406432 alpha-ketoglutarate transporter; Provisional 99.55
cd06174352 MFS The Major Facilitator Superfamily (MFS) is a large 99.52
pfam05977524 DUF894 Bacterial protein of unknown function (DUF894). 99.43
COG2270438 Permeases of the major facilitator superfamily [General 99.39
COG2814394 AraJ Arabinose efflux permease [Carbohydrate transport 99.37
pfam03825400 Nuc_H_symport Nucleoside H+ symporter. 99.35
PRK10213394 nepI ribonucleoside transporter; Reviewed 99.33
TIGR00805 723 oat sodium-independent organic anion transporter; Inter 99.31
TIGR00711501 efflux_EmrB drug resistance MFS transporter, drug:H+ an 99.3
COG2223417 NarK Nitrate/nitrite transporter [Inorganic ion transpo 99.3
TIGR00900387 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug 99.3
KOG2504509 consensus 99.3
PRK09705393 cynX putative cyanate transporter; Provisional 99.3
TIGR00890429 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741 99.28
COG0477338 ProP Permeases of the major facilitator superfamily [Ca 99.27
TIGR00924501 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H 99.23
PRK11010490 ampG muropeptide transporter; Validated 99.22
PRK08633 1150 2-acyl-glycerophospho-ethanolamine acyltransferase; Val 99.22
TIGR00891453 2A0112 MFS transporter, sialate:H+ symporter (SHS) fami 99.19
TIGR00899377 2A0120 sugar efflux transporter; InterPro: IPR004750 Th 99.17
pfam01770410 Folate_carrier Reduced folate carrier. The reduced fola 99.11
COG2211467 MelB Na+/melibiose symporter and related transporters [ 99.1
TIGR00892475 2A0113 monocarboxylate transporter; InterPro: IPR004743 99.05
pfam06813248 Nodulin-like Nodulin-like. This family represents a con 99.05
PRK06814 1139 acylglycerophosphoethanolamine acyltransferase; Provisi 99.02
pfam02487409 CLN3 CLN3 protein. This is a family of proteins from th 98.85
TIGR00897411 2A0118 polyol permease; InterPro: IPR004748 Proteins in 98.84
TIGR00896372 CynX cyanate transporter; InterPro: IPR004747 This fami 98.84
KOG3574510 consensus 98.75
COG2807395 CynX Cyanate permease [Inorganic ion transport and meta 98.75
TIGR00792470 gph sugar (Glycoside-Pentoside-Hexuronide) transporter; 98.74
TIGR01299 742 synapt_SV2 synaptic vesicle protein SV2; InterPro: IPR0 98.71
pfam05978157 UNC-93 Ion channel regulatory protein UNC-93. This fami 98.65
KOG0637498 consensus 98.59
TIGR00889435 2A0110 nucleoside transporter; InterPro: IPR004740 This 98.55
pfam03219491 TLC TLC ATP/ADP transporter. 98.39
KOG3810433 consensus 98.06
COG3202509 ATP/ADP translocase [Energy production and conversion] 97.85
TIGR00926 781 2A1704 Oligopeptide transporter (Peptide:H+ symporter); 97.79
PRK03612516 spermidine synthase; Provisional 97.57
TIGR02332412 HpaX 4-hydroxyphenylacetate permease; InterPro: IPR0127 97.52
TIGR00901 531 2A0125 AmpG-related permease; InterPro: IPR004752 The s 97.33
TIGR00788 594 fbt folate/biopterin transporter; InterPro: IPR004324 M 96.32
KOG3880409 consensus 95.94
KOG1237571 consensus 95.87
TIGR00886472 2A0108 nitrite transporter; InterPro: IPR004737 This fa 99.96
TIGR01272322 gluP glucose/galactose transporter WARNING; InterPro: I 99.95
TIGR00880148 2_A_01_02 Multidrug resistance protein; InterPro: IPR00 99.83
PRK11663434 regulatory protein UhpC; Provisional 99.61
PRK11102377 bicyclomycin/multidrug efflux system; Provisional 99.59
PRK10054395 putative MFS-type transporter YdeE; Provisional 99.59
PRK09952438 shikimate transporter; Provisional 99.57
PRK10473392 multidrug efflux system protein MdtL; Provisional 99.53
PRK11043401 inner membrane transport protein YdhC; Provisional 99.48
PRK11902402 ampG muropeptide transporter; Reviewed 99.39
KOG3098461 consensus 99.25
KOG4686459 consensus 99.05
KOG2533495 consensus 98.47
pfam03137582 OATP Organic Anion Transporter Polypeptide (OATP) famil 99.83
KOG3626 735 consensus 99.61
PRK10504471 multidrug efflux system protein MdtE; Provisional 99.66
PRK10077486 xylE D-xylose transporter XylE; Provisional 99.43
pfam01306413 LacY_symp LacY proton/sugar symporter. This family is c 99.27
PRK10207490 inner membrane transporter YhiP; Provisional 99.27
PRK09848457 glucuronide transporter; Provisional 99.2
KOG0569485 consensus 99.19
TIGR00924501 yjdL_sub1_fam amino acid/peptide transporter (Peptide:H 99.12
pfam0677985 DUF1228 Protein of unknown function (DUF1228). This fam 99.04
PRK11462460 putative transporter; Provisional 98.87
PRK11195415 major facilitator family transporter; Provisional 98.86
KOG2615451 consensus 98.36
pfam00854372 PTR2 POT family. The POT (proton-dependent oligopeptide 98.05
pfam03092425 BT1 BT1 family. Members of this family are transmembran 97.1
TIGR00788594 fbt folate/biopterin transporter; InterPro: IPR004324 M 96.09
TIGR00895 413 2A0115 MFS transporter, aromatic acid:H+ symporter (AAH 99.61
PRK11652 394 emrD multidrug resistance protein D; Provisional 99.58
TIGR00710 400 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA s 99.42
TIGR00712 468 glpT glycerol-3-phosphate transporter; InterPro: IPR005 97.9
TIGR00882 397 2A0105 oligosaccharide:H+ symporter; InterPro: IPR00057 97.11
pfam05631354 DUF791 Protein of unknown function (DUF791). This famil 99.58
KOG4332454 consensus 98.89
KOG1479406 consensus 98.4
pfam11700477 ATG22 Vacuole effluxer Atg22 like. Autophagy is a major 99.51
KOG0253528 consensus 98.79
KOG2325488 consensus 97.3
pfam03137582 OATP Organic Anion Transporter Polypeptide (OATP) famil 96.98
COG2271 448 UhpC Sugar phosphate permease [Carbohydrate transport a 99.39
KOG3762618 consensus 99.35
TIGR00893 427 2A0114 d-galactonate transporter; InterPro: IPR004744 D 99.31
TIGR00881 404 2A0104 phosphoglycerate transporter family protein; Int 99.13
TIGR00880148 2_A_01_02 Multidrug resistance protein; InterPro: IPR00 98.94
KOG3764 464 consensus 98.81
KOG1330 493 consensus 98.61
TIGR00898 557 2A0119 cation transport protein; InterPro: IPR004749 Or 98.48
TIGR00894 514 2A0114euk Na(+)-dependent inorganic phosphate cotranspo 97.34
PRK11128383 putative 3-phenylpropionic acid transporter; Provisiona 99.37
KOG2816463 consensus 97.9
KOG3098461 consensus 97.85
pfam02487409 CLN3 CLN3 protein. This is a family of proteins from th 95.87
PRK09584500 tppB putative tripeptide transporter permease; Reviewed 99.35
COG3104498 PTR2 Dipeptide/tripeptide permease [Amino acid transpor 98.97
TIGR00926 781 2A1704 Oligopeptide transporter (Peptide:H+ symporter); 95.61
pfam00083449 Sugar_tr Sugar (and other) transporter. 99.32
PRK09528418 lacY galactoside permease; Reviewed 99.24
PRK09669442 putative symporter YagG; Provisional 99.1
pfam06609598 TRI12 Fungal trichothecene efflux pump (TRI12). This fa 99.1
KOG2563 480 consensus 97.23
TIGR00879 572 SP MFS transporter, sugar porter (SP) family; InterPro: 98.83
KOG0254513 consensus 98.76
TIGR00886 472 2A0108 nitrite transporter; InterPro: IPR004737 This fa 98.76
pfam01733305 Nucleoside_tran Nucleoside transporter. This is a famil 95.79
KOG0255 521 consensus 98.69
KOG0252 538 consensus 97.59
KOG3762 618 consensus 98.66
TIGR00901531 2A0125 AmpG-related permease; InterPro: IPR004752 The s 96.51
KOG2532466 consensus 98.65
pfam05631354 DUF791 Protein of unknown function (DUF791). This famil 97.79
COG0738422 FucP Fucose permease [Carbohydrate transport and metabo 98.6
pfam00854372 PTR2 POT family. The POT (proton-dependent oligopeptide 98.42
PRK10133438 L-fucose transporter; Provisional 98.37
pfam06813248 Nodulin-like Nodulin-like. This family represents a con 96.28
KOG3097390 consensus 95.7
>PRK10133 L-fucose transporter; Provisional Back     alignment and domain information
>COG0738 FucP Fucose permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03699 hypothetical protein; Provisional Back     alignment and domain information
>PRK11551 putative 3-hydroxyphenylpropionic transporter MhpT; Provisional Back     alignment and domain information
>PRK11663 regulatory protein UhpC; Provisional Back     alignment and domain information
>PRK11273 glpT sn-glycerol-3-phosphate transporter; Provisional Back     alignment and domain information
>PRK03545 sugar efflux transporter; Provisional Back     alignment and domain information
>PRK12307 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK09874 drug efflux system protein MdtG; Provisional Back     alignment and domain information
>PRK03893 putative sialic acid transporter; Provisional Back     alignment and domain information
>PRK10091 MFS transport protein AraJ; Provisional Back     alignment and domain information
>PRK09556 uhpT sugar phosphate antiporter; Reviewed Back     alignment and domain information
>PRK10473 multidrug efflux system protein MdtL; Provisional Back     alignment and domain information
>PRK11652 emrD multidrug resistance protein D; Provisional Back     alignment and domain information
>PRK11102 bicyclomycin/multidrug efflux system; Provisional Back     alignment and domain information
>PRK11043 inner membrane transport protein YdhC; Provisional Back     alignment and domain information
>PRK05122 major facilitator superfamily transporter; Provisional Back     alignment and domain information
>PRK12382 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00885 fucP L-fucose:H+ symporter permease; InterPro: IPR005275 This family describes the L-fucose permease in bacteria Back     alignment and domain information
>TIGR00893 2A0114 d-galactonate transporter; InterPro: IPR004744 D-galactonate transporters and other proteins that belong to the phthalate permease family are members of this group Back     alignment and domain information
>PRK10054 putative MFS-type transporter YdeE; Provisional Back     alignment and domain information
>COG2814 AraJ Arabinose efflux permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11646 multidrug resistance protein MdtH; Provisional Back     alignment and domain information
>cd06174 MFS The Major Facilitator Superfamily (MFS) is a large and diverse group of secondary transporters that includes uniporters, symporters, and antiporters Back     alignment and domain information
>PRK10213 nepI ribonucleoside transporter; Reviewed Back     alignment and domain information
>PRK09705 cynX putative cyanate transporter; Provisional Back     alignment and domain information
>pfam00083 Sugar_tr Sugar (and other) transporter Back     alignment and domain information
>COG2271 UhpC Sugar phosphate permease [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK03633 putative MFS family transporter protein; Provisional Back     alignment and domain information
>TIGR00881 2A0104 phosphoglycerate transporter family protein; InterPro: IPR000849 Proteins in this group are involved in the transport system that mediates the uptake of a number of sugar phosphates as well as the regulatory components that are responsible for induction of this transport system by external glucose 6-phosphate Back     alignment and domain information
>COG2223 NarK Nitrate/nitrite transporter [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10642 proline/glycine betaine transporter; Provisional Back     alignment and domain information
>PRK10077 xylE D-xylose transporter XylE; Provisional Back     alignment and domain information
>PRK09952 shikimate transporter; Provisional Back     alignment and domain information
>PRK10489 enterobactin exporter EntS; Provisional Back     alignment and domain information
>PRK10406 alpha-ketoglutarate transporter; Provisional Back     alignment and domain information
>TIGR00883 2A0106 MFS transporter, metabolite:H+ symporter (MHS) family protein; InterPro: IPR004736 Recent genome-sequencing data and a wealth of biochemical and molecular genetic investigations have revealed the occurrence of dozens of families of primary and secondary transporters Back     alignment and domain information
>KOG2533 consensus Back     alignment and domain information
>TIGR00892 2A0113 monocarboxylate transporter; InterPro: IPR004743 Proton-linked monocarboxylate transporters catalyse the rapid transport across the plasma membrane of many monocarboxylates such as lactate, pyruvate, branched-chain oxo acids derived from leucine, valine and isoleucine, and the ketone bodies acetoacetate, beta-hydroxybutyrate and acetate Back     alignment and domain information
>pfam05977 DUF894 Bacterial protein of unknown function (DUF894) Back     alignment and domain information
>KOG2504 consensus Back     alignment and domain information
>COG2807 CynX Cyanate permease [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09528 lacY galactoside permease; Reviewed Back     alignment and domain information
>TIGR00712 glpT glycerol-3-phosphate transporter; InterPro: IPR005267 This family includes very hydrophobic proteins, predicted to span the membrane at least 8 times Back     alignment and domain information
>pfam01306 LacY_symp LacY proton/sugar symporter Back     alignment and domain information
>KOG0569 consensus Back     alignment and domain information
>TIGR00879 SP MFS transporter, sugar porter (SP) family; InterPro: IPR003663 The sugar transporters belong to a superfamily of membrane proteins responsible for the binding and transport of various carbohydrates, organic alcohols, and acids in a wide range of prokaryotic and eukaryotic organisms Back     alignment and domain information
>TIGR00890 2A0111 Oxalate/Formate Antiporter; InterPro: IPR004741 Oxalate/formate antiporters and many, as yet, uncharacterised proteins belong to this group Back     alignment and domain information
>PRK11902 ampG muropeptide transporter; Reviewed Back     alignment and domain information
>pfam03825 Nuc_H_symport Nucleoside H+ symporter Back     alignment and domain information
>KOG2615 consensus Back     alignment and domain information
>PRK11195 major facilitator family transporter; Provisional Back     alignment and domain information
>PRK11128 putative 3-phenylpropionic acid transporter; Provisional Back     alignment and domain information
>TIGR00899 2A0120 sugar efflux transporter; InterPro: IPR004750 This family of proteins is an efflux system for lactose, glucose, aromatic glucosides and galactosides, cellobiose, maltose, a-methyl glucoside and other sugar compounds Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>KOG4686 consensus Back     alignment and domain information
>KOG0252 consensus Back     alignment and domain information
>TIGR00897 2A0118 polyol permease; InterPro: IPR004748 Proteins in this entry are mostly known or predicted polyol transporters Back     alignment and domain information
>TIGR02332 HpaX 4-hydroxyphenylacetate permease; InterPro: IPR012707 Among the different families of transporter only two occur ubiquitously in all classifications of organisms Back     alignment and domain information
>PRK11010 ampG muropeptide transporter; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>KOG2563 consensus Back     alignment and domain information
>TIGR00882 2A0105 oligosaccharide:H+ symporter; InterPro: IPR000576 In bacteria there are a number of families of transport proteins, including symporters and antiporters, that mediate the intake of a variety of sugars with the concomitant uptake of hydrogen ions (proton symporters) Back     alignment and domain information
>TIGR00887 2A0109 phosphate:H+ symporter; InterPro: IPR004738 In yeast the high-affinity transporter for external inorganic phosphate is not essential since a constitutive, low-affinity transporter exists Back     alignment and domain information
>TIGR00889 2A0110 nucleoside transporter; InterPro: IPR004740 This family of proteins transports nucleosides at a high affinity Back     alignment and domain information
>TIGR00902 2A0127 MFS transporter, phenyl propionate permease (PPP) family; InterPro: IPR005276 This family of proteins is involved in the uptake of 3-phenylpropionic acid Back     alignment and domain information
>TIGR02718 sider_RhtX_FptX siderophore transporter, RhtX/FptX family; InterPro: IPR014090 RhtX from Sinorhizobium meliloti 1021 and FptX from Pseudomonas aeruginosa appear to be single polypeptide transporters, from the major facilitator family for import of siderophores as a means to import iron Back     alignment and domain information
>TIGR00895 2A0115 MFS transporter, aromatic acid:H+ symporter (AAHS) family; InterPro: IPR004746 Benzoate transport proteins belong to this group Back     alignment and domain information
>PRK10504 multidrug efflux system protein MdtE; Provisional Back     alignment and domain information
>pfam07690 MFS_1 Major Facilitator Superfamily Back     alignment and domain information
>TIGR00710 efflux_Bcr_CflA drug resistance transporter, Bcr/CflA subfamily; InterPro: IPR004812 The drug resistance transporter Bcr/CflA proteins are predicted to have 12 membrane-spanning regions Back     alignment and domain information
>TIGR00711 efflux_EmrB drug resistance MFS transporter, drug:H+ antiporter-1 (14 Spanner) (DHA2) family; InterPro: IPR004638 This subfamily of drug efflux proteins, a part of the major facilitator family, is predicted to have 14 potential membrane-spanning regions Back     alignment and domain information
>KOG1330 consensus Back     alignment and domain information
>TIGR00891 2A0112 MFS transporter, sialate:H+ symporter (SHS) family; InterPro: IPR004742 The sugar transporters belong to a family of membrane proteins responsible for the transport of various sugars in a wide range of prokaryotic and eukaryotic organisms Back     alignment and domain information
>TIGR00900 2A0121 H+ Antiporter protein; InterPro: IPR004751 Drug antiporters which use the proton motive force for the active efflux of the drug Back     alignment and domain information
>PRK10429 melibiose:sodium symporter; Provisional Back     alignment and domain information
>PRK09848 glucuronide transporter; Provisional Back     alignment and domain information
>COG2211 MelB Na+/melibiose symporter and related transporters [Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG2816 consensus Back     alignment and domain information
>pfam06963 FPN1 Ferroportin1 (FPN1) Back     alignment and domain information
>KOG2532 consensus Back     alignment and domain information
>TIGR00894 2A0114euk Na(+)-dependent inorganic phosphate cotransporter; InterPro: IPR004745 Na(+)-dependent inorganic phosphate cotransporter proteins belong to this group Back     alignment and domain information
>TIGR00898 2A0119 cation transport protein; InterPro: IPR004749 Organic cation transport proteins belong to this group Back     alignment and domain information
>KOG3764 consensus Back     alignment and domain information
>pfam11700 ATG22 Vacuole effluxer Atg22 like Back     alignment and domain information
>KOG0253 consensus Back     alignment and domain information
>COG2270 Permeases of the major facilitator superfamily [General function prediction only] Back     alignment and domain information
>pfam03209 PUCC PUCC protein Back     alignment and domain information
>TIGR00896 CynX cyanate transporter; InterPro: IPR004747 This family of proteins is involved in active transport of cyanate Back     alignment and domain information
>KOG0255 consensus Back     alignment and domain information
>PRK09669 putative symporter YagG; Provisional Back     alignment and domain information
>PRK11462 putative transporter; Provisional Back     alignment and domain information
>pfam03092 BT1 BT1 family Back     alignment and domain information
>TIGR00903 2A0129 major facilitator 4 family protein; Inter