254780846

254780846

bifunctional riboflavin kinase/FMN adenylyltransferase

GeneID in NCBI database:8209859Locus tag:CLIBASIA_03705
Protein GI in NCBI database:254780846Protein Accession:YP_003065259.1
Gene range:-(816217, 817191)Protein Length:324aa
Gene description:bifunctional riboflavin kinase/FMN adenylyltransferase
COG prediction:[H] FAD synthase
KEGG prediction:bifunctional riboflavin kinase/FMN adenylyltransferase (EC:2.7.1.26); K11753 riboflavin kinase / FMN adenylyltransferase [EC:2.7.1.26 2.7.7.2]
SEED prediction:Riboflavin kinase (EC 2.7.1.26) / FMN adenylyltransferase (EC 2.7.7.2)
Pathway involved in KEGG:Riboflavin metabolism [PATH:las00740]
Subsystem involved in SEED:Glutaredoxins;
Riboflavin, FMN and FAD metabolism
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320----
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF
cEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEEcccHHHHHcccccccccccHHHHHHHHHHccccEEEEEcccHHHHcccHHHHHHHHHHHHccccEEEEcccccccccccccHHHHHHHHHHHccEEEEEccEEEccccEEEHHHHHHHHHcccHHHHHHHccccEEEEEEEEEcccccccccccEEEEEccccccccccEEEEEEEEccccEEEEEEEEcccccccccccEEEEEEEEcccccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccEEEEc
cccEccccccccccHHHcccEEEEcccccHHHHHHHHHHHHHHHHccccEEEEEEccccHHHccccccccHcccHHHHHHHHHHccccEEEEEEccHHHHHccHHHHHHHHHHHccccEEEEEcccccccccccccHHHHHHHHHHcccEEEEEcccEcccccEEcHHHHHHHHHcccHHHHHHHHcccEEEEEEEEEccccccccccccccccccccccccccEEEEEEEEccccccccEEEccccccccccccEEEEEEEEEccccccccEEEEEHHHHHccHcccccHHHHHHHHHHHHHHHHHHHHccccccccccHHcc
mhvfhnieinqslpnhlkggvvaignfdgihlGHHLILEQAIKiannspitvlsfnphprtiiqssspiftlsppsIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTvitgtkfrfgkdragdrgilqkrgekygfHTVFIDELrnnksqivsssnirtaltkghVLNAAHLLGYRftiesdvihgekigrtlgfptanmqlspdillKEGVYAIRfrtqdqtsysgvanfgrnptmvpngpllLESFIFDfsqeiygqrctvsffdylrpeikfkdIEKLKIYMGEDEKKARKILEssyplserdriicf
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSsspiftlsPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTvitgtkfrfgkdragdrgilqkrgekyGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSffdylrpeikfkdieklkiymgedekkarkilessyplserdriicf
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDR***F
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF
MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARKILESSYPLSERDRIICF

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target324 bifunctional riboflavin kinase/FMN adenylyltransferase
315122730324 bifunctional riboflavin kinase/FMN adenylyltransferase 1 1e-144
218682200327 bifunctional riboflavin kinase/FMN adenylyltransferase 1 2e-93
209548080327 bifunctional riboflavin kinase/FMN adenylyltransferase 1 7e-93
218673797327 bifunctional riboflavin kinase/FMN adenylyltransferase 1 1e-92
222085007327 riboflavin biosynthesis protein RibF [Agrobacterium rad 1 2e-92
241203266327 bifunctional riboflavin kinase/FMN adenylyltransferase 1 4e-92
190890538327 riboflavin kinase/FMN adenylyltransferase [Rhizobium et 1 3e-91
116250660327 bifunctional riboflavin kinase/FMN adenylyltransferase 1 4e-91
327191134327 riboflavin kinase/FMN adenylyltransferase protein [Rhiz 1 9e-91
86356477327 bifunctional riboflavin kinase/FMN adenylyltransferase 1 1e-90
>gi|315122730|ref|YP_004063219.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 324 Back     alignment and organism information
 Score =  514 bits (1325), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 243/324 (75%), Positives = 281/324 (86%)

Query: 1   MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIANNSPITVLSFNPHPR 60
           MHVFHNIE NQ LPNHLKGGVV IGNFDGIHLGH+ ILE AIKIAN +P  VL F+PHPR
Sbjct: 1   MHVFHNIETNQPLPNHLKGGVVVIGNFDGIHLGHYSILEHAIKIANGAPTAVLLFSPHPR 60

Query: 61  TIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKT 120
            ++QSS+P+FTL+P SIQ KILEKMGFSALIRYKFTLE +NYS+EQFI+KVLVEWLE K 
Sbjct: 61  IVLQSSTPLFTLTPQSIQTKILEKMGFSALIRYKFTLEMSNYSSEQFIRKVLVEWLEAKK 120

Query: 121 VITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGHVL 180
           VITG++FRFGK+R+GD   L+K G KYGF+T+ IDELR+N  QI+SSS IRT LT G+V 
Sbjct: 121 VITGSQFRFGKNRSGDGTFLEKSGRKYGFNTILIDELRDNTDQIISSSKIRTELTNGNVH 180

Query: 181 NAAHLLGYRFTIESDVIHGEKIGRTLGFPTANMQLSPDILLKEGVYAIRFRTQDQTSYSG 240
           NAAHLLGY FTIES V+HG+KIGRTLGFPTANMQLS +  LKEGVY I FRTQD+ SY+G
Sbjct: 181 NAAHLLGYHFTIESKVVHGKKIGRTLGFPTANMQLSSETSLKEGVYTIHFRTQDKISYNG 240

Query: 241 VANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGE 300
           +ANFGRNPT++ NGPLLLESFIFDFSQEIYGQ C VSFFD+LRPEIKFKD+++L+ +  +
Sbjct: 241 IANFGRNPTVIQNGPLLLESFIFDFSQEIYGQTCAVSFFDFLRPEIKFKDLQELQKHTQK 300

Query: 301 DEKKARKILESSYPLSERDRIICF 324
           DEKKARK+LE+  PLSERDRIICF
Sbjct: 301 DEKKARKLLENYQPLSERDRIICF 324


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218682200|ref|ZP_03529801.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Rhizobium etli CIAT 894] Length = 327 Back     alignment and organism information
>gi|209548080|ref|YP_002279997.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 327 Back     alignment and organism information
>gi|218673797|ref|ZP_03523466.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Rhizobium etli GR56] Length = 327 Back     alignment and organism information
>gi|222085007|ref|YP_002543536.1| riboflavin biosynthesis protein RibF [Agrobacterium radiobacter K84] Length = 327 Back     alignment and organism information
>gi|241203266|ref|YP_002974362.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 327 Back     alignment and organism information
>gi|190890538|ref|YP_001977080.1| riboflavin kinase/FMN adenylyltransferase [Rhizobium etli CIAT 652] Length = 327 Back     alignment and organism information
>gi|116250660|ref|YP_766498.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 327 Back     alignment and organism information
>gi|327191134|gb|EGE58179.1| riboflavin kinase/FMN adenylyltransferase protein [Rhizobium etli CNPAF512] Length = 327 Back     alignment and organism information
>gi|86356477|ref|YP_468369.1| bifunctional riboflavin kinase/FMN adenylyltransferase [Rhizobium etli CFN 42] Length = 327 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target324 bifunctional riboflavin kinase/FMN adenylyltransferase
PRK05627305 PRK05627, PRK05627, bifunctional riboflavin kinase/FMN 9e-91
TIGR00083288 TIGR00083, ribF, riboflavin kinase/FMN adenylyltransfer 5e-57
PRK07143279 PRK07143, PRK07143, hypothetical protein; Provisional 1e-10
COG0196304 COG0196, RibF, FAD synthase [Coenzyme metabolism] 8e-74
cd02064180 cd02064, FAD_synthetase_N, FAD synthetase, N-terminal d 5e-44
pfam06574158 pfam06574, FAD_syn, FAD synthetase 7e-37
pfam01687125 pfam01687, Flavokinase, Riboflavin kinase 4e-37
KOG3110153 KOG3110, KOG3110, KOG3110, Riboflavin kinase [Coenzyme 6e-07
PLN02940382 PLN02940, PLN02940, riboflavin kinase 6e-04
>gnl|CDD|180171 PRK05627, PRK05627, bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|161699 TIGR00083, ribF, riboflavin kinase/FMN adenylyltransferase Back     alignment and domain information
>gnl|CDD|180859 PRK07143, PRK07143, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|30545 COG0196, RibF, FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|185679 cd02064, FAD_synthetase_N, FAD synthetase, N-terminal domain of the bifunctional enzyme Back     alignment and domain information
>gnl|CDD|115244 pfam06574, FAD_syn, FAD synthetase Back     alignment and domain information
>gnl|CDD|145043 pfam01687, Flavokinase, Riboflavin kinase Back     alignment and domain information
>gnl|CDD|38320 KOG3110, KOG3110, KOG3110, Riboflavin kinase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|178528 PLN02940, PLN02940, riboflavin kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 324 bifunctional riboflavin kinase/FMN adenylyltransferase
PRK05627303 bifunctional riboflavin kinase/FMN adenylyltransferase; 100.0
COG0196304 RibF FAD synthase [Coenzyme metabolism] 100.0
TIGR00083296 ribF riboflavin biosynthesis protein RibF; InterPro: IP 100.0
PRK07143277 hypothetical protein; Provisional 100.0
PRK01170328 phosphopantetheine adenylyltransferase/unknown domain f 98.86
PRK07152343 nadD putative nicotinate-nucleotide adenylyltransferase 97.56
cd02064179 Flavokinase_C Riboflavin kinase (Flavokinase). This fam 100.0
cd02172143 RfaE_N RfaE is a protein involved in the biosynthesis o 99.13
cd02171129 G3P_Cytidylyltransferase These sequences describe glyce 99.03
cd02170136 cytidylyltransferase The cytidylyltransferase family in 99.01
PRK00777155 phosphopantetheine adenylyltransferase; Provisional 98.93
cd00560276 PanC PanC Pantoate-beta-alanine ligase, also known as p 98.81
pfam02569280 Pantoate_ligase Pantoate-beta-alanine ligase. Pantoate- 98.79
cd02174150 CCT CTP:phosphocholine cytidylyltransferase (CCT) catal 98.76
COG0615140 TagD Cytidylyltransferase [Cell envelope biogenesis, ou 98.58
PRK00380283 panC pantoate--beta-alanine ligase; Reviewed 98.58
cd02167157 NMNAT_NadR The NMNAT domain of NadR protein. The NadR p 98.55
cd02163152 PPAT_a Phosphopantetheine adenylyltransferase (PPAT) is 98.49
pfam08218182 Citrate_ly_lig Citrate lyase ligase C-terminal domain. 98.48
cd02165194 NMNAT This family contains the predominant bacterial/eu 98.46
PRK00071200 nadD nicotinic acid mononucleotide adenylyltransferase; 98.39
TIGR02199144 rfaE_dom_II rfaE bifunctional protein, domain II; Inter 98.39
PRK01153170 nicotinamide-nucleotide adenylyltransferase; Provisiona 98.38
cd02166163 NMNAT_Archaea This family of archaeal proteins exhibits 98.37
PRK11316473 bifunctional heptose 7-phosphate kinase/heptose 1-phosp 98.37
PRK08887173 nicotinic acid mononucleotide adenylyltransferase; Prov 98.35
cd02173152 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) 98.32
PRK00168159 coaD phosphopantetheine adenylyltransferase; Provisiona 98.26
smart00764182 Citrate_ly_lig Citrate lyase ligase C-terminal domain. 98.21
PRK08099411 nicotinamide-nucleotide adenylyltransferase; Provisiona 98.19
TIGR00018310 panC pantoate--beta-alanine ligase; InterPro: IPR003721 98.18
cd02169296 Citrate_lyase_ligase Citrate lyase ligase, also known a 98.06
COG1057197 NadD Nicotinic acid mononucleotide adenylyltransferase 98.01
COG0669159 CoaD Phosphopantetheine adenylyltransferase [Coenzyme m 98.0
TIGR01510163 coaD_prev_kdtB pantetheine-phosphate adenylyltransferas 97.89
COG2046397 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Ino 97.73
COG2870467 RfaE ADP-heptose synthase, bifunctional sugar kinase/ad 97.5
PRK13964140 coaD phosphopantetheine adenylyltransferase; Provisiona 97.49
COG1323358 Predicted nucleotidyltransferase [General function pred 97.3
COG3053352 CitC Citrate lyase synthetase [Energy production and co 97.11
pfam01747310 ATP-sulfurylase ATP-sulfurylase. This family consists o 97.11
PTZ00308353 ethanolamine-phosphate cytidylytransferase; Provisional 97.1
PRK05379340 bifunctional nicotinamide mononucleotide adenylyltransf 96.95
cd00517356 ATPS ATP-sulfurylase (ATPS), also known as sulfate aden 96.94
cd02168179 NMNAT_Nudix This domain represents the N-terminal NMNAT 96.93
KOG3351293 consensus 96.7
COG1056172 NadR Nicotinamide mononucleotide adenylyltransferase [C 96.64
PRK13793188 nicotinamide-nucleotide adenylyltransferase; Provisiona 96.58
PRK04149390 sat sulfate adenylyltransferase; Reviewed 96.57
KOG2803358 consensus 95.25
PRK05537568 bifunctional sulfate adenylyltransferase subunit 1/aden 94.42
TIGR01527171 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 93.74
KOG2804348 consensus 92.37
pfam06574158 FAD_syn FAD synthetase. This family corresponds to the 100.0
cd02039141 cytidylyltransferase_like Cytidylyltransferase-like dom 99.9
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 99.44
cd02164142 PPAT_CoAS The PPAT domain of the bifunctional enzyme wi 98.72
TIGR01518126 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransfera 98.64
cd02158183 PanC_ATPS PanC_ATPS Pantothenate synthetase (PanC) and 98.4
COG1019158 Predicted nucleotidyltransferase [General function pred 98.38
PRK13477 512 bifunctional pantoate ligase/cytidylate kinase; Provisi 98.27
pfam01467148 CTP_transf_2 Cytidylyltransferase. This family includes 98.14
COG0414285 PanC Panthothenate synthetase [Coenzyme metabolism] 98.04
TIGR01526346 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransfe 97.73
PTZ00308353 ethanolamine-phosphate cytidylytransferase; Provisional 97.73
PRK13671298 hypothetical protein; Provisional 97.37
pfam05636389 DUF795 Protein of unknown function (DUF795). This famil 97.36
PRK13670390 hypothetical protein; Provisional 97.33
KOG3042283 consensus 96.95
KOG2803358 consensus 95.32
pfam01687125 Flavokinase Riboflavin kinase. This family represents t 100.0
KOG3110153 consensus 99.91
TIGR0012563 cyt_tran_rel cytidyltransferase-related domain; InterPr 96.85
TIGR00482229 TIGR00482 nicotinate (nicotinamide) nucleotide adenylyl 95.84
>PRK05627 bifunctional riboflavin kinase/FMN adenylyltransferase; Reviewed Back     alignment and domain information
>COG0196 RibF FAD synthase [Coenzyme metabolism] Back     alignment and domain information
>TIGR00083 ribF riboflavin biosynthesis protein RibF; InterPro: IPR002606 Riboflavin is converted into catalytically active cofactors (FAD and FMN) by the actions of riboflavin kinase (2 Back     alignment and domain information
>PRK07143 hypothetical protein; Provisional Back     alignment and domain information
>PRK01170 phosphopantetheine adenylyltransferase/unknown domain fusion protein; Provisional Back     alignment and domain information
>PRK07152 nadD putative nicotinate-nucleotide adenylyltransferase; Validated Back     alignment and domain information
>cd02064 Flavokinase_C Riboflavin kinase (Flavokinase) Back     alignment and domain information
>cd02172 RfaE_N RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis Back     alignment and domain information
>cd02171 G3P_Cytidylyltransferase These sequences describe glycerol-3-phosphate cytidylyltransferase, also called CDP-glycerol pyrophosphorylase Back     alignment and domain information
>cd02170 cytidylyltransferase The cytidylyltransferase family includes cholinephosphate cytidylyltransferase (CCT), glycerol-3-phosphate cytidylyltransferase, RafE and phosphoethanolamine cytidylyltransferase (ECT) Back     alignment and domain information
>PRK00777 phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>cd00560 PanC PanC Pantoate-beta-alanine ligase, also known as pantothenate synthase, catalyzes the formation of pantothenate from pantoate and alanine Back     alignment and domain information
>pfam02569 Pantoate_ligase Pantoate-beta-alanine ligase Back     alignment and domain information
>cd02174 CCT CTP:phosphocholine cytidylyltransferase (CCT) catalyzes the condensation of CTP and phosphocholine to form CDP-choline as the rate-limiting and regulatory step in the CDP-choline pathway Back     alignment and domain information
>COG0615 TagD Cytidylyltransferase [Cell envelope biogenesis, outer membrane / Lipid metabolism] Back     alignment and domain information
>PRK00380 panC pantoate--beta-alanine ligase; Reviewed Back     alignment and domain information
>cd02167 NMNAT_NadR The NMNAT domain of NadR protein Back     alignment and domain information
>cd02163 PPAT_a Phosphopantetheine adenylyltransferase (PPAT) is an essential enzyme in bacteria that catalyses a rate-limiting step in coenzyme A (CoA) biosynthesis, by transferring an adenylyl group from ATP to 4'-phosphopantetheine, yielding dephospho-CoA (dPCoA) Back     alignment and domain information
>pfam08218 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>cd02165 NMNAT This family contains the predominant bacterial/eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide Back     alignment and domain information
>PRK00071 nadD nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>TIGR02199 rfaE_dom_II rfaE bifunctional protein, domain II; InterPro: IPR011914 RfaE is a protein involved in the biosynthesis of ADP-L-glycero-D-manno-heptose, a precursor for LPS inner core biosynthesis Back     alignment and domain information
>PRK01153 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02166 NMNAT_Archaea This family of archaeal proteins exhibits nicotinamide-nucleotide adenylyltransferase (NMNAT) activity utilizing the salvage pathway to synthesize NAD Back     alignment and domain information
>PRK11316 bifunctional heptose 7-phosphate kinase/heptose 1-phosphate adenyltransferase; Provisional Back     alignment and domain information
>PRK08887 nicotinic acid mononucleotide adenylyltransferase; Provisional Back     alignment and domain information
>cd02173 ECT CTP:phosphoethanolamine cytidylyltransferase (ECT) catalyzes the conversion of phosphoethanolamine to CDP-ethanolamine as part of the CDP#ethanolamine biosynthesis pathway Back     alignment and domain information
>PRK00168 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>smart00764 Citrate_ly_lig Citrate lyase ligase C-terminal domain Back     alignment and domain information
>PRK08099 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>TIGR00018 panC pantoate--beta-alanine ligase; InterPro: IPR003721 D-Pantothenate is synthesized via four enzymes from ketoisovalerate, which is an intermediate of branched-chain amino acid synthesis Back     alignment and domain information
>cd02169 Citrate_lyase_ligase Citrate lyase ligase, also known as [Citrate (pro-3S)-lyase] ligase, is responsible for acetylation of the (2-(5''-phosphoribosyl)-3'-dephosphocoenzyme-A) prosthetic group of the gamma subunit of citrate lyase, converting the inactive thiol form of this enzyme to the active form Back     alignment and domain information
>COG1057 NadD Nicotinic acid mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>COG0669 CoaD Phosphopantetheine adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01510 coaD_prev_kdtB pantetheine-phosphate adenylyltransferase; InterPro: IPR001980 Temperature-sensitive mutants of Escherichia coli, defective in the transfer of 3-deoxy-D-manno-octulosonic acid (KDO) from CMP-KDO to a tetraacyldisaccharide 1,4'-bisphosphate precursor of lipid A, have been used to map KDO transferase activity on the E Back     alignment and domain information
>COG2046 MET3 ATP sulfurylase (sulfate adenylyltransferase) [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG2870 RfaE ADP-heptose synthase, bifunctional sugar kinase/adenylyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13964 coaD phosphopantetheine adenylyltransferase; Provisional Back     alignment and domain information
>COG1323 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>COG3053 CitC Citrate lyase synthetase [Energy production and conversion] Back     alignment and domain information
>pfam01747 ATP-sulfurylase ATP-sulfurylase Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylytransferase; Provisional Back     alignment and domain information
>PRK05379 bifunctional nicotinamide mononucleotide adenylyltransferase/ADP-ribose pyrophosphatase; Provisional Back     alignment and domain information
>cd00517 ATPS ATP-sulfurylase (ATPS), also known as sulfate adenylate transferase, catalyzes the transfer of an adenylyl group from ATP to sulfate, forming adenosine 5'-phosphosulfate (APS) Back     alignment and domain information
>cd02168 NMNAT_Nudix This domain represents the N-terminal NMNAT (Nicotinamide/nicotinate mononucleotide adenylyltransferase) domain of a novel bifunctional enzyme endowed with NMN adenylyltransferase and #Nudix' hydrolase activities Back     alignment and domain information
>KOG3351 consensus Back     alignment and domain information
>COG1056 NadR Nicotinamide mononucleotide adenylyltransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK13793 nicotinamide-nucleotide adenylyltransferase; Provisional Back     alignment and domain information
>PRK04149 sat sulfate adenylyltransferase; Reviewed Back     alignment and domain information
>KOG2803 consensus Back     alignment and domain information
>PRK05537 bifunctional sulfate adenylyltransferase subunit 1/adenylylsulfate kinase protein; Validated Back     alignment and domain information
>TIGR01527 arch_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006418 This family of archaeal proteins exhibits NAD salvage biosynthesis enzyme nicotinamide-nucleotide adenylyltransferase (2 Back     alignment and domain information
>KOG2804 consensus Back     alignment and domain information
>pfam06574 FAD_syn FAD synthetase Back     alignment and domain information
>cd02039 cytidylyltransferase_like Cytidylyltransferase-like domain Back     alignment and domain information
>cd02156 nt_trans nt_trans (nucleotidyl transferase) This superfamily includes the class I amino-acyl tRNA synthetases, pantothenate synthetase (PanC), ATP sulfurylase, and the cytidylyltransferases, all of which have a conserved dinucleotide-binding domain Back     alignment and domain information
>cd02164 PPAT_CoAS The PPAT domain of the bifunctional enzyme with PPAT and DPCK functions Back     alignment and domain information
>TIGR01518 g3p_cytidyltrns glycerol-3-phosphate cytidylyltransferase; InterPro: IPR006409 These sequences describe glycerol-3-phosphate cytidyltransferase, also called CDP-glycerol pyrophosphorylase Back     alignment and domain information
>cd02158 PanC_ATPS PanC_ATPS Pantothenate synthetase (PanC) and ATP-sulfurylase (ATPS) share a similar dinucleotide-binding domain Back     alignment and domain information
>COG1019 Predicted nucleotidyltransferase [General function prediction only] Back     alignment and domain information
>PRK13477 bifunctional pantoate ligase/cytidylate kinase; Provisional Back     alignment and domain information
>pfam01467 CTP_transf_2 Cytidylyltransferase Back     alignment and domain information
>COG0414 PanC Panthothenate synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR01526 nadR_NMN_Atrans nicotinamide-nucleotide adenylyltransferase; InterPro: IPR006417 The NadR protein of Escherichia coli and closely related bacteria is both enzyme and regulatory protein Back     alignment and domain information
>PTZ00308 ethanolamine-phosphate cytidylytransferase; Provisional Back     alignment and domain information
>PRK13671 hypothetical protein; Provisional Back     alignment and domain information
>pfam05636 DUF795 Protein of unknown function (DUF795) Back     alignment and domain information
>PRK13670 hypothetical protein; Provisional Back     alignment and domain information
>KOG3042 consensus Back     alignment and domain information
>KOG2803 consensus Back     alignment and domain information
>pfam01687 Flavokinase Riboflavin kinase Back     alignment and domain information
>KOG3110 consensus Back     alignment and domain information
>TIGR00125 cyt_tran_rel cytidyltransferase-related domain; InterPro: IPR004821 Protein families that contain at least one copy of this domain include citrate lyase ligase, pantoate-beta-alanine ligase, glycerol-3-phosphate cytidyltransferase, ADP-heptose synthase, phosphocholine cytidylyltransferase, lipopolysaccharide core biosynthesis protein KdtB, the bifunctional protein NadR, and a number whose function is unknown Back     alignment and domain information
>TIGR00482 TIGR00482 nicotinate (nicotinamide) nucleotide adenylyltransferase; InterPro: IPR005248 This family contains the predominant bacterial/eukaryotic adenylyltransferases for nicotinamide-nucleotide and for the deamido form, nicotinate nucleotide Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target324 bifunctional riboflavin kinase/FMN adenylyltransferase
2x0k_A338 Crystal Structure Of Modular Fad Synthetase From Co 3e-50
3op1_A308 Crystal Structure Of Macrolide-Efflux Protein Sp_11 3e-43
1mrz_A293 Crystal Structure Of A Flavin Binding Protein From 1e-41
2i1l_A293 Crystal Structure Of The C2 Form Of Fad Synthetase 6e-41
1q9s_A149 Crystal Structure Of Riboflavin Kinase With Ternary 5e-17
1nb0_A147 Crystal Structure Of Human Riboflavin Kinase Length 5e-17
1n05_A163 Crystal Structure Of Schizosaccharomyces Pombe Ribo 2e-09
3bnw_A181 Crystal Structure Of Riboflavin Kinase From Trypano 2e-07
gi|296863357|pdb|2X0K|A Chain A, Crystal Structure Of Modular Fad Synthetase From Corynebacterium Ammoniagenes Length = 338 Back     alignment and structure
 Score =  203 bits (516), Expect = 3e-50,   Method: Composition-based stats.
 Identities = 85/325 (26%), Positives = 153/325 (47%), Gaps = 21/325 (6%)

Query: 1   MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIAN--NSPITVLSFNPH 58
           M +++      ++P  L    V IG FDG+H GH  ++   ++ A    +   +++F+PH
Sbjct: 1   MDIWYG---TAAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPH 57

Query: 59  PRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEV 118
           P ++         ++  + +  + E  G   ++   FT E +  S E++++ +L + L  
Sbjct: 58  PVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHA 117

Query: 119 KTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGH 178
             V+ G  F FG++ AG    L++  +     TV + +L +++   +SS+ +R  L++G 
Sbjct: 118 SHVVVGANFTFGENAAGTADSLRQICQSRL--TVDVIDLLDDEGVRISSTTVREFLSEGD 175

Query: 179 VLNAAHLLGYRFTIESDVIHGEKIGRTL-GFPTANMQLSPDI-LLKEGVYAIRFRT---- 232
           V  A   LG  F +   V+ G   G    GFPTAN      + L  +GVYA         
Sbjct: 176 VARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTE 235

Query: 233 -------QDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPE 285
                  + + +Y+   + G NPT   +    +ESF+ D   ++YG    V F D++R  
Sbjct: 236 APVSGNMEPEVAYAAAISVGTNPTF-GDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAM 294

Query: 286 IKFKDIEKLKIYMGEDEKKARKILE 310
            KF  +E+L   M +D +K R +L 
Sbjct: 295 EKFDSVEQLLEVMAKDVQKTRTLLA 319


>gi|307776578|pdb|3OP1|A Chain A, Crystal Structure Of Macrolide-Efflux Protein Sp_1110 From Streptococcus Pneumoniae Length = 308 Back     alignment and structure
gi|37926833|pdb|1MRZ|A Chain A, Crystal Structure Of A Flavin Binding Protein From Thermotoga Maritima, Tm379 Length = 293 Back     alignment and structure
>gi|119390018|pdb|2I1L|A Chain A, Crystal Structure Of The C2 Form Of Fad Synthetase From Thermotoga Maritima Length = 293 Back     alignment and structure
>gi|40889446|pdb|1Q9S|A Chain A, Crystal Structure Of Riboflavin Kinase With Ternary Product Complex Length = 149 Back     alignment and structure
>gi|29726587|pdb|1NB0|A Chain A, Crystal Structure Of Human Riboflavin Kinase Length = 147 Back     alignment and structure
gi|28948694|pdb|1N05|A Chain A, Crystal Structure Of Schizosaccharomyces Pombe Riboflavin Kinase Reveals A Novel Atp And Riboflavin Binding Fold Length = 163 Back     alignment and structure
>gi|164519581|pdb|3BNW|A Chain A, Crystal Structure Of Riboflavin Kinase From Trypanosoma Brucei Length = 181 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target324 bifunctional riboflavin kinase/FMN adenylyltransferase
2x0k_A338 Riboflavin biosynthesis protein RIBF; riboflavin kinase 2e-64
3op1_A308 Macrolide-efflux protein; structural genomics, PSI-2, p 8e-61
1mrz_A293 Riboflavin kinase/FMN adenylyltransferase; rossmann fol 7e-53
1nb0_A147 Hypothetical protein FLJ11149; beta barrel, transferase 9e-29
1n08_A163 Putative riboflavin kinase; phophoryl transferases, fla 1e-25
3bnw_A181 Riboflavin kinase, putative; APO structure, structural 3e-25
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl trans 2e-18
3do8_A148 Phosphopantetheine adenylyltransferase; protein with un 1e-08
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transferase, s 4e-08
3glv_A143 Lipopolysaccharide core biosynthesis protein; structura 4e-04
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; dinucl 4e-04
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltransferas 5e-04
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase; NAD 0.002
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-binding, multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Length = 338 Back     alignment and structure
 Score =  240 bits (614), Expect = 2e-64
 Identities = 86/329 (26%), Positives = 155/329 (47%), Gaps = 21/329 (6%)

Query: 1   MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIA--NNSPITVLSFNPH 58
           M +++      ++P  L    V IG FDG+H GH  ++   ++ A    +   +++F+PH
Sbjct: 1   MDIWYGTA---AVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPH 57

Query: 59  PRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEV 118
           P ++         ++  + +  + E  G   ++   FT E +  S E++++ +L + L  
Sbjct: 58  PVSVFLPRRAPLGITTLAERFALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHA 117

Query: 119 KTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGH 178
             V+ G  F FG++ AG    L++        TV + +L +++   +SS+ +R  L++G 
Sbjct: 118 SHVVVGANFTFGENAAGTADSLRQIC--QSRLTVDVIDLLDDEGVRISSTTVREFLSEGD 175

Query: 179 VLNAAHLLGYRFTIESDVIHGE-KIGRTLGFPTANMQLSPDILL-KEGVYAIRF------ 230
           V  A   LG  F +   V+ G  + G+ LGFPTAN      + L  +GVYA         
Sbjct: 176 VARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTE 235

Query: 231 -----RTQDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPE 285
                  + + +Y+   + G NPT   +    +ESF+ D   ++YG    V F D++R  
Sbjct: 236 APVSGNMEPEVAYAAAISVGTNPT-FGDEQRSVESFVLDRDADLYGHDVKVEFVDHVRAM 294

Query: 286 IKFKDIEKLKIYMGEDEKKARKILESSYP 314
            KF  +E+L   M +D +K R +L     
Sbjct: 295 EKFDSVEQLLEVMAKDVQKTRTLLAQDVQ 323


>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Length = 308 Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel, nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Length = 293 Back     alignment and structure
>1nb0_A Hypothetical protein FLJ11149; beta barrel, transferase; HET: ADP; 1.70A {Homo sapiens} SCOP: b.43.5.1 PDB: 1nb9_A* 1p4m_A* 1q9s_A* Length = 147 Back     alignment and structure
>1n08_A Putative riboflavin kinase; phophoryl transferases, flavin cofactors, metal binding; HET: ADP; 1.60A {Schizosaccharomyces pombe} SCOP: b.43.5.1 PDB: 1n05_A* 1n07_A* 1n06_A* Length = 163 Back     alignment and structure
>3bnw_A Riboflavin kinase, putative; APO structure, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP, transferase; 2.40A {Trypanosoma brucei} Length = 181 Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Length = 365 Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Length = 148 Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Length = 168 Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural genomics, PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Length = 143 Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacterthermautotrophicus} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Length = 181 Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltransferase; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesis; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3e27_A* 2qtn_A* 2qtm_A* Length = 189 Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Length = 189 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target324 bifunctional riboflavin kinase/FMN adenylyltransferase
2x0k_A338 Riboflavin biosynthesis protein RIBF; riboflavin kinase 100.0
3op1_A308 Macrolide-efflux protein; structural genomics, PSI-2, p 100.0
1mrz_A293 Riboflavin kinase/FMN adenylyltransferase; rossmann fol 100.0
1n08_A163 Putative riboflavin kinase; phophoryl transferases, fla 100.0
1nb0_A147 Hypothetical protein FLJ11149; beta barrel, transferase 100.0
3bnw_A181 Riboflavin kinase, putative; APO structure, structural 100.0
1lw7_A365 Transcriptional regulator NADR; NMN, NMN adenylyl trans 99.92
1ej2_A181 Nicotinamide mononucleotide adenylyltransferase; dinucl 99.15
3hl4_A236 Choline-phosphate cytidylyltransferase A; rossmann fold 99.14
3f3m_A168 Phosphopantetheine adenylyltransferase; PPAT, coenzyme 98.06
1m8p_A573 Sulfate adenylyltransferase; rossmann fold, phosphosulf 97.1
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, beta-b 97.03
2gks_A546 Bifunctional SAT/APS kinase; transferase, sulfurylase; 96.88
1jhd_A396 Sulfate adenylyltransferase; sulfurylase, APS, chemoaut 96.72
3cr8_A552 Sulfate adenylyltranferase, adenylylsulfate kinase; APS 96.59
1r6x_A395 ATP:sulfate adenylyltransferase; APS kinase-like domain 96.54
1x6v_B630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfate syn 95.66
3do8_A148 Phosphopantetheine adenylyltransferase; protein with un 99.55
3glv_A143 Lipopolysaccharide core biosynthesis protein; structura 99.53
2b7l_A132 Glycerol-3-phosphate cytidylyltransferase; rossmann fol 99.41
1coz_A129 Protein (glycerol-3-phosphate cytidylyltransferase); HE 99.3
1f9a_A168 Hypothetical protein MJ0541; alpha/beta, transferase, s 99.16
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 98.97
3n8h_A264 Pantothenate synthetase; alpha-beta sandwich, ligase, s 98.85
3elb_A341 Ethanolamine-phosphate cytidylyltransferase; kennedy pa 98.85
2ejc_A280 Pantoate--beta-alanine ligase; X-RAY diffraction, struc 98.85
3ag6_A283 Pantothenate synthetase; ATP-dependent enzyme, ATP-bind 98.85
3mxt_A285 Pantothenate synthetase; alpha-beta-alpha, structural g 98.83
1v8f_A276 Pantoate-beta-alanine ligase; rossmann fold, dimer, str 98.79
3inn_A314 Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, 98.78
2h29_A189 Probable nicotinate-nucleotide adenylyltransferase; NAD 98.74
3cov_A301 Pantothenate synthetase; pantothenate biosynthesis, enz 98.66
1kam_A194 Deamido-NAD(+), nicotinate-nucleotide adenylyltransfera 98.63
1iho_A283 Pantoate--beta-alanine ligase; rossman fold, dimer, APO 98.62
3h05_A177 Uncharacterized protein VPA0413; nucleotidylyl, transfe 98.56
2qjt_B352 Nicotinamide-nucleotide adenylyltransferase; two indivi 98.25
2qtr_A189 Nicotinate (nicotinamide) nucleotide adenylyltransferas 98.21
1od6_A160 PPAT, phosphopantetheine adenylyltransferase; coenzyme 98.1
1vlh_A173 Phosphopantetheine adenylyltransferase; TM0741, structu 98.07
1v47_A349 ATP sulfurylase; product binding complex, zinc, riken s 96.88
3gmi_A357 UPF0348 protein MJ0951; protein with unknown function, 98.56
1yum_A242 'probable nicotinate-nucleotide adenylyltransferase; al 98.43
1nup_A252 FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyri 98.37
2qjo_A341 Bifunctional NMN adenylyltransferase/nudix hydrolase; t 98.32
1kqn_A279 Nmnat, nicotinamide mononucleotide adenylyl transferase 98.21
3guz_A176 Pantothenate synthetase; pantothenate biosynthesis, sub 97.67
3k9w_A170 Phosphopantetheine adenylyltransferase; niaid, ssgcid, 98.11
3nbk_A177 Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: 98.0
1qjc_A158 Phosphopantetheine adenylyltransferase; coenzyme A bios 97.74
1o6b_A169 Phosphopantetheine adenylyltransferase; structural geno 97.73
1k4m_A213 NAMN adenylyltransferase; nucleotidyltransferase; HET: 97.65
>2x0k_A Riboflavin biosynthesis protein RIBF; riboflavin kinase, nucleotide-binding, transferase, ATP-binding, multifunctional enzyme; 1.95A {Corynebacterium ammoniagenes} Back     alignment and structure
Probab=100.00  E-value=0  Score=715.50  Aligned_cols=310  Identities=28%  Similarity=0.508  Sum_probs=287.7

Q ss_pred             CEEECCCCCCCCCCCCCCCEEEEEECCCCCCHHHHHHHHHHHHHHC--CCCEEEEEECCCHHHHHCCCCCCCCCCHHHHH
Q ss_conf             9422488521127610188499993156502899999999999502--79779998379868984788866200007899
Q gi|254780846|r    1 MHVFHNIEINQSLPNHLKGGVVAIGNFDGIHLGHHLILEQAIKIAN--NSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQ   78 (324)
Q Consensus         1 Mki~~~~~~~~~~p~~~~~~vvtiG~FDGvH~GHq~Li~~~~~~a~--~~~~~viTF~p~P~~~~~~~~~~~~l~~~~~k   78 (324)
                      |||||++   .++|.+.++||||||+|||||+|||+||+++++.|+  +.+++|+||+|||+.++.++..+.+|++.++|
T Consensus         1 M~i~~~~---~~ip~~~~~svvtIG~FDGvHlGHq~Li~~~~~~A~~~~~~~~viTF~phP~~~~~~~~~~~~l~~~~ek   77 (338)
T 2x0k_A            1 MDIWYGT---AAVPKDLDNSAVTIGVFDGVHRGHQKLINATVEKAREVGAKAIMVTFDPHPVSVFLPRRAPLGITTLAER   77 (338)
T ss_dssp             CEEEESG---GGSCTTCCCEEEEESCCTTCCHHHHHHHHHHHHHHHHHTCEEEEEEESSCHHHHHSTTCSCCBSSCHHHH
T ss_pred             CEEEECH---HHCCCCCCCCEEEEECCCCCCHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHCCCCCCHHHHHHHHH
T ss_conf             9799566---6778446991999972733248999999999999997299889999459899980976775012457999


Q ss_pred             HHHHHHCCCCCCCCCCCHHHHHHCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCEEEECCHHH
Q ss_conf             99885113100022564057752283026888621427802999834553033775560246775101264167615223
Q gi|254780846|r   79 EKILEKMGFSALIRYKFTLETANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELR  158 (324)
Q Consensus        79 ~~~l~~~Gid~vi~~~F~~~~a~ls~e~Fi~~iL~~~l~~k~ivVG~Df~FG~~r~Gd~~~L~~~~~~~g~~v~~i~~~~  158 (324)
                      .++|+++|+|++++++||+++++|||++|++++|.+.++++.||||+|||||++|+||+++|+++|+.. +.+.+++++.
T Consensus        78 ~~~l~~~gid~~~~i~F~~~~a~ls~e~Fi~~il~~~l~~k~ivvG~Df~FG~~r~G~~~~L~~~~~~~-~~~~~i~~~~  156 (338)
T 2x0k_A           78 FALAESFGIDGVLVIDFTRELSGTSPEKYVEFLLEDTLHASHVVVGANFTFGENAAGTADSLRQICQSR-LTVDVIDLLD  156 (338)
T ss_dssp             HHHHHHTTCSEEEEECTTTSSSSCCHHHHHHHCCCCCTCEEEEEEETTCEESGGGCEEHHHHHHHTTTT-SEEEEECCCE
T ss_pred             HHHHHHCCCCEEEEECHHHHHHCCCHHHHHHHHHHHHCCCEEEEEECCCCCCCCCCCCHHHHHHHCCCC-CEEEEEEEEE
T ss_conf             999875499889995027876327988899999873037339999455444300477699999854567-3688641140


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHCCCC-CCEEEEEEEEEEHHCCC-CCCHHHHEEEEEE----
Q ss_conf             02333023036899987258999998500000000012210020-11011111211000022-2310110002476----
Q gi|254780846|r  159 NNKSQIVSSSNIRTALTKGHVLNAAHLLGYRFTIESDVIHGEKI-GRTLGFPTANMQLSPDI-LLKEGVYAIRFRT----  232 (324)
Q Consensus       159 ~~~~~~ISSt~IR~~l~~Gdi~~an~lLGr~y~i~G~Vv~G~~~-Gr~lGfPTaNi~~~~~~-~p~~GVY~~~v~~----  232 (324)
                       .++++||||+||++|++|||+.||+||||||+|+|+|+||+++ ||+||||||||.+++.. +|+.||||++|.+    
T Consensus       157 -~~~~~ISST~IR~~i~~G~i~~A~~lLGr~y~i~G~Vv~G~~~~Gr~lGfPTANl~~~~~~~~P~~GVYa~~v~i~~~~  235 (338)
T 2x0k_A          157 -DEGVRISSTTVREFLSEGDVARANWALGRHFYVTGPVVRGAGRGGKELGFPTANQYFHDTVALPADGVYAGWLTILPTE  235 (338)
T ss_dssp             -ETTEECSHHHHHHHHHTTCHHHHHHHHTSCCEEEEECBCCSSCSSSCTTSCSEEEEECTTBCCCCSEEEEEEEEECSCC
T ss_pred             -CCCCEECHHHHHHHHHCCCHHHHHHHCCCCEEEEEEEEECCCCCCCEECCCCCCCCCCCCCCCCCCCEEEEEEEEECCC
T ss_conf             -5882303899999998698988888669987999999977640664534655002574201467654388999981455


Q ss_pred             -------EECCCCCHHCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCEEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHH
Q ss_conf             -------3056562110578997267797149999940678551898899994600008874689899999999979999
Q gi|254780846|r  233 -------QDQTSYSGVANFGRNPTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKA  305 (324)
Q Consensus       233 -------~~~~~~~~v~niG~~PT~~~~~~~~iE~hildf~~dlYg~~i~v~f~~~iR~e~kF~s~~~L~~qI~~D~~~a  305 (324)
                             .++.+|+||+|||.||||++ ..+++|||||||++||||++|+|+|++|||||+||+|+|+|++||++|++.|
T Consensus       236 ~~~~g~~~~~~~y~g~~niG~~PT~~~-~~~~iE~hildf~~dlYgk~i~V~f~~~iR~e~kF~s~eeL~~QI~~Di~~a  314 (338)
T 2x0k_A          236 APVSGNMEPEVAYAAAISVGTNPTFGD-EQRSVESFVLDRDADLYGHDVKVEFVDHVRAMEKFDSVEQLLEVMAKDVQKT  314 (338)
T ss_dssp             SCCEESCCTTCEEEEEEEEEEETTTCT-TEEEEEEEETTCCEECTTCEEEEEEEEEEECCCCCSSHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCCCCEEEEEEECCCCCCCCC-CCEEEEEEECCCCCCCCCCEEEEEEHHHCCCCCCCCCHHHHHHHHHHHHHHH
T ss_conf             532354478834655887577997589-7478999863788760897799995772379988399999999999999999


Q ss_pred             HHHHHHCCCCC
Q ss_conf             99987448721
Q gi|254780846|r  306 RKILESSYPLS  316 (324)
Q Consensus       306 ~~~l~~~~~~~  316 (324)
                      |++|++....+
T Consensus       315 k~~l~~~~~~~  325 (338)
T 2x0k_A          315 RTLLAQDVQAH  325 (338)
T ss_dssp             HHHHHHHHHST
T ss_pred             HHHHHHHHHHC
T ss_conf             99997555642



>3op1_A Macrolide-efflux protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PEG; 2.49A {Streptococcus pneumoniae} Back     alignment and structure
>1mrz_A Riboflavin kinase/FMN adenylyltransferase; rossmann fold, flavin binding domain, 6-stranded beta barrel, nucleotide binding domain; HET: CIT; 1.90A {Thermotoga maritima} SCOP: b.43.5.1 c.26.1.3 PDB: 1s4m_A* 1t6x_A* 1t6y_A* 1t6z_A* 2i1l_A Back     alignment and structure
>1n08_A Putative riboflavin kinase; phophoryl transferases, flavin cofactors, metal binding; HET: ADP; 1.60A {Schizosaccharomyces pombe} SCOP: b.43.5.1 PDB: 1n05_A* 1n07_A* 1n06_A* Back     alignment and structure
>1nb0_A Hypothetical protein FLJ11149; beta barrel, transferase; HET: ADP; 1.70A {Homo sapiens} SCOP: b.43.5.1 PDB: 1nb9_A* 1p4m_A* 1q9s_A* Back     alignment and structure
>3bnw_A Riboflavin kinase, putative; APO structure, structural genomics, structural genomics of pathogenic protozoa consortium, SGPP, transferase; 2.40A {Trypanosoma brucei} Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide kinase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1ej2_A Nicotinamide mononucleotide adenylyltransferase; dinucleotide binding fold, structural genomics, PSI; HET: NAD; 1.90A {Methanothermobacterthermautotrophicus} SCOP: c.26.1.3 PDB: 1m8g_A* 1hyb_A* 1m8j_A* 1m8f_A* 1m8k_A* Back     alignment and structure
>3hl4_A Choline-phosphate cytidylyltransferase A; rossmann fold, phospholipid synthesis, phosphatidylcholine, phosphocholine, CTP, CDP-choline; HET: CDC; 2.20A {Rattus norvegicus} Back     alignment and structure
>3f3m_A Phosphopantetheine adenylyltransferase; PPAT, coenzyme A biosynthetic pathway, coenzyme A biosynthesis, cytoplasm, nucleotidyltransferase; HET: PPS; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>1jhd_A Sulfate adenylyltransferase; sulfurylase, APS, chemoautotroph, bromide; 1.70A {Sulfur-oxidizing endosymbiont ofriftia pachyptila} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>1r6x_A ATP:sulfate adenylyltransferase; APS kinase-like domain; 1.40A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3do8_A Phosphopantetheine adenylyltransferase; protein with unknown function, structural genomics, MCSG, PSI-2, protein structure initiative; 1.60A {Archaeoglobus fulgidus} Back     alignment and structure
>3glv_A Lipopolysaccharide core biosynthesis protein; structural genomics, PSI, MCSG, protein structure initiative; HET: AMP; 1.99A {Thermoplasma volcanium GSS1} Back     alignment and structure
>2b7l_A Glycerol-3-phosphate cytidylyltransferase; rossmann fold; 3.00A {Staphylococcus aureus} Back     alignment and structure
>1coz_A Protein (glycerol-3-phosphate cytidylyltransferase); HET: CTP; 2.00A {Bacillus subtilis} SCOP: c.26.1.2 PDB: 1n1d_A* Back     alignment and structure
>1f9a_A Hypothetical protein MJ0541; alpha/beta, transferase, structural genomics; HET: ATP; 2.00A {Methanocaldococcus jannaschii} SCOP: c.26.1.3 Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>3n8h_A Pantothenate synthetase; alpha-beta sandwich, ligase, structural genomics, structural of infectious diseases; HET: MSE AMP GOL; 2.00A {Francisella tularensis subsp} Back     alignment and structure
>3elb_A Ethanolamine-phosphate cytidylyltransferase; kennedy pathway, CMP, CTP, phosphoethanolamine, SGC, structural genomics consortium; HET: C5P; 2.00A {Homo sapiens} Back     alignment and structure
>2ejc_A Pantoate--beta-alanine ligase; X-RAY diffraction, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.40A {Thermotoga maritima} Back     alignment and structure
>3ag6_A Pantothenate synthetase; ATP-dependent enzyme, ATP-binding, nucleotide-binding, pantothenate biosynthesis; HET: PAJ PG4; 1.85A {Staphylococcus aureus} PDB: 3ag5_A* 2x3f_A* Back     alignment and structure
>3mxt_A Pantothenate synthetase; alpha-beta-alpha, structural genomics, center for structural of infectious diseases, csgid, ligase; HET: MSE; 1.85A {Campylobacter jejuni subsp} Back     alignment and structure
>1v8f_A Pantoate-beta-alanine ligase; rossmann fold, dimer, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: P6G; 1.90A {Thermus thermophilus} SCOP: c.26.1.4 PDB: 1ufv_A Back     alignment and structure
>3inn_A Pantothenate synthetase; ssgcid, SBRI, UW, decode, NIH, niaid, pantoate beta alanine ligase, ATP-binding, cytoplasm, ligase; HET: ATP; 2.10A {Brucella melitensis} Back     alignment and structure
>2h29_A Probable nicotinate-nucleotide adenylyltransferase; NADD, namnat, nmnat; HET: DND; 2.00A {Staphylococcus aureus} PDB: 2h2a_A* Back     alignment and structure
>3cov_A Pantothenate synthetase; pantothenate biosynthesis, enzymes, ligase, drug design, ATP-binding, cytoplasm, magnesium, metal-binding; 1.50A {Mycobacterium tuberculosis} SCOP: c.26.1.4 PDB: 3cow_A* 3coy_A* 3coz_A* 3imc_A* 3ime_A* 3img_A* 3iob_A* 3ioc_A* 3iod_A* 3ioe_A* 3iub_A* 3iue_A* 3ivc_A* 3ivg_A* 3ivx_A* 2a84_A* 1n2b_A* 1n2e_A* 1n2g_A* 1n2h_A* ... Back     alignment and structure
>1kam_A Deamido-NAD(+), nicotinate-nucleotide adenylyltransferase; rossman fold; 2.10A {Bacillus subtilis} SCOP: c.26.1.3 PDB: 1kaq_A* Back     alignment and structure
>1iho_A Pantoate--beta-alanine ligase; rossman fold, dimer, APO, high, KSMKS, flexible domains, multidomain; 1.70A {Escherichia coli} SCOP: c.26.1.4 PDB: 3mue_A Back     alignment and structure
>3h05_A Uncharacterized protein VPA0413; nucleotidylyl, transferase, MCSG, midwest center for structural genomics, PSI; 1.65A {Vibrio parahaemolyticus} Back     alignment and structure
>2qjt_B Nicotinamide-nucleotide adenylyltransferase; two individual domains, hydrolase; HET: AMP; 2.30A {Francisella tularensis} PDB: 2r5w_B Back     alignment and structure
>2qtr_A Nicotinate (nicotinamide) nucleotide adenylyltransferase; NAD, nucleotidyltransferase, pyridine nucleotide biosynthesis; HET: NXX; 1.70A {Bacillus anthracis} PDB: 3dv2_A 3mla_A* 3hfj_A* 3mlb_A* 3mmx_A* 3e27_A* 2qtn_A* 2qtm_A* Back     alignment and structure
>1od6_A PPAT, phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.5A {Thermus thermophilus} SCOP: c.26.1.3 Back     alignment and structure
>1vlh_A Phosphopantetheine adenylyltransferase; TM0741, structural genomics, JCSG, protein structure initiative, PSI; HET: PNS; 2.20A {Thermotoga maritima} SCOP: c.26.1.3 Back     alignment and structure
>1v47_A ATP sulfurylase; product binding complex, zinc, riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; HET: ADX; 2.49A {Thermus thermophilus} SCOP: b.122.1.3 c.26.1.5 Back     alignment and structure
>3gmi_A UPF0348 protein MJ0951; protein with unknown function, structural genomics, PSI, MCSG, protein structure initiative; 1.91A {Methanocaldococcus jannaschii DSM2661} Back     alignment and structure
>1yum_A 'probable nicotinate-nucleotide adenylyltransferase; alpha/beta domain; HET: CIT NCN; 1.70A {Pseudomonas aeruginosa} PDB: 1yul_A* 1yun_A* Back     alignment and structure
>1nup_A FKSG76; NAD biosynthesis, cytoplasm, mitochondria, pyridine adenylyltransferase, enzyme catalysi; HET: NMN; 1.90A {Homo sapiens} SCOP: c.26.1.3 PDB: 1nuq_A* 1nur_A 1nus_A* 1nut_A* 1nuu_A* Back     alignment and structure
>2qjo_A Bifunctional NMN adenylyltransferase/nudix hydrolase; two individual domains; HET: APR NAD; 2.60A {Synechocystis SP} Back     alignment and structure
>1kqn_A Nmnat, nicotinamide mononucleotide adenylyl transferase; nucleotidyltransferase superfamily; HET: NAD; 2.20A {Homo sapiens} SCOP: c.26.1.3 PDB: 1kqo_A* 1kr2_A* 1kku_A 1gzu_A* Back     alignment and structure
>3guz_A Pantothenate synthetase; pantothenate biosynthesis, substrate binding, competitive inhibition, rossmann fold; HET: PAF; 1.67A {Escherichia coli} Back     alignment and structure
>3k9w_A Phosphopantetheine adenylyltransferase; niaid, ssgcid, seattle structural genomics center for infectious disease, coenzyme A; HET: 4PS ADE PG4; 1.60A {Burkholderia pseudomallei 1710B} PDB: 3ikz_A* Back     alignment and structure
>3nbk_A Phosphopantetheine adenylyltransferase; PPAT, PHP; HET: PNS; 1.58A {Mycobacterium tuberculosis} PDB: 3nba_A* 3lcj_A* 1tfu_A Back     alignment and structure
>1qjc_A Phosphopantetheine adenylyltransferase; coenzyme A biosynthesis, nucleotidyltransferase; HET: PNS; 1.64A {Escherichia coli} SCOP: c.26.1.3 PDB: 1h1t_A* 1gn8_A* 1b6t_A* 3l92_A* 3l93_A Back     alignment and structure
>1o6b_A Phosphopantetheine adenylyltransferase; structural genomics; HET: ADP; 2.20A {Bacillus subtilis} SCOP: c.26.1.3 Back     alignment and structure
>1k4m_A NAMN adenylyltransferase; nucleotidyltransferase; HET: NAD CIT; 1.90A {Escherichia coli} SCOP: c.26.1.3 PDB: 1k4k_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 324 bifunctional riboflavin kinase/FMN adenylyltransferase
d1mrza1130 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunc 5e-26
d1nb9a_147 b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [ 1e-23
d1n08a_154 b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizos 9e-23
d1mrza2157 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bi 4e-17
d1lw7a1163 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN 7e-17
d1ej2a_167 c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenyly 1e-04
>d1mrza1 b.43.5.1 (A:159-288) Riboflavin kinase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Length = 130 Back     information, alignment and structure

class: All beta proteins
fold: Reductase/isomerase/elongation factor common domain
superfamily: Riboflavin kinase-like
family: ATP-dependent riboflavin kinase-like
domain: Riboflavin kinase domain of bifunctional FAD synthetase
species: Thermotoga maritima [TaxId: 2336]
 Score =  112 bits (281), Expect = 5e-26
 Identities = 46/124 (37%), Positives = 65/124 (52%), Gaps = 2/124 (1%)

Query: 190 FTIESDVIHGEKIGRTLGFPTANMQLSPD--ILLKEGVYAIRFRTQDQTSYSGVANFGRN 247
           F IE  V    + GR LGFPTAN+    +  + LK GVY +R    D     GV N G  
Sbjct: 2   FEIEGIVHKDREFGRKLGFPTANIDRGNEKLVDLKRGVYLVRVHLPDGKKKFGVMNVGFR 61

Query: 248 PTMVPNGPLLLESFIFDFSQEIYGQRCTVSFFDYLRPEIKFKDIEKLKIYMGEDEKKARK 307
           PT+     +  E +I DF  ++YGQR  +    ++R E KF  IE+LK  + +D K AR 
Sbjct: 62  PTVGDARNVKYEVYILDFEGDLYGQRLKLEVLKFMRDEKKFDSIEELKAAIDQDVKSARN 121

Query: 308 ILES 311
           +++ 
Sbjct: 122 MIDD 125


>d1nb9a_ b.43.5.1 (A:) Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]} Length = 147 Back     information, alignment and structure
>d1n08a_ b.43.5.1 (A:) Riboflavin kinase {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 154 Back     information, alignment and structure
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Length = 157 Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Length = 163 Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 167 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target324 bifunctional riboflavin kinase/FMN adenylyltransferase
d1mrza2157 FMN adenylyltransferase domain of bifunctional FAD synt 100.0
d1coza_126 CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus 99.3
d1lw7a1163 Transcriptional regulator NadR, NMN-adenylyltransferase 99.25
d1f9aa_164 Nicotinamide mononucleotide (NMN) adenylyltransferase { 99.18
d1ej2a_167 Nicotinamide mononucleotide (NMN) adenylyltransferase { 98.91
d1v8fa_276 Pantothenate synthetase (Pantoate-beta-alanine ligase, 98.78
d1ihoa_282 Pantothenate synthetase (Pantoate-beta-alanine ligase, 98.55
d1jhda2223 ATP sulfurylase catalytic domain {Sulfur-oxidizing endo 98.55
d2a84a1286 Pantothenate synthetase (Pantoate-beta-alanine ligase, 98.53
d1kama_189 Nicotinamide mononucleotide (NMN) adenylyltransferase { 98.51
d1o6ba_163 Phosphopantetheine adenylyltransferase {Bacillus subtil 98.12
d1x6va2235 ATP sulfurylase catalytic domain {Human (Homo sapiens) 97.62
d1g8fa2221 ATP sulfurylase catalytic domain {Baker's yeast (Saccha 97.41
d1v47a2214 ATP sulfurylase catalytic domain {Thermus thermophilus 96.88
d1n08a_154 Riboflavin kinase {Fission yeast (Schizosaccharomyces p 100.0
d1mrza1130 Riboflavin kinase domain of bifunctional FAD synthetase 100.0
d1nb9a_147 Riboflavin kinase {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1nuua_233 Cytosolic NMN/NAMN adenylyltransferase {Human (Homo sap 98.37
d1kr2a_271 Nicotinamide mononucleotide (NMN) adenylyltransferase { 98.27
d1tfua_157 Phosphopantetheine adenylyltransferase {Mycobacterium t 98.15
d1od6a_160 Phosphopantetheine adenylyltransferase {Thermus thermop 98.07
d1k4ma_213 Nicotinamide mononucleotide (NMN) adenylyltransferase { 98.04
d1qjca_157 Phosphopantetheine adenylyltransferase {Escherichia col 97.93
d1vlha_157 Phosphopantetheine adenylyltransferase {Thermotoga mari 97.81
>d1mrza2 c.26.1.3 (A:2-158) FMN adenylyltransferase domain of bifunctional FAD synthetase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Nucleotidylyl transferase
family: Adenylyltransferase
domain: FMN adenylyltransferase domain of bifunctional FAD synthetase
species: Thermotoga maritima [TaxId: 2336]
Probab=100.00  E-value=3.5e-44  Score=305.22  Aligned_cols=155  Identities=28%  Similarity=0.468  Sum_probs=137.2

Q ss_pred             EEEEECCCCCCHHHHHHHHHHHHHHC--CCCEEEEEECCCHHHHHCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCHHH
Q ss_conf             99993156502899999999999502--7977999837986898478886620000789999885113100022564057
Q gi|254780846|r   21 VVAIGNFDGIHLGHHLILEQAIKIAN--NSPITVLSFNPHPRTIIQSSSPIFTLSPPSIQEKILEKMGFSALIRYKFTLE   98 (324)
Q Consensus        21 vvtiG~FDGvH~GHq~Li~~~~~~a~--~~~~~viTF~p~P~~~~~~~~~~~~l~~~~~k~~~l~~~Gid~vi~~~F~~~   98 (324)
                      |+|||+|||+|+|||+||+++++.|+  +.+++|+||+|||..+ .++.+ ..+++.++|.++|+++|++  ++++|+ +
T Consensus         1 VvtiG~FDGvH~GHq~li~~~~~~a~~~~~~~~v~tf~~~p~~~-~~~~~-~~l~~~~~k~~~l~~~g~~--~~l~f~-~   75 (157)
T d1mrza2           1 VVSIGVFDGVHIGHQKVLRTMKEIAFFRKDDSLIYTISYPPEYF-LPDFP-GLLMTVESRVEMLSRYART--VVLDFF-R   75 (157)
T ss_dssp             CEEEECCTTCCHHHHHHHHHHHHHHHHHTCCCEEEEESSCGGGG-STTCC-CBSSCHHHHHHHHTTTSCE--EEECHH-H
T ss_pred             CEEEECCCCHHHHHHHHHHHHHHHHHHCCCCCEEEECCCCCHHE-EECCC-CCCCCHHHHHHHHHCCCCE--EEEHHH-H
T ss_conf             98997261045899999999999999729985676427882314-74166-5444477765554303430--221256-6


Q ss_pred             HHHCCCHHHHHHHHCCCCCEEEEEECCCCCCCCCCCCCHHHHHHHHHCCCCEEEECCHHHCCCCCCCCHHHHHHHHHHHH
Q ss_conf             75228302688862142780299983455303377556024677510126416761522302333023036899987258
Q gi|254780846|r   99 TANYSAEQFIQKVLVEWLEVKTVITGTKFRFGKDRAGDRGILQKRGEKYGFHTVFIDELRNNKSQIVSSSNIRTALTKGH  178 (324)
Q Consensus        99 ~a~ls~e~Fi~~iL~~~l~~k~ivVG~Df~FG~~r~Gd~~~L~~~~~~~g~~v~~i~~~~~~~~~~ISSt~IR~~l~~Gd  178 (324)
                      +++|||++|++++|.   +++.||||+||+||++|+||+++|++    +|+++.+++++.. ++++||||+||++|.+||
T Consensus        76 ~~~ls~~~Fi~~~l~---~~~~ivvG~Df~FG~~r~G~~~~Lk~----~g~~v~~i~~~~~-~~~~ISST~IR~~l~~G~  147 (157)
T d1mrza2          76 IKDLTPEGFVERYLS---GVSAVVVGRDFRFGKNASGNASFLRK----KGVEVYEIEDVVV-QGKRVSSSLIRNLVQEGR  147 (157)
T ss_dssp             HTTCCHHHHHHHHCT---TCCEEEEETTCCBSGGGCBCHHHHHH----TTCEEEEECCCEE-TTEECCHHHHHHHHHTTC
T ss_pred             HHHHHHHHHHHHHHH---CCCEEEEECCCCCCCCCCCCHHHHCC----CEEEEEEECCEEE-CCCEECHHHHHHHHHCCC
T ss_conf             765406678998863---27389995574004444555455325----2058996145851-991895999999998499


Q ss_pred             HHHHHHHHHH
Q ss_conf             9999985000
Q gi|254780846|r  179 VLNAAHLLGY  188 (324)
Q Consensus       179 i~~an~lLGr  188 (324)
                      |+.||+||||
T Consensus       148 i~~A~~lLGR  157 (157)
T d1mrza2         148 VEEIPAYLGR  157 (157)
T ss_dssp             TTTTHHHHSS
T ss_pred             HHHHHHHCCC
T ss_conf             9999985399



>d1coza_ c.26.1.2 (A:) CTP:glycerol-3-phosphate cytidylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lw7a1 c.26.1.3 (A:57-219) Transcriptional regulator NadR, NMN-adenylyltransferase domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1f9aa_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ej2a_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1v8fa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ihoa_ c.26.1.4 (A:) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jhda2 c.26.1.5 (A:174-396) ATP sulfurylase catalytic domain {Sulfur-oxidizing endosymbiont of Riftia pachyptila [TaxId: 35843]} Back     information, alignment and structure
>d2a84a1 c.26.1.4 (A:3-288) Pantothenate synthetase (Pantoate-beta-alanine ligase, PanC) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kama_ c.26.1.3 (A:) Nicotinamide mononucleotide (NMN) adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1o6ba_ c.26.1.3 (A:) Phosphopantetheine adenylyltransferase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1x6va2 c.26.1.5 (A:390-624) ATP sulfurylase catalytic domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure