254780847

254780847

hypothetical protein CLIBASIA_03710

GeneID in NCBI database:8209860Locus tag:CLIBASIA_03710
Protein GI in NCBI database:254780847Protein Accession:YP_003065260.1
Gene range:-(817204, 818052)Protein Length:282aa
Gene description:hypothetical protein
COG prediction:[G] Predicted sugar phosphatases of the HAD superfamily
KEGG prediction:hypothetical protein
SEED prediction:HAD superfamily protein involved in N-acetyl-glucosamine catabolism
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280--
MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
cccHHHHHHHHHHHccEEEEEcccEEEccccccHHHHHHHHHHHHcccEEEEEEcccccHHHHHHHHHHcccccccHHHEEcHHHHHHHHHHccccEEEEEccHHHHHHHHHccccccccccccEEEEEEcccccccHHHHHHHHHHHHHHcccEEEEEcccccccccccccccccHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHcccccHHHEEEEcccHHHHHHHHHHccccEEEEccccccHHHcccccccHHHHHHHHHcccccccEEccccc
cccccccHHHHHHHccEEEEEcccEEEccccccHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHcccccccHHHEEcHHHHHHHHHHHcccEEEEEccccHHHHHHHcccEEEccccccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEcccccccccccccccHHHHHHHHHHccccEEEEccccHHHHHHHHHHHHHHcccccHcEEEEEccccHHHHHHHHHccccEEEEEcccccHHHHccccccHHHHHHHHHHccccccEEccccc
mtkeitslrtilpyYDVILCDVwgvlhngqkflpgtipALKEARENGLKVILftnsprpsasVISQIQslgsssqfwddiitsgdlthhllveeshniffigpqRDYALLEKLNIKIVNEQHAETILCtglyddekdkTEDYRMLLERFAHrhiplicanpdivanrgnkiiPCAGALALIYQQLNGIVkmigkphlpIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDAlyvsdgihrheylfndnIDAQMLQNFftkknlyphWWIQQLI
mtkeitslrtilPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETIlctglyddekDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSAsvisqiqslgsssqFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
******SLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
****ITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI
MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNEQHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target282 hypothetical protein CLIBASIA_03710 [Candidatus Liberib
315122729282 hypothetical protein CKC_04905 [Candidatus Liberibacter 1 1e-135
15888027282 hypothetical protein Atu0684 [Agrobacterium tumefaciens 1 3e-78
163758405282 hypothetical protein HPDFL43_02230 [Hoeflea phototrophi 1 2e-77
325292067321 hydrolase protein, HAD superfamily [Agrobacterium sp. H 1 6e-77
227820991282 HAD-superfamily hydrolase, subfamily IIA [Sinorhizobium 1 2e-75
218673796282 putative hydrolase protein, HAD superfamily [Rhizobium 1 2e-75
222085006282 hydrolase [Agrobacterium radiobacter K84] Length = 282 1 3e-75
150395635282 HAD family hydrolase [Sinorhizobium medicae WSM419] Len 1 1e-74
218509039282 putative hydrolase protein, HAD superfamily [Rhizobium 1 3e-74
15964548282 hypothetical protein SMc00910 [Sinorhizobium meliloti 1 1 4e-74
>gi|315122729|ref|YP_004063218.1| hypothetical protein CKC_04905 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 282 Back     alignment and organism information
 Score =  486 bits (1252), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 225/282 (79%), Positives = 257/282 (91%)

Query: 1   MTKEITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPS 60
           MTKEI+SL  I P+YD+ILCDVWGVLHNGQK  PG+IPAL++ARENGLK+IL TNSPRPS
Sbjct: 1   MTKEISSLCQISPFYDIILCDVWGVLHNGQKLFPGSIPALQKARENGLKIILLTNSPRPS 60

Query: 61  ASVISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHNIFFIGPQRDYALLEKLNIKIVNE 120
           ASVIS IQSLGSS +FWDDIITSGDLTHHLL +ESHNIFFIGP RD  LLE LN+K+V+E
Sbjct: 61  ASVISHIQSLGSSQKFWDDIITSGDLTHHLLAKESHNIFFIGPDRDRVLLENLNVKVVDE 120

Query: 121 QHAETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALAL 180
           Q+AETI+CTGLY+DE +K EDYR+LLE FA R+IP ICANPDI+ANRGNK++PCAGALAL
Sbjct: 121 QYAETIICTGLYNDETEKPEDYRILLEPFARRNIPFICANPDILANRGNKVVPCAGALAL 180

Query: 181 IYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDA 240
           IYQQLNGI+KM+GKPHLPIYEMAFKKIS+LCNS +KKRILAIGDGM+TDIKGALQSGIDA
Sbjct: 181 IYQQLNGIIKMVGKPHLPIYEMAFKKISTLCNSLDKKRILAIGDGMETDIKGALQSGIDA 240

Query: 241 LYVSDGIHRHEYLFNDNIDAQMLQNFFTKKNLYPHWWIQQLI 282
           LYVS GIH HEY  N+ I+AQMLQNFF +KNL+PHWWI++LI
Sbjct: 241 LYVSQGIHTHEYSANNKIEAQMLQNFFIRKNLHPHWWIRELI 282


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888027|ref|NP_353708.1| hypothetical protein Atu0684 [Agrobacterium tumefaciens str. C58] Length = 282 Back     alignment and organism information
>gi|163758405|ref|ZP_02165493.1| hypothetical protein HPDFL43_02230 [Hoeflea phototrophica DFL-43] Length = 282 Back     alignment and organism information
>gi|325292067|ref|YP_004277931.1| hydrolase protein, HAD superfamily [Agrobacterium sp. H13-3] Length = 321 Back     alignment and organism information
>gi|227820991|ref|YP_002824961.1| HAD-superfamily hydrolase, subfamily IIA [Sinorhizobium fredii NGR234] Length = 282 Back     alignment and organism information
>gi|218673796|ref|ZP_03523465.1| putative hydrolase protein, HAD superfamily [Rhizobium etli GR56] Length = 282 Back     alignment and organism information
>gi|222085006|ref|YP_002543535.1| hydrolase [Agrobacterium radiobacter K84] Length = 282 Back     alignment and organism information
>gi|150395635|ref|YP_001326102.1| HAD family hydrolase [Sinorhizobium medicae WSM419] Length = 282 Back     alignment and organism information
>gi|218509039|ref|ZP_03506917.1| putative hydrolase protein, HAD superfamily [Rhizobium etli Brasil 5] Length = 282 Back     alignment and organism information
>gi|15964548|ref|NP_384901.1| hypothetical protein SMc00910 [Sinorhizobium meliloti 1021] Length = 282 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target282 hypothetical protein CLIBASIA_03710 [Candidatus Liberib
TIGR01460236 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamil 7e-36
TIGR01459242 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA h 7e-33
KOG2882306 KOG2882, KOG2882, KOG2882, p-Nitrophenyl phosphatase [I 2e-13
TIGR01457249 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily I 8e-08
KOG3040262 KOG3040, KOG3040, KOG3040, Predicted sugar phosphatase 2e-07
PRK10444248 PRK10444, PRK10444, UMP phosphatase; Provisional 4e-05
COG0647269 COG0647, NagD, Predicted sugar phosphatases of the HAD 1e-50
TIGR01452279 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphat 7e-08
cd01427139 cd01427, HAD_like, Haloacid dehalogenase-like hydrolase 8e-08
TIGR02253221 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrola 0.001
TIGR01509183 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfam 0.002
PLN02887580 PLN02887, PLN02887, hydrolase family protein 3e-04
PRK10530272 PRK10530, PRK10530, pyridoxal phosphate (PLP) phosphata 0.003
PRK09449224 PRK09449, PRK09449, dUMP phosphatase; Provisional 8e-04
COG1011229 COG1011, COG1011, Predicted hydrolase (HAD superfamily) 0.002
TIGR02254224 TIGR02254, YjjG/YfnB, HAD superfamily (subfamily IA) hy 0.003
>gnl|CDD|162373 TIGR01460, HAD-SF-IIA, Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>gnl|CDD|130526 TIGR01459, HAD-SF-IIA-hyp4, HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>gnl|CDD|38093 KOG2882, KOG2882, KOG2882, p-Nitrophenyl phosphatase [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|130524 TIGR01457, HAD-SF-IIA-hyp2, HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>gnl|CDD|38250 KOG3040, KOG3040, KOG3040, Predicted sugar phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|182466 PRK10444, PRK10444, UMP phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|30992 COG0647, NagD, Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|162369 TIGR01452, PGP_euk, phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>gnl|CDD|119389 cd01427, HAD_like, Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>gnl|CDD|162787 TIGR02253, CTE7, HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>gnl|CDD|162395 TIGR01509, HAD-SF-IA-v3, haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>gnl|CDD|178475 PLN02887, PLN02887, hydrolase family protein Back     alignment and domain information
>gnl|CDD|182523 PRK10530, PRK10530, pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|181865 PRK09449, PRK09449, dUMP phosphatase; Provisional Back     alignment and domain information
>gnl|CDD|31215 COG1011, COG1011, Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>gnl|CDD|162788 TIGR02254, YjjG/YfnB, HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 282 hypothetical protein CLIBASIA_03710 [Candidatus Liberib
COG0647269 NagD Predicted sugar phosphatases of the HAD superfamil 100.0
PRK10444248 UMP phosphatase; Provisional 100.0
TIGR01457251 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase 100.0
TIGR01452288 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatas 100.0
KOG2882306 consensus 100.0
TIGR01458258 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase 100.0
KOG3040262 consensus 100.0
TIGR01456325 CECR5 HAD-superfamily subfamily IIA hydrolase, TIGR0145 100.0
PRK06769175 hypothetical protein; Validated 99.63
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 99.43
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomocyste 98.18
TIGR01459243 HAD-SF-IIA-hyp4 HAD-superfamily subfamily IIA hydrolase 100.0
TIGR01460304 HAD-SF-IIA HAD-superfamily hydrolase, subfamily IIA; In 100.0
KOG1618389 consensus 100.0
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. The hal 99.75
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validated 99.63
TIGR02254233 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIG 99.61
TIGR01662171 HAD-SF-IIIA hydrolase, HAD-superfamily, subfamily IIIA; 99.17
COG0241181 HisB Histidinol phosphatase and related phosphatases [A 99.13
TIGR01993205 Pyr-5-nucltdase pyrimidine 5'-nucleotidase; InterPro: I 98.91
TIGR01428207 HAD_type_II haloacid dehalogenase, type II; InterPro: I 98.79
TIGR00213178 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase; Int 98.33
TIGR01548245 HAD-SF-IA-hyp1 HAD superfamily (subfamily IA) hydrolase 98.21
COG4229229 Predicted enolase-phosphatase [Energy production and co 96.0
TIGR01482247 SPP-subfamily Sucrose-phosphate phosphatase subfamily; 95.67
TIGR01422199 phosphonatase phosphonoacetaldehyde hydrolase; InterPro 95.67
COG2217713 ZntA Cation transport ATPase [Inorganic ion transport a 92.86
TIGR01664239 DNA-3'-Pase DNA 3'-phosphatase; InterPro: IPR006551 The 90.73
TIGR02253244 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR0225 99.82
PRK13227228 consensus 99.77
PRK13222228 phosphoglycolate phosphatase; Provisional 99.74
PRK13223272 phosphoglycolate phosphatase; Provisional 99.73
PRK13288214 pyrophosphatase PpaX; Provisional 99.72
PRK13228232 consensus 99.68
PRK10748238 flavin mononucleotide phosphatase; Provisional 99.67
PRK09449225 nucleotidase; Provisional 99.66
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade of s 99.6
PRK13225273 phosphoglycolate phosphatase; Provisional 98.9
TIGR01454206 AHBA_synth_RP AHBA synthesis associated protein; InterP 93.49
PRK13229234 consensus 99.72
PRK13226221 phosphoglycolate phosphatase; Provisional 99.67
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 99.62
PRK13224216 consensus 99.56
PRK11587218 putative phosphatase; Provisional 99.47
KOG3085237 consensus 99.45
COG0546220 Gph Predicted phosphatases [General function prediction 99.41
TIGR01449230 PGP_bact phosphoglycolate phosphatase, bacterial; Inter 99.32
pfam00702190 Hydrolase haloacid dehalogenase-like hydrolase. This fa 99.26
COG0637221 Predicted phosphatase/phosphohexomutase [General functi 99.09
TIGR02252224 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydro 99.05
PRK09456199 phosphatase; Provisional 98.94
TIGR02009211 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase; 98.94
TIGR01509156 HAD-SF-IA-v3 HAD-superfamily hydrolase, subfamily IA, v 98.85
TIGR01990190 bPGM beta-phosphoglucomutase; InterPro: IPR010972 This 98.8
KOG3109244 consensus 98.62
KOG2914222 consensus 98.58
TIGR02247228 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like ph 98.2
KOG2961190 consensus 97.94
PRK10563221 6-phosphogluconate phosphatase; Provisional 99.5
PRK10725188 fructose-1-phosphatase; Provisional 99.41
COG1011229 Predicted hydrolase (HAD superfamily) [General function 99.39
pfam09419166 DUF2010 Protein of unknown function. This is a family o 99.39
COG2179175 Predicted hydrolase of the HAD superfamily [General fun 99.1
TIGR01668196 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phospha 99.04
TIGR01549151 HAD-SF-IA-v1 HAD-superfamily hydrolase, subfamily IA, v 98.85
pfam08645158 PNK3P Polynucleotide kinase 3 phosphatase. Polynucleoti 98.81
TIGR02244402 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolas 97.58
TIGR01261165 hisB_Nterm histidinol-phosphatase; InterPro: IPR005954 97.37
TIGR01656208 Histidinol-ppas histidinol-phosphate phosphatase family 97.13
TIGR00338223 serB phosphoserine phosphatase SerB; InterPro: IPR00446 95.76
TIGR01685183 MDP-1 magnesium-dependent phosphatase-1; InterPro: IPR0 91.6
PRK05446354 imidazole glycerol-phosphate dehydratase/histidinol pho 99.13
pfam05116247 S6PP Sucrose-6F-phosphate phosphohydrolase. This family 98.52
PRK10513270 sugar phosphatase; Provisional 98.33
TIGR01533295 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family; In 98.29
PRK01158226 phosphoglycolate phosphatase; Provisional 98.19
pfam08282254 Hydrolase_3 haloacid dehalogenase-like hydrolase. This 98.19
TIGR01487223 SPP-like SPP-like hydrolase, Archaeal; InterPro: IPR006 98.18
COG0561264 Cof Predicted hydrolases of the HAD superfamily [Genera 98.05
PRK00192275 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.97
PRK10530272 phosphotransferase; Provisional 97.83
COG2503274 Predicted secreted acid phosphatase [General function p 97.69
TIGR00099270 Cof-subfamily Cof-like hydrolase; InterPro: IPR000150 T 97.62
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.61
PRK10976266 putative sugar phosphatase; Provisional 97.55
pfam03767230 Acid_phosphat_B HAD superfamily, subfamily IIIB (Acid p 97.55
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 97.39
TIGR02463224 MPGP_rel mannosyl-3-phosphoglycerate phosphatase homolo 97.33
TIGR02461248 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase; 97.27
TIGR02253244 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR0225 96.53
TIGR01484261 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB; In 96.3
COG4850373 Uncharacterized conserved protein [Function unknown] 96.1
PRK13222228 phosphoglycolate phosphatase; Provisional 96.09
PTZ00174247 phosphomannomutase; Provisional 95.97
PRK13226221 phosphoglycolate phosphatase; Provisional 95.89
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharomyces 95.85
COG1778170 Low specificity phosphatase (HAD superfamily) [General 95.78
PRK13227228 consensus 95.76
PRK13228232 consensus 95.69
PRK13223272 phosphoglycolate phosphatase; Provisional 95.64
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade of s 95.63
PRK13288214 pyrophosphatase PpaX; Provisional 95.53
COG3769274 Predicted hydrolase (HAD superfamily) [General function 95.43
PRK13224216 consensus 95.36
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 95.3
PRK13229234 consensus 95.21
pfam08235156 LNS2 LNS2 (Lipin/Ned1/Smp2). This domain is found in Sa 95.12
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 94.92
pfam03031151 NIF NLI interacting factor-like phosphatase. This famil 94.35
PRK11587218 putative phosphatase; Provisional 94.05
PRK13225273 phosphoglycolate phosphatase; Provisional 92.34
COG0637221 Predicted phosphatase/phosphohexomutase [General functi 92.25
pfam00702190 Hydrolase haloacid dehalogenase-like hydrolase. This fa 91.78
PRK05301375 pyrroloquinoline quinone biosynthesis protein PqqE; Pro 91.14
COG0546220 Gph Predicted phosphatases [General function prediction 90.91
TIGR01675245 plant-AP plant acid phosphatase; InterPro: IPR010028 Th 90.21
COG1011229 Predicted hydrolase (HAD superfamily) [General function 90.2
COG2179175 Predicted hydrolase of the HAD superfamily [General fun 97.81
PRK09484186 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; P 97.72
TIGR01668196 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phospha 97.54
pfam06437404 ISN1 IMP-specific 5'-nucleotidase. The Saccharomyces ce 97.33
TIGR01428207 HAD_type_II haloacid dehalogenase, type II; InterPro: I 96.2
TIGR02252224 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydro 95.09
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphat 95.05
TIGR01663526 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterP 94.01
TIGR01261165 hisB_Nterm histidinol-phosphatase; InterPro: IPR005954 93.31
cd06295275 PBP1_CelR Ligand binding domain of a transcription regu 92.01
TIGR01684323 viral_ppase viral phosphatase; InterPro: IPR007827 This 90.98
pfam05761448 5_nucleotid 5' nucleotidase family. This family of euka 97.32
TIGR02254233 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIG 96.09
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 95.44
pfam05152297 DUF705 Protein of unknown function (DUF705). This famil 90.37
PRK09449225 nucleotidase; Provisional 95.63
TIGR01681179 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC 94.06
PRK10671834 copA copper exporting ATPase; Provisional 90.93
TIGR01656208 Histidinol-ppas histidinol-phosphate phosphatase family 94.94
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB; Pro 94.78
cd01543265 PBP1_XylR Ligand-binding domain of DNA transcription re 93.39
TIGR02108314 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; Inter 90.82
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457; InterPro: IPR006354 These sequences are all members of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family; InterPro: IPR006349 This family of sequences represent 2-phosphoglycolate phosphatase which is limited to the eukaryotic lineage Back     alignment and domain information
>KOG2882 consensus Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458; InterPro: IPR006355 These sequences are all members of the IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>KOG3040 consensus Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily subfamily IIA hydrolase, TIGR01456, CECR5; InterPro: IPR006353 This hypothetical equivalog is a member of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily subfamily IIA hydrolase, TIGR01459; InterPro: IPR006356 These sequences are all members of the Class IIA subfamily of the haloacid dehalogenase superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01460 HAD-SF-IIA HAD-superfamily hydrolase, subfamily IIA; InterPro: IPR006357 These sequences form one of the structural subclass of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>KOG1618 consensus Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254; InterPro: IPR011951 This family consists of uncharacterised proteobacterial and Gram-positive bacterial sequences including YjjG from Escherichia coli and YfnB from Bacillus subtilis Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA hydrolase, HAD-superfamily, subfamily IIIA; InterPro: IPR006549 This group of proteins is a part of the haloacid dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase; InterPro: IPR010237 This family of proteins includes the SDT1/SSM1 gene from yeast, which has been shown to code for a pyrimidine (UMP/CMP) 5'nucleotidase Back     alignment and domain information
>TIGR01428 HAD_type_II haloacid dehalogenase, type II; InterPro: IPR006328 These proteins catalyze the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase; InterPro: IPR004446 In a number of species, including Escherichia coli, the histidine biosynthetic enzymes imidazole glycerol phosphate dehydratase and histidinol phosphatase are found together in the bifunctional protein HisB Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 HAD superfamily (subfamily IA) hydrolase, TIGR01548; InterPro: IPR006438 This entry represents a small and phylogenetically curious clade of sequences Back     alignment and domain information
>COG4229 Predicted enolase-phosphatase [Energy production and conversion] Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily; InterPro: IPR006378 This family of sequences includes both the members of the sucrose-phosphate phosphatase (SPP) family, encompassing plants and cyanobacteria, as well as those archaeal sequences which are the closest relatives Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase; InterPro: IPR006323 These sequences represent an enzyme that catalyzes the cleavage of the carbon phosphorous bond of a phosphonate Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase; InterPro: IPR006551 These proteins catalyse the dephosphorylation of DNA 3'-phosphates Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253; InterPro: IPR011950 This family of sequences from archaea and metazoans includes the human uncharacterised protein CTE7 Back     alignment and domain information
>PRK13227 consensus Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PRK13228 consensus Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PRK09449 nucleotidase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP AHBA synthesis associated protein; InterPro: IPR006351 The enzymes in this family are all located in the operons for the biosynthesis of 3-amino-5-hydroxybenzoic acid (AHBA), which is a precursor of several antibiotics including ansatrienin , naphthomycin , rifamycin and mitomycin Back     alignment and domain information
>PRK13229 consensus Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>PRK13224 consensus Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>KOG3085 consensus Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01449 PGP_bact phosphoglycolate phosphatase, bacterial; InterPro: IPR006346 This family of sequences represent 2-phosphoglycolate phosphatase which is limited to the prokaryotes Back     alignment and domain information
>pfam00702 Hydrolase haloacid dehalogenase-like hydrolase Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase; InterPro: IPR011949 This family of proteins includes uncharacterised sequences from eukaryotes, cyanobacteria and Leptospira as well as the DREG-2 protein from Drosophila melanogaster which has been identified as a rhythmically (diurnally) regulated gene Back     alignment and domain information
>PRK09456 phosphatase; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase; InterPro: IPR010976 Phosphoglucomutases interconvert D-glucose 1-phosphate and D-glucose 6-phosphate, a reaction which is important for energy metabolism in many organisms and for cell wall biosynthesis in bacteria , Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 HAD-superfamily hydrolase, subfamily IA, variant 3; InterPro: IPR006402 This group of sequences represent part of one structural subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase; InterPro: IPR010972 This model represents the beta-phosphoglucomutase enzyme which catalyses the interconversion of beta-D-glucose-1-phosphate and beta-D-glucose-6-phosphate Back     alignment and domain information
>KOG3109 consensus Back     alignment and domain information
>KOG2914 consensus Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase; InterPro: IPR011945 This entry represents a small clade of sequences from the metazoa and bacteria Back     alignment and domain information
>KOG2961 consensus Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK10725 fructose-1-phosphatase; Provisional Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>pfam09419 DUF2010 Protein of unknown function Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 HAD-superfamily hydrolase, subfamily IA, variant 1; InterPro: IPR006439 This family represents part of one structural subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>pfam08645 PNK3P Polynucleotide kinase 3 phosphatase Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase; InterPro: IPR008380 This family includes a 5'-nucleotidase, 3 Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase; InterPro: IPR005954 This entry describes a histidinol phosphatase domain Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain; InterPro: IPR006543 This is a group of authentic histidinol-phosphate phosphatases which are sometimes found as stand-alone entities and sometimes as fusions with imidazoleglycerol-phosphate dehydratase Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB; InterPro: IPR004469 Phosphoserine phosphatase (SerB), (3 Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>pfam05116 S6PP Sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK10513 sugar phosphatase; Provisional Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family; InterPro: IPR006423 This group of sequences represents a set of bacterial lipoproteins belonging to a larger acid phosphatase family, which in turn belongs to the haloacid dehalogenase (HAD) superfamily of aspartate-dependent hydrolases Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>pfam08282 Hydrolase_3 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR01487 SPP-like SPP-like hydrolase, Archaeal; InterPro: IPR006382 This group of Archaeal sequences is most closely related to the sucrose-phosphate phosphatases (SPP) from plants and cyanobacteria Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10530 phosphotransferase; Provisional Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof-like hydrolase; InterPro: IPR000150 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10976 putative sugar phosphatase; Provisional Back     alignment and domain information
>pfam03767 Acid_phosphat_B HAD superfamily, subfamily IIIB (Acid phosphatase) Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase homolog; InterPro: IPR012815 This family consists of members of the HAD superfamily, subfamily IIB Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase; InterPro: IPR012813 Members of this family are mannosyl-3-phosphoglycerate phosphatase (3 Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253; InterPro: IPR011950 This family of sequences from archaea and metazoans includes the human uncharacterised protein CTE7 Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB; InterPro: IPR006379 This subfamily falls within the Haloacid Dehalogenase (HAD) superfamily of aspartate-nucleophile hydrolases Back     alignment and domain information
>COG4850 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK13227 consensus Back     alignment and domain information
>PRK13228 consensus Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK13224 consensus Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>PRK13229 consensus Back     alignment and domain information
>pfam08235 LNS2 LNS2 (Lipin/Ned1/Smp2) Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>pfam03031 NIF NLI interacting factor-like phosphatase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>pfam00702 Hydrolase haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK05301 pyrroloquinoline quinone biosynthesis protein PqqE; Provisional Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase; InterPro: IPR010028 This entry represents a family of acid phosphatase , from plants which are closely related to the class B non-specific acid phosphatase OlpA (IPR006423 from INTERPRO, which is believed to be a 5'-nucleotide phosphatase) and somewhat more distantly to another class B phosphatase, AphA (IPR010025 from INTERPRO) Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>pfam06437 ISN1 IMP-specific 5'-nucleotidase Back     alignment and domain information
>TIGR01428 HAD_type_II haloacid dehalogenase, type II; InterPro: IPR006328 These proteins catalyze the hydrolytic dehalogenation of small L-2-haloalkanoic acids to yield the corresponding D-2-hydroxyalkanoic acids Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase; InterPro: IPR011949 This family of proteins includes uncharacterised sequences from eukaryotes, cyanobacteria and Leptospira as well as the DREG-2 protein from Drosophila melanogaster which has been identified as a rhythmically (diurnally) regulated gene Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family; InterPro: IPR010023 This entry is a part of the haloacid dehalogenase (HAD) superfamily of hydrolases from beta, gamma and epsilon proteobacteria, Aquifex, Fusobacterium, Porphyromonas and Methanosarcina Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide kinase 3'-phosphatase; InterPro: IPR006550 These sequences represent the metazoan 5'-polynucleotide-kinase-3'-phosphatase, PNKP, which is believed to be involved in repair of oxidative DNA damage Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase; InterPro: IPR005954 This entry describes a histidinol phosphatase domain Back     alignment and domain information
>cd06295 PBP1_CelR Ligand binding domain of a transcription regulator of cellulose genes, CelR, which is highly homologous to the LacI-GalR family of bacterial transcription regulators Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase; InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>pfam05761 5_nucleotid 5' nucleotidase family Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254; InterPro: IPR011951 This family consists of uncharacterised proteobacterial and Gram-positive bacterial sequences including YjjG from Escherichia coli and YfnB from Bacillus subtilis Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>pfam05152 DUF705 Protein of unknown function (DUF705) Back     alignment and domain information
>PRK09449 nucleotidase; Provisional Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC; InterPro: IPR010033 This entry represents the IIIC subfamily of the Haloacid Dehalogenase (HAD) superfamily of aspartate nucleophile hydrolases Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain; InterPro: IPR006543 This is a group of authentic histidinol-phosphate phosphatases which are sometimes found as stand-alone entities and sometimes as fusions with imidazoleglycerol-phosphate dehydratase Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>cd01543 PBP1_XylR Ligand-binding domain of DNA transcription repressor specific for xylose (XylR) Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; InterPro: IPR011842 This entry describes coenzyme PQQ biosynthesis protein B, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target282 hypothetical protein CLIBASIA_03710 [Candidatus Liberib
1zjj_A263 Crystal Structure Of Hypothetical Protein Ph1952 Fr 5e-33
3pdw_A266 Crystal Structure Of Putative P-Nitrophenyl Phospha 4e-32
1vjr_A271 Crystal Structure Of 4-Nitrophenylphosphatase (Tm17 2e-29
2cfs_A298 Crystal Structure Of Human Pyridoxal 5'-Phosphate P 3e-29
1pw5_A253 Putative Nagd Protein Length = 253 3e-29
1ys9_A254 Crystal Sructure Of Phosphatase Spy1043 From Strept 3e-29
1yv9_A264 Crystal Structure Of A Had-Like Phosphatase From En 7e-29
3epr_A264 Crystal Structure Of Putative Had Superfamily Hydro 9e-29
1wvi_A257 Crystal Structure Of Putative Phosphatase From Stre 1e-27
1ydf_A257 Crystal Structure Of A Had-Like Phosphatase From St 1e-27
2oyc_A306 Crystal Structure Of Human Pyridoxal Phosphate Phos 2e-27
2cfr_A298 Crystal Structure Of Human Pyridoxal 5'-Phosphate P 2e-27
2c4n_A250 Nagd From E.Coli K-12 Strain Length = 250 8e-26
3qgm_A268 P-Nitrophenyl Phosphatase From Archaeoglobus Fulgid 1e-24
2hx1_A284 Crystal Structure Of Possible Sugar Phosphatase, Ha 4e-24
3hlt_A266 The Crystal Structure Of Human Haloacid Dehalogenas 7e-24
2ho4_A259 Crystal Structure Of Protein From Mouse Mm.236127 L 7e-22
2x4d_A271 Crystal Structure Of Human Phospholysine Phosphohis 2e-17
2hoq_A241 Crystal Structure Of The Probable Haloacid Dehaloge 7e-08
2w4m_A270 The Crystal Structure Of Human N-Acetylneuraminic A 1e-04
2gfh_A260 Crystal Structure Of A N-Acetylneuraminic Acid Phos 3e-04
3ed5_A238 The Crystal Structure Of Yfnb From Bacillus Subtili 7e-04
3i76_A244 The Crystal Structure Of The Orthorhombic Form Of T 0.001
3kc2_A352 Crystal Structure Of Mitochondrial Had-Like Phospha 3e-09
1wr8_A231 Crystal Structure Of Hypothetical Protein Ph1421 Fr 0.004
3kc2_A352 Crystal Structure Of Mitochondrial Had-Like Phospha 2e-05
gi|99031688|pdb|1ZJJ|A Chain A, Crystal Structure Of Hypothetical Protein Ph1952 From Pyrococcus Horikoshii Ot3 Length = 263 Back     alignment and structure
 Score =  145 bits (366), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 57/257 (22%), Positives = 96/257 (37%), Gaps = 20/257 (7%)

Query: 17  VILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTNSPRPSASVISQIQSLGSSSQF 76
            I+ D+ GVL+ G + +PG    ++  +E G+     TN+   +  +  +          
Sbjct: 3   AIIFDMDGVLYRGNRAIPGVRELIEFLKERGIPFAFLTNNSTKTPEMYREKLLKMGIDVS 62

Query: 77  WDDIITSGDLTHHLLVEE--SHNIFFIGPQRDYALLEKLNIKI-------VNEQHAETIL 127
              IITSG  T   + +      IF IG +     ++ L   I                +
Sbjct: 63  SSIIITSGLATRLYMSKHLDPGKIFVIGGEGLVKEMQALGWGIVTLDEARQGSWKEVKHV 122

Query: 128 CTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRGNKIIPCAGALALIYQ-QLN 186
             GL  D   +   Y  L           I  NPD        I P AG++    +   N
Sbjct: 123 VVGLDPDLTYEKLKYATL---AIRNGATFIGTNPDATLPGEEGIYPGAGSIIAALKVATN 179

Query: 187 GIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKGALQSGIDALYVSDG 246
               +IGKP+ P+YE+  +           + +  +GD +DTDI  A + G+ A+ V  G
Sbjct: 180 VEPIIIGKPNEPMYEVVREMF-------PGEELWMVGDRLDTDIAFAKKFGMKAIMVLTG 232

Query: 247 IHRHEYLFNDNIDAQML 263
           +   E +        ++
Sbjct: 233 VSSLEDIKKSEYKPDLV 249


>gi|312208187|pdb|3PDW|A Chain A, Crystal Structure Of Putative P-Nitrophenyl Phosphatase From Bacillus Subtilis Length = 266 Back     alignment and structure
>gi|47169464|pdb|1VJR|A Chain A, Crystal Structure Of 4-Nitrophenylphosphatase (Tm1742) From Thermotoga Maritima At 2.40 A Resolution Length = 271 Back     alignment and structure
>gi|134104092|pdb|2CFS|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 Back     alignment and structure
>gi|46015261|pdb|1PW5|A Chain A, Putative Nagd Protein Length = 253 Back     alignment and structure
>gi|61680815|pdb|1YS9|A Chain A, Crystal Sructure Of Phosphatase Spy1043 From Streptococcus Pyogenes Length = 254 Back     alignment and structure
>gi|62738782|pdb|1YV9|A Chain A, Crystal Structure Of A Had-Like Phosphatase From Enterococcus Faecalis V583 Length = 264 Back     alignment and structure
>gi|211939431|pdb|3EPR|A Chain A, Crystal Structure Of Putative Had Superfamily Hydrolase From Streptococcus Agalactiae Length = 264 Back     alignment and structure
gi|58177248|pdb|1WVI|A Chain A, Crystal Structure Of Putative Phosphatase From Streptococcus Mutans Ua159 Length = 257 Back     alignment and structure
>gi|60594279|pdb|1YDF|A Chain A, Crystal Structure Of A Had-Like Phosphatase From Streptococcus Pneumoniae Length = 257 Back     alignment and structure
>gi|145580318|pdb|2OYC|A Chain A, Crystal Structure Of Human Pyridoxal Phosphate Phosphatase Length = 306 Back     alignment and structure
>gi|134104091|pdb|2CFR|A Chain A, Crystal Structure Of Human Pyridoxal 5'-Phosphate Phosphatase Length = 298 Back     alignment and structure
gi|88192540|pdb|2C4N|A Chain A, Nagd From E.Coli K-12 Strain Length = 250 Back     alignment and structure
>gi|322812811|pdb|3QGM|A Chain A, P-Nitrophenyl Phosphatase From Archaeoglobus Fulgidus Length = 268 Back     alignment and structure
>gi|114794601|pdb|2HX1|A Chain A, Crystal Structure Of Possible Sugar Phosphatase, Had Superfamily (Zp_00311070.1) From Cytophaga Hutchinsonii Atcc 33406 At 2.10 A Resolution Length = 284 Back     alignment and structure
>gi|251837027|pdb|3HLT|A Chain A, The Crystal Structure Of Human Haloacid Dehalogenase-Like Hydrolase Domain Containing 2 (Hdhd2) Length = 266 Back     alignment and structure
>gi|114794442|pdb|2HO4|A Chain A, Crystal Structure Of Protein From Mouse Mm.236127 Length = 259 Back     alignment and structure
>gi|291191016|pdb|2X4D|A Chain A, Crystal Structure Of Human Phospholysine Phosphohistidine Inorganic Pyrophosphate Phosphatase Lhpp Length = 271 Back     alignment and structure
gi|152149087|pdb|2HOQ|A Chain A, Crystal Structure Of The Probable Haloacid Dehalogenase (Ph1655) From Pyrococcus Horikoshii Ot3 Length = 241 Back     alignment and structure
>gi|218766562|pdb|2W4M|A Chain A, The Crystal Structure Of Human N-Acetylneuraminic Acid Phosphatase, Nanp Length = 270 Back     alignment and structure
>gi|99032497|pdb|2GFH|A Chain A, Crystal Structure Of A N-Acetylneuraminic Acid Phosphatase (Nanp) From Mus Musculus At 1.90 A Resolution Length = 260 Back     alignment and structure
>gi|203282553|pdb|3ED5|A Chain A, The Crystal Structure Of Yfnb From Bacillus Subtilis Subsp. Subtilis Str. 168 Length = 238 Back     alignment and structure
>gi|254575079|pdb|3I76|A Chain A, The Crystal Structure Of The Orthorhombic Form Of The Putative Had-Hydrolase Yfnb From Bacillus Subtilis Bound To Magnesium Reveals Interdomain Movement Length = 244 Back     alignment and structure
>gi|269914581|pdb|3KC2|A Chain A, Crystal Structure Of Mitochondrial Had-Like Phosphatase From Saccharomyces Cerevisiae Length = 352 Back     alignment and structure
gi|56554398|pdb|1WR8|A Chain A, Crystal Structure Of Hypothetical Protein Ph1421 From Pyrococcus Horikoshii. Length = 231 Back     alignment and structure
>gi|269914581|pdb|3KC2|A Chain A, Crystal Structure Of Mitochondrial Had-Like Phosphatase From Saccharomyces Cerevisiae Length = 352 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target282 hypothetical protein CLIBASIA_03710 [Candidatus Liberib
2hx1_A284 Predicted sugar phosphatases of the HAD superfamily; ZP 2e-31
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomics, PS 7e-28
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase fold, 2e-27
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitochondral 6e-26
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genomics, 2e-25
3epr_A264 Hydrolase, haloacid dehalogenase-like family; structura 6e-25
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; struc 2e-23
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypothetical p 2e-23
2ho4_A259 Haloacid dehalogenase-like hydrolase domain containing 3e-20
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfamily, 1e-19
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic pyropho 5e-17
1rkq_A282 Hypothetical protein YIDA; two domain structure with be 3e-04
2b30_A301 Pvivax hypothetical protein; SGPP, structural genomics, 7e-04
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosph 0.004
3dao_A283 Putative phosphatse; RER070207001050, structural genomi 0.004
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Length = 284 Back     alignment and structure
 Score =  131 bits (330), Expect = 2e-31
 Identities = 63/259 (24%), Positives = 97/259 (37%), Gaps = 12/259 (4%)

Query: 4   EITSLRTILPYYDVILCDVWGVLHNGQKFLPGTIPALKEARENGLKVILFTN-SPRPSAS 62
           +I S +++LP Y  I  D +GVL      LPG        +  G    + TN + R    
Sbjct: 3   QIESFKSLLPKYKCIFFDAFGVLKTYNGLLPGIENTFDYLKAQGQDYYIVTNDASRSPEQ 62

Query: 63  VISQIQSLGSSSQFWDDIITSGDLTHHLLVEESHN--IFFIGPQRDYALLEKLNIKIVNE 120
           +      LG  S   D II+SG +T   +  +     + ++G       L    IK++  
Sbjct: 63  LADSYHKLGLFSITADKIISSGMITKEYIDLKVDGGIVAYLGTANSANYLVSDGIKMLPV 122

Query: 121 QH------AETILCTGLYDDEKDKTEDYRMLLERFAHRHIPLICANPDIVANRG--NKII 172
                    E      L D+  +   D    +     R IP I AN D        +  I
Sbjct: 123 SAIDDSNIGEVNALVLLDDEGFNWFHDLNKTVNLLRKRTIPAIVANTDNTYPLTKTDVAI 182

Query: 173 PCAGALALIYQQLNGIVKMIGKPHLPIYEMAFKKISSLCNSFNKKRILAIGDGMDTDIKG 232
              G   +I   L       GKP   ++  A+  +       +K+ IL +GD + TDI G
Sbjct: 183 AIGGVATMIESILGRRFIRFGKPDSQMFMFAYDMLRQKME-ISKREILMVGDTLHTDILG 241

Query: 233 ALQSGIDALYVSDGIHRHE 251
             + G+D   V  G  R +
Sbjct: 242 GNKFGLDTALVLTGNTRID 260


>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} Length = 266 Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genomics; 1.85A {Pyrococcus horikoshii OT3} Length = 263 Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomics, protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} Length = 352 Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Length = 271 Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydrolase., PSI-2; 1.55A {Streptococcus agalactiae serogroup V} PDB: 1ys9_A 1wvi_A 1ydf_A Length = 264 Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Length = 306 Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, structural genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis V583} SCOP: c.108.1.14 Length = 264 Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Length = 259 Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Length = 250 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophosphate phosphatase; hydrolase; 1.92A {Homo sapiens} Length = 271 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Length = 282 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Length = 301 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Length = 275 Back     alignment and structure
>3dao_A Putative phosphatse; RER070207001050, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Length = 283 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target282 hypothetical protein CLIBASIA_03710 [Candidatus Liberib
2hx1_A284 Predicted sugar phosphatases of the HAD superfamily; ZP 100.0
3kc2_A352 Uncharacterized protein YKR070W; HAD-like, mitochondral 100.0
2oyc_A306 PLP phosphatase, pyridoxal phosphate phosphatase; struc 100.0
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase fold, 100.0
3epr_A264 Hydrolase, haloacid dehalogenase-like family; structura 100.0
2ho4_A259 Haloacid dehalogenase-like hydrolase domain containing 100.0
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypothetical p 100.0
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfamily, 100.0
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomics, PS 100.0
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genomics, 100.0
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic pyropho 100.0
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD supe 99.71
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding pr 99.7
2o2x_A218 Hypothetical protein; NP_103874.1, structural genomics, 99.62
3ib6_A189 Uncharacterized protein; structural genomics, unknown f 99.59
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; histi 99.58
2oda_A196 Hypothetical protein pspto_2114; haloacid dehalogenase, 99.4
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP_5999 99.36
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, B-ha 99.71
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC60149, 99.68
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1, str 99.64
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD famil 99.63
1x42_A232 Hypothetical protein PH0459; haloacid dehalogenase, str 99.6
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogenase, s 99.6
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_639141. 99.6
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; structur 99.59
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, struc 99.56
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 3D-st 99.54
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid deha 99.53
3iru_A277 Phoshonoacetaldehyde hydolase like protein; phosphonoac 99.52
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapie 99.51
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structural g 99.47
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition state ana 99.42
2go7_A207 Hydrolase, haloacid dehalogenase-like family; structura 99.42
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant 1; ssg 99.42
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabolism, 99.39
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase domai 99.38
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; structura 99.35
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural geno 99.28
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, stru 99.25
2zg6_A220 Putative uncharacterized protein ST2620, probable 2-hal 99.23
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkbhstru 95.85
2iye_A263 Copper-transporting ATPase; hydrolase, P-type ATPase, C 91.6
3k1z_A263 Haloacid dehalogenase-like hydrolase domain- containing 99.69
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 99.64
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily 99.64
2gfh_A260 Haloacid dehalogenase-like hydrolase domain containing 99.6
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomona 99.59
1qyi_A384 ZR25, hypothetical protein; structural genomics, PSI, p 99.58
1te2_A226 Putative phosphatase; structural genomics, phosphates, 99.57
2hsz_A243 Novel predicted phosphatase; structural genomics, joint 99.54
3e58_A214 Putative beta-phosphoglucomutase; structural genomics, 99.45
2p11_A231 Hypothetical protein; putative haloacid dehalogenase-li 98.96
2ah5_A