254780849

254780849

chaperonin GroEL

GeneID in NCBI database:8209862Locus tag:CLIBASIA_03720
Protein GI in NCBI database:254780849Protein Accession:YP_003065262.1
Gene range:+(818723, 820378)Protein Length:551aa
Gene description:chaperonin GroEL
COG prediction:[O] Chaperonin GroEL (HSP60 family)
KEGG prediction:chaperonin GroEL; K04077 chaperonin GroEL
SEED prediction:Heat shock protein 60 family chaperone GroEL
Pathway involved in KEGG:RNA degradation [PATH:las03018]
Subsystem involved in SEED:GroEL GroES
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-
MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGMDMMM
ccHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccEEEEEHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEEEccccccHHHcccccccEEEEcccEEEEEccccccHHHHHHHHHHHHHcccccEEEcccccHHHHHHHHHHHHHcccHHHHcccccccHHHHHHHHHHHHHcccEEccHHHccccccccHHHcccccEEEEEcccEEEEcccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccEEEEcccccEEEHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccc
cccEEEEEHHHHHHHHHHHHHHHHHHHHccccccccEEEEcccccccEEEccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcEccccHHHHHHHHHHHccccHHHHHHHHHHHHHHcccccEEEEcccccccEEEEEccEEEcccEcccccccEccccEEEEEccEEEcEEcEEccHHHcHHHHHHHHHHHccEEEEEcEEcHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccEEHHHccccccccccccEEEEEEEEccccEEEEEEcccHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHcEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHHHcEEEcccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccEEEEccccEEEEccccccEEEHHHHHHHHHHHHHHHHHHHcEEEEEEEccccccccccccccccccccccccHHcc
maakdiklGTAARDAIAYGVNTLAEAVkctlgpkgrcviignsfgaprvtkdgVTVAKSISFKNHFHEVGARMIRDVatntedssgdgttTATCLAQAIYNEGRKyvtaglnpmdikRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGmqidrgyispyfvTSTErmtaevenpyiLIYDKkisalqpllpilesatqsgrplciiAEDVEGDALATLVVNRVRcglpvlavkapafgdRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKkvvmskddttivggngpserIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLdatraasdegivpgGGIALVRAAQAlsvkgdnedqcAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQEsktanygynaqksvfgdmfemgiiDPVKVVRNALQSAGSLAGMMLITEAVvvdapkdetaspqmpagggmgggmggmdmmm
maakdiklgtaaRDAIAYGVNTLAEAVKCTLGPKGRCVIIGnsfgaprvtkdGVTVAKSisfknhfhevgARMIRDVATNtedssgdgtTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKanhkkvgsreeiiqvatisangdreIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVvqgmqidrgyiSPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLavkapafgdrrkEVLRDIAAVVGatviseeiglklekatiadlgsakkvvmskddttivggngpseriegRINEIQKAiedtksdydrDKLKERLAklaggvavlevgdvteaalgekkdryqdsldatraasdegivpGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIknagdeseLIVSKIqesktanygYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKdetaspqmpagggmgGGMGGMDMMM
MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAgggmgggmggmdmmm
**AKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKAN*******EEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVV*********************MGGMDMMM
MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATN*********TTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGMDMMM
*AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDET**********************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPxxxxxxxxxxxxxxxxxxxxxYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGMDMMM
MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGMDMMM
MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSISFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGIDLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAKTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESATQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYDRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVRAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGGGMGGGMGGMDMMM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target551 chaperonin GroEL [Candidatus Liberibacter asiaticus str
315122727555 chaperonin GroEL [Candidatus Liberibacter solanacearum 1 0.0
110635424542 chaperonin GroEL [Mesorhizobium sp. BNC1] Length = 542 1 0.0
13472184542 chaperonin GroEL [Mesorhizobium loti MAFF303099] Length 1 0.0
260466933543 chaperonin GroEL [Mesorhizobium opportunistum WSM2075] 1 0.0
222085003546 Chaperonin GroEL [Agrobacterium radiobacter K84] Length 1 0.0
209548077547 chaperonin GroEL [Rhizobium leguminosarum bv. trifolii 1 0.0
241203263547 chaperonin GroEL [Rhizobium leguminosarum bv. trifolii 1 0.0
325292065544 GroEL chaperonin [Agrobacterium sp. H13-3] Length = 544 1 0.0
16262848545 chaperonin GroEL [Sinorhizobium meliloti 1021] Length = 1 0.0
116250657547 chaperonin GroEL [Rhizobium leguminosarum bv. viciae 38 1 0.0
>gi|315122727|ref|YP_004063216.1| chaperonin GroEL [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 555 Back     alignment and organism information
 Score =  947 bits (2448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 458/536 (85%), Positives = 501/536 (93%)

Query: 1   MAAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSI 60
           M+AKDIKLG  ARD++AYGVN LA+AVKCTLGPKGRCVII NSFGAPRVTKDGV+VAKSI
Sbjct: 1   MSAKDIKLGINARDSVAYGVNALADAVKCTLGPKGRCVIIANSFGAPRVTKDGVSVAKSI 60

Query: 61  SFKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGI 120
           SFKNHFHEVGARMIRDVATN ED+SGDGTTTATCLAQAI NEGRKYV AGLNPMD++RGI
Sbjct: 61  SFKNHFHEVGARMIRDVATNAEDNSGDGTTTATCLAQAIINEGRKYVAAGLNPMDLRRGI 120

Query: 121 DLAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQA 180
           +LAVQEVV+YLK NHKKVGSREEIIQVATISANGDR+IGEKIA+AME+IGPHGIITIDQA
Sbjct: 121 NLAVQEVVDYLKVNHKKVGSREEIIQVATISANGDRDIGEKIAFAMEKIGPHGIITIDQA 180

Query: 181 KTATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESA 240
           KTATTEVRVV+GMQ DRGYISPYF+T++E+MTAE ENPYIL+YDKKISALQPLLP+LE  
Sbjct: 181 KTATTEVRVVKGMQFDRGYISPYFMTNSEKMTAEAENPYILVYDKKISALQPLLPLLEIV 240

Query: 241 TQSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATV 300
            QSGRPLCIIAEDVEGDALATLVVNR+RC L VLAVKAPAFGDRRK VL+DIA +VGATV
Sbjct: 241 AQSGRPLCIIAEDVEGDALATLVVNRLRCNLSVLAVKAPAFGDRRKAVLQDIAVLVGATV 300

Query: 301 ISEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDY 360
           IS+E+GLKLEKAT+ADLGSAKKVVM+KDDTTIVGG G  E ++ RI+EIQ AIE+TKSDY
Sbjct: 301 ISDEVGLKLEKATVADLGSAKKVVMTKDDTTIVGGCGSQELVQARISEIQAAIEETKSDY 360

Query: 361 DRDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALV 420
           DRDKLKERLAKLAGGVAV+EVGDVTEAAL EKKDRYQDSLDATRAASDEGIV GGGI+L+
Sbjct: 361 DRDKLKERLAKLAGGVAVIEVGDVTEAALSEKKDRYQDSLDATRAASDEGIVVGGGISLI 420

Query: 421 RAAQALSVKGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQESKTANYGYNA 480
           RAAQALSVKGDN DQCAGIEIVRK L YPCRQII+NAGDE+ LIVSKIQE+K  N+GY+A
Sbjct: 421 RAAQALSVKGDNSDQCAGIEIVRKVLGYPCRQIIENAGDEAALIVSKIQENKNVNFGYDA 480

Query: 481 QKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPA 536
           QK VFGDMFEMGIIDPVKVVRNALQSA S+A M+LITEAVVVD PKDE+A+PQMPA
Sbjct: 481 QKGVFGDMFEMGIIDPVKVVRNALQSAASVASMLLITEAVVVDLPKDESAAPQMPA 536


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|110635424|ref|YP_675632.1| chaperonin GroEL [Mesorhizobium sp. BNC1] Length = 542 Back     alignment and organism information
>gi|13472184|ref|NP_103751.1| chaperonin GroEL [Mesorhizobium loti MAFF303099] Length = 542 Back     alignment and organism information
>gi|260466933|ref|ZP_05813116.1| chaperonin GroEL [Mesorhizobium opportunistum WSM2075] Length = 543 Back     alignment and organism information
>gi|222085003|ref|YP_002543532.1| Chaperonin GroEL [Agrobacterium radiobacter K84] Length = 546 Back     alignment and organism information
>gi|209548077|ref|YP_002279994.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 547 Back     alignment and organism information
>gi|241203263|ref|YP_002974359.1| chaperonin GroEL [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 547 Back     alignment and organism information
>gi|325292065|ref|YP_004277929.1| GroEL chaperonin [Agrobacterium sp. H13-3] Length = 544 Back     alignment and organism information
>gi|16262848|ref|NP_435641.1| chaperonin GroEL [Sinorhizobium meliloti 1021] Length = 545 Back     alignment and organism information
>gi|116250657|ref|YP_766495.1| chaperonin GroEL [Rhizobium leguminosarum bv. viciae 3841] Length = 547 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target551 chaperonin GroEL [Candidatus Liberibacter asiaticus str
PRK00013542 PRK00013, groEL, chaperonin GroEL; Reviewed 0.0
PRK12849542 PRK12849, groEL, chaperonin GroEL; Reviewed 0.0
TIGR02348524 TIGR02348, GroEL, chaperonin GroL 0.0
PTZ00114555 PTZ00114, PTZ00114, Heat shock protein 60; Provisional 0.0
PRK12850544 PRK12850, groEL, chaperonin GroEL; Reviewed 0.0
PRK12852545 PRK12852, groEL, chaperonin GroEL; Reviewed 0.0
PRK12851541 PRK12851, groEL, chaperonin GroEL; Reviewed 0.0
PRK14104546 PRK14104, PRK14104, chaperonin GroEL; Provisional 1e-169
KOG0356550 KOG0356, KOG0356, KOG0356, Mitochondrial chaperonin, Cp 1e-157
CHL00093529 CHL00093, groEL, chaperonin GroEL 1e-154
PLN03167600 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisi 1e-133
COG0459524 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttra 1e-121
pfam00118481 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family 7e-94
cd00309464 cd00309, chaperonin_type_I_II, chaperonin families, typ 8e-92
KOG0359520 KOG0359, KOG0359, KOG0359, Chaperonin complex component 4e-11
cd03341472 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) 2e-10
KOG0362537 KOG0362, KOG0362, KOG0362, Chaperonin complex component 6e-08
cd03344520 cd03344, GroEL, GroEL_like type I chaperonin 0.0
cd03333209 cd03333, chaperonin_like, chaperonin_like superfamily 2e-22
cd03343517 cd03343, cpn60, cpn60 chaperonin family 9e-21
TIGR02339519 TIGR02339, thermosome_arch, thermosome, various subunit 2e-19
cd03335527 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) 4e-09
KOG0360545 KOG0360, KOG0360, KOG0360, Chaperonin complex component 2e-05
cd03342484 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) c 6e-14
TIGR02347531 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta sub 8e-12
cd03337480 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) 1e-04
cd03336517 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) c 7e-12
KOG0363527 KOG0363, KOG0363, KOG0363, Chaperonin complex component 1e-11
TIGR02341519 TIGR02341, chap_CCT_beta, T-complex protein 1, beta sub 6e-11
cd03340522 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) ch 1e-10
cd03338515 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) 2e-10
KOG0358534 KOG0358, KOG0358, KOG0358, Chaperonin complex component 4e-10
PTZ00212533 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; P 8e-10
KOG0361543 KOG0361, KOG0361, KOG0361, Chaperonin complex component 2e-09
TIGR02342517 TIGR02342, chap_CCT_delta, T-complex protein 1, delta s 3e-09
TIGR02345522 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subun 4e-09
cd03339526 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic type II 2e-08
TIGR02343532 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon 2e-07
TIGR02340536 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha s 7e-06
TIGR02346531 TIGR02346, chap_CCT_theta, T-complex protein 1, theta s 5e-05
KOG0357400 KOG0357, KOG0357, KOG0357, Chaperonin complex component 0.001
KOG0361543 KOG0361, KOG0361, KOG0361, Chaperonin complex component 2e-07
KOG0363527 KOG0363, KOG0363, KOG0363, Chaperonin complex component 1e-05
cd03336517 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) c 6e-05
TIGR02345522 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subun 3e-04
TIGR02341519 TIGR02341, chap_CCT_beta, T-complex protein 1, beta sub 0.001
PTZ00212533 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; P 0.002
cd03342484 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) c 1e-04
cd03340522 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) ch 1e-04
>gnl|CDD|178794 PRK00013, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|183791 PRK12849, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|162814 TIGR02348, GroEL, chaperonin GroL Back     alignment and domain information
>gnl|CDD|185455 PTZ00114, PTZ00114, Heat shock protein 60; Provisional Back     alignment and domain information
>gnl|CDD|183792 PRK12850, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|171771 PRK12852, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|171770 PRK12851, groEL, chaperonin GroEL; Reviewed Back     alignment and domain information
>gnl|CDD|172594 PRK14104, PRK14104, chaperonin GroEL; Provisional Back     alignment and domain information
>gnl|CDD|35577 KOG0356, KOG0356, KOG0356, Mitochondrial chaperonin, Cpn60/Hsp60p [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|177025 CHL00093, groEL, chaperonin GroEL Back     alignment and domain information
>gnl|CDD|178711 PLN03167, PLN03167, Chaperonin-60 beta subunit; Provisional Back     alignment and domain information
>gnl|CDD|30807 COG0459, GroL, Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|143893 pfam00118, Cpn60_TCP1, TCP-1/cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|73189 cd00309, chaperonin_type_I_II, chaperonin families, type I and type II Back     alignment and domain information
>gnl|CDD|35580 KOG0359, KOG0359, KOG0359, Chaperonin complex component, TCP-1 zeta subunit (CCT6) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|73352 cd03341, TCP1_theta, TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>gnl|CDD|35583 KOG0362, KOG0362, KOG0362, Chaperonin complex component, TCP-1 theta subunit (CCT8) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48161 cd03344, GroEL, GroEL_like type I chaperonin Back     alignment and domain information
>gnl|CDD|73350 cd03333, chaperonin_like, chaperonin_like superfamily Back     alignment and domain information
>gnl|CDD|48160 cd03343, cpn60, cpn60 chaperonin family Back     alignment and domain information
>gnl|CDD|162810 TIGR02339, thermosome_arch, thermosome, various subunits, archaeal Back     alignment and domain information
>gnl|CDD|48152 cd03335, TCP1_alpha, TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>gnl|CDD|35581 KOG0360, KOG0360, KOG0360, Chaperonin complex component, TCP-1 alpha subunit (CCT1) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|73353 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>gnl|CDD|162813 TIGR02347, chap_CCT_zeta, T-complex protein 1, zeta subunit Back     alignment and domain information
>gnl|CDD|73351 cd03337, TCP1_gamma, TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>gnl|CDD|48153 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>gnl|CDD|35584 KOG0363, KOG0363, KOG0363, Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131394 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit Back     alignment and domain information
>gnl|CDD|48157 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>gnl|CDD|48155 cd03338, TCP1_delta, TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>gnl|CDD|35579 KOG0358, KOG0358, KOG0358, Chaperonin complex component, TCP-1 delta subunit (CCT4) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|35582 KOG0361, KOG0361, KOG0361, Chaperonin complex component, TCP-1 eta subunit (CCT7) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|131395 TIGR02342, chap_CCT_delta, T-complex protein 1, delta subunit Back     alignment and domain information
>gnl|CDD|131398 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit Back     alignment and domain information
>gnl|CDD|48156 cd03339, TCP1_epsilon, TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>gnl|CDD|131396 TIGR02343, chap_CCT_epsi, T-complex protein 1, epsilon subunit Back     alignment and domain information
>gnl|CDD|131393 TIGR02340, chap_CCT_alpha, T-complex protein 1, alpha subunit Back     alignment and domain information
>gnl|CDD|162812 TIGR02346, chap_CCT_theta, T-complex protein 1, theta subunit Back     alignment and domain information
>gnl|CDD|35578 KOG0357, KOG0357, KOG0357, Chaperonin complex component, TCP-1 epsilon subunit (CCT5) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35582 KOG0361, KOG0361, KOG0361, Chaperonin complex component, TCP-1 eta subunit (CCT7) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|35584 KOG0363, KOG0363, KOG0363, Chaperonin complex component, TCP-1 beta subunit (CCT2) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|48153 cd03336, TCP1_beta, TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>gnl|CDD|131398 TIGR02345, chap_CCT_eta, T-complex protein 1, eta subunit Back     alignment and domain information
>gnl|CDD|131394 TIGR02341, chap_CCT_beta, T-complex protein 1, beta subunit Back     alignment and domain information
>gnl|CDD|185514 PTZ00212, PTZ00212, T-complex protein 1 subunit beta; Provisional Back     alignment and domain information
>gnl|CDD|73353 cd03342, TCP1_zeta, TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>gnl|CDD|48157 cd03340, TCP1_eta, TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 551 chaperonin GroEL [Candidatus Liberibacter asiaticus str
PTZ00114580 Heat shock protein 60; Provisional 100.0
PRK00013535 groEL chaperonin GroEL; Reviewed 100.0
PRK12849538 groEL chaperonin GroEL; Reviewed 100.0
PRK12852542 groEL chaperonin GroEL; Reviewed 100.0
PRK12850543 groEL chaperonin GroEL; Reviewed 100.0
TIGR02348528 GroEL chaperonin GroL; InterPro: IPR012723 Partially fo 100.0
PRK12851541 groEL chaperonin GroEL; Reviewed 100.0
CHL00093527 groEL chaperonin GroEL 100.0
COG0459524 GroL Chaperonin GroEL (HSP60 family) [Posttranslational 100.0
TIGR02340540 chap_CCT_alpha T-complex protein 1, alpha subunit; Inte 100.0
TIGR02345537 chap_CCT_eta T-complex protein 1, eta subunit; InterPro 100.0
cd03340522 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin f 100.0
cd03342484 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin 100.0
cd03335527 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin 100.0
PTZ00212533 T-complex protein 1 beta subunit; Provisional 100.0
cd03336517 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin 100.0
TIGR02346554 chap_CCT_theta T-complex protein 1, theta subunit; Inte 100.0
pfam00118481 Cpn60_TCP1 TCP-1/cpn60 chaperonin family. This family i 100.0
KOG0356550 consensus 100.0
KOG0361543 consensus 100.0
TIGR02347548 chap_CCT_zeta T-complex protein 1, zeta subunit; InterP 100.0
KOG0363527 consensus 100.0
KOG0360545 consensus 100.0
KOG0362537 consensus 100.0
TIGR02341519 chap_CCT_beta T-complex protein 1, beta subunit; InterP 100.0
KOG0359520 consensus 100.0
KOG0364527 consensus 100.0
cd03344520 GroEL GroEL_like type I chaperonin. Chaperonins are inv 100.0
TIGR02339522 thermosome_arch thermosome, various subunits, archaeal; 100.0
TIGR02343541 chap_CCT_epsi T-complex protein 1, epsilon subunit; Int 100.0
cd03339526 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperon 100.0
TIGR02342526 chap_CCT_delta T-complex protein 1, delta subunit; Inte 100.0
cd00309464 chaperonin_type_I_II chaperonin families, type I and ty 100.0
cd03343517 cpn60 cpn60 chaperonin family. Chaperonins are involved 100.0
cd03338515 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin 100.0
cd03337480 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin 100.0
cd03341472 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin 100.0
TIGR02344527 chap_CCT_gamma T-complex protein 1, gamma subunit; Inte 100.0
KOG0358534 consensus 100.0
KOG0357400 consensus 100.0
cd03333209 chaperonin_like chaperonin_like superfamily. Chaperonin 99.94
cd03334261 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatid 99.85
KOG0230 1598 consensus 98.29
TIGR02343541 chap_CCT_epsi T-complex protein 1, epsilon subunit; Int 94.3
PTZ00212533 T-complex protein 1 beta subunit; Provisional 92.21
>PTZ00114 Heat shock protein 60; Provisional Back     alignment and domain information
>PRK00013 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12849 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12852 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>PRK12850 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>TIGR02348 GroEL chaperonin GroL; InterPro: IPR012723 Partially folded polypeptide chains, either newly made by ribosomes or emerging from mature proteins unfolded by stress, run the risk of aggregating with one another to the detriment of the organism Back     alignment and domain information
>PRK12851 groEL chaperonin GroEL; Reviewed Back     alignment and domain information
>CHL00093 groEL chaperonin GroEL Back     alignment and domain information
>COG0459 GroL Chaperonin GroEL (HSP60 family) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02340 chap_CCT_alpha T-complex protein 1, alpha subunit; InterPro: IPR012715 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>TIGR02345 chap_CCT_eta T-complex protein 1, eta subunit; InterPro: IPR012720 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>cd03340 TCP1_eta TCP-1 (CTT or eukaryotic type II) chaperonin family, eta subunit Back     alignment and domain information
>cd03342 TCP1_zeta TCP-1 (CTT or eukaryotic type II) chaperonin family, zeta subunit Back     alignment and domain information
>cd03335 TCP1_alpha TCP-1 (CTT or eukaryotic type II) chaperonin family, alpha subunit Back     alignment and domain information
>PTZ00212 T-complex protein 1 beta subunit; Provisional Back     alignment and domain information
>cd03336 TCP1_beta TCP-1 (CTT or eukaryotic type II) chaperonin family, beta subunit Back     alignment and domain information
>TIGR02346 chap_CCT_theta T-complex protein 1, theta subunit; InterPro: IPR012721 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>pfam00118 Cpn60_TCP1 TCP-1/cpn60 chaperonin family Back     alignment and domain information
>KOG0356 consensus Back     alignment and domain information
>KOG0361 consensus Back     alignment and domain information
>TIGR02347 chap_CCT_zeta T-complex protein 1, zeta subunit; InterPro: IPR012722 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>KOG0363 consensus Back     alignment and domain information
>KOG0360 consensus Back     alignment and domain information
>KOG0362 consensus Back     alignment and domain information
>TIGR02341 chap_CCT_beta T-complex protein 1, beta subunit; InterPro: IPR012716 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>KOG0359 consensus Back     alignment and domain information
>KOG0364 consensus Back     alignment and domain information
>cd03344 GroEL GroEL_like type I chaperonin Back     alignment and domain information
>TIGR02339 thermosome_arch thermosome, various subunits, archaeal; InterPro: IPR012714 Thermosome is the name given to the archaeal rather than eukaryotic form of the group II chaperonin (counterpart to the group I chaperonin, GroEL/GroES, in bacteria), a toroidal, ATP-dependent molecular chaperone that assists in the folding or refolding of nascent or denatured proteins Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit; InterPro: IPR012718 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>cd03339 TCP1_epsilon TCP-1 (CTT or eukaryotic type II) chaperonin family, epsilon subunit Back     alignment and domain information
>TIGR02342 chap_CCT_delta T-complex protein 1, delta subunit; InterPro: IPR012717 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>cd00309 chaperonin_type_I_II chaperonin families, type I and type II Back     alignment and domain information
>cd03343 cpn60 cpn60 chaperonin family Back     alignment and domain information
>cd03338 TCP1_delta TCP-1 (CTT or eukaryotic type II) chaperonin family, delta subunit Back     alignment and domain information
>cd03337 TCP1_gamma TCP-1 (CTT or eukaryotic type II) chaperonin family, gamma subunit Back     alignment and domain information
>cd03341 TCP1_theta TCP-1 (CTT or eukaryotic type II) chaperonin family, theta subunit Back     alignment and domain information
>TIGR02344 chap_CCT_gamma T-complex protein 1, gamma subunit; InterPro: IPR012719 The TCP-1 protein , (Tailless Complex Polypeptide 1) was first identified in mice where it is especially abundant in testis but present in all cell types Back     alignment and domain information
>KOG0358 consensus Back     alignment and domain information
>KOG0357 consensus Back     alignment and domain information
>cd03333 chaperonin_like chaperonin_like superfamily Back     alignment and domain information
>cd03334 Fab1_TCP TCP-1 like domain of the eukaryotic phosphatidylinositol 3-phosphate (PtdIns3P) 5-kinase Fab1 Back     alignment and domain information
>KOG0230 consensus Back     alignment and domain information
>TIGR02343 chap_CCT_epsi T-complex protein 1, epsilon subunit; InterPro: IPR012718 Members of this eukaryotic family are part of the group II chaperonin complex called CCT (chaperonin containing TCP-1) or TRiC Back     alignment and domain information
>PTZ00212 T-complex protein 1 beta subunit; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target551 chaperonin GroEL [Candidatus Liberibacter asiaticus str
1we3_A543 Crystal Structure Of The Chaperonin Complex Cpn60CP 1e-138
1iok_A545 Crystal Structure Of Chaperonin-60 From Paracoccus 1e-136
2eu1_A548 Crystal Structure Of The Chaperonin Groel-E461k Len 1e-128
1aon_A547 Crystal Structure Of The Asymmetric Chaperonin Comp 1e-128
3c9v_A526 C7 Symmetrized Structure Of Unliganded Groel At 4.7 1e-128
1grl_A548 The Crystal Structure Of The Bacterial Chaperonin G 1e-128
1j4z_A547 Structural And Mechanistic Basis For Allostery In T 1e-127
1pcq_A524 Crystal Structure Of Groel-Groes Length = 524 1e-127
3fbh_B524 Crystal Structure Of The Allosteric-Defective Chape 1e-127
1gr5_A547 Solution Structure Of Apo Groel By Cryo-Electron Mi 1e-127
1oel_A547 Conformational Variability In The Refined Structure 1e-127
1kp8_A547 Structural Basis For Groel-Assisted Protein Folding 1e-127
1sx3_A525 Groel14-(Atpgammas)14 Length = 525 1e-126
3cau_A526 D7 Symmetrized Structure Of Unliganded Groel At 4.2 1e-126
1ss8_A524 Groel Length = 524 1e-126
1a6d_A545 Thermosome From T. Acidophilum Length = 545 4e-80
1q3r_A548 Crystal Structure Of The Chaperonin From Thermococc 2e-77
1q3s_A548 Crystal Structure Of The Chaperonin From Thermococc 2e-76
1q2v_A548 Crystal Structure Of The Chaperonin From Thermococc 3e-76
3los_A543 Atomic Model Of Mm-Cpn In The Closed State Length = 4e-76
3izh_A513 Mm-Cpn D386a With Atp Length = 513 9e-76
3izi_A513 Mm-Cpn Rls With Atp Length = 513 4e-75
3iyf_A521 Atomic Model Of The Lidless Mm-Cpn In The Open Stat 4e-74
3izn_A491 Mm-Cpn Deltalid With Atp Length = 491 8e-74
3izk_A491 Mm-Cpn Rls Deltalid With Atp Length = 491 5e-73
3iyg_H515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 7e-73
3ko1_A553 Cystal Structure Of Thermosome From Acidianus Tengc 1e-72
1a6d_B543 Thermosome From T. Acidophilum Length = 543 1e-72
3iyg_D518 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 3e-68
3iyg_G515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 8e-66
3iyg_B513 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 3e-64
3iyg_A529 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 4e-64
3iyg_E515 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 1e-57
3iyg_Z517 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 4e-55
3iyg_Q512 Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGST 8e-48
1sjp_A504 Mycobacterium Tuberculosis Chaperonin60.2 Length = 1e-107
gi|50514033|pdb|1WE3|A Chain A, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 543 Back     alignment and structure
 Score =  497 bits (1279), Expect = e-138,   Method: Composition-based stats.
 Identities = 297/551 (53%), Positives = 391/551 (70%), Gaps = 11/551 (1%)

Query: 2   AAKDIKLGTAARDAIAYGVNTLAEAVKCTLGPKGRCVIIGNSFGAPRVTKDGVTVAKSIS 61
            AK +    AAR A+  GVN +A AVK TLGP+GR V++   FG+P +TKDGVTVAK + 
Sbjct: 1   MAKILVFDEAARRALERGVNAVANAVKVTLGPRGRNVVLEKKFGSPTITKDGVTVAKEVE 60

Query: 62  FKNHFHEVGARMIRDVATNTEDSSGDGTTTATCLAQAIYNEGRKYVTAGLNPMDIKRGID 121
            ++H   +GA+++++VA+ T D +GDGTTTAT LAQAI  EG K V AG NP+ +KRGI+
Sbjct: 61  LEDHLENIGAQLLKEVASKTNDVAGDGTTTATVLAQAIVREGLKNVAAGANPLALKRGIE 120

Query: 122 LAVQEVVEYLKANHKKVGSREEIIQVATISANGDREIGEKIAYAMEQIGPHGIITIDQAK 181
            AV+  VE +KA    V  R+ I +VATISAN    +G+ IA AME++G  GIIT++++K
Sbjct: 121 KAVEAAVEKIKALAIPVEDRKAIEEVATISANDPE-VGKLIADAMEKVGKEGIITVEESK 179

Query: 182 TATTEVRVVQGMQIDRGYISPYFVTSTERMTAEVENPYILIYDKKISALQPLLPILESAT 241
           +  TE++ V+G Q D+GYISPYFVT+ E M A +E+ +ILI +KK+S ++ LLPILE   
Sbjct: 180 SLETELKFVEGYQFDKGYISPYFVTNPETMEAVLEDAFILIVEKKVSNVRELLPILEQVA 239

Query: 242 QSGRPLCIIAEDVEGDALATLVVNRVRCGLPVLAVKAPAFGDRRKEVLRDIAAVVGATVI 301
           Q+G+PL IIAEDVEG+ALATLVVN++R  L V AVKAP FGDRRKE+L+DIAAV G TVI
Sbjct: 240 QTGKPLLIIAEDVEGEALATLVVNKLRGTLSVAAVKAPGFGDRRKEMLKDIAAVTGGTVI 299

Query: 302 SEEIGLKLEKATIADLGSAKKVVMSKDDTTIVGGNGPSERIEGRINEIQKAIEDTKSDYD 361
           SEE+G KLE AT++ LG A++V ++KD+TTIVGG G  E IE RIN I+K +E T S+Y 
Sbjct: 300 SEELGFKLENATLSMLGRAERVRITKDETTIVGGKGKKEDIEARINGIKKELETTDSEYA 359

Query: 362 RDKLKERLAKLAGGVAVLEVGDVTEAALGEKKDRYQDSLDATRAASDEGIVPGGGIALVR 421
           R+KL+ERLAKLAGGVAV+ VG  TE  L EKK R++D+L+ATRAA +EGIVPGGG+ L+R
Sbjct: 360 REKLQERLAKLAGGVAVIRVGAATETELKEKKHRFEDALNATRAAVEEGIVPGGGVTLLR 419

Query: 422 AAQALSV--KGDNEDQCAGIEIVRKALSYPCRQIIKNAGDESELIVSKIQES-KTANYGY 478
           A  A+    K    D+  G +IVR+AL  P RQI +NAG E  +IV +I    K   YG+
Sbjct: 420 AISAVEELIKKLEGDEATGAKIVRRALEEPARQIAENAGYEGSVIVQQILAETKNPRYGF 479

Query: 479 NAQKSVFGDMFEMGIIDPVKVVRNALQSAGSLAGMMLITEAVVVDAPKDETASPQMPAGG 538
           NA    F DM E GI+DP KV R+ALQ+A S+  ++L TEAVV + P+ + ++P      
Sbjct: 480 NAATGEFVDMVEAGIVDPAKVTRSALQNAASIGALILTTEAVVAEKPEKKESTPA----- 534

Query: 539 GMGGGMGGMDM 549
               G G MD 
Sbjct: 535 --SAGAGDMDF 543


gi|15988025|pdb|1IOK|A Chain A, Crystal Structure Of Chaperonin-60 From Paracoccus Denitrificans Length = 545 Back     alignment and structure
>gi|114793773|pdb|2EU1|A Chain A, Crystal Structure Of The Chaperonin Groel-E461k Length = 548 Back     alignment and structure
>gi|2624772|pdb|1AON|A Chain A, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 547 Back     alignment and structure
>gi|197725074|pdb|3C9V|A Chain A, C7 Symmetrized Structure Of Unliganded Groel At 4.7 Angstrom Resolution From Cryoem Length = 526 Back     alignment and structure
>gi|157831241|pdb|1GRL|A Chain A, The Crystal Structure Of The Bacterial Chaperonin Groel At 2.8 Angstroms Length = 548 Back     alignment and structure
>gi|39654074|pdb|1J4Z|A Chain A, Structural And Mechanistic Basis For Allostery In The Bacterial Chaperonin Groel; See Remark 400 Length = 547 Back     alignment and structure
>gi|38492781|pdb|1PCQ|A Chain A, Crystal Structure Of Groel-Groes Length = 524 Back     alignment and structure
>gi|18655582|pdb|1GR5|A Chain A, Solution Structure Of Apo Groel By Cryo-Electron Microscopy Length = 547 Back     alignment and structure
>gi|1421648|pdb|1OEL|A Chain A, Conformational Variability In The Refined Structure Of The Chaperonin Groel At 2.8 Angstrom Resolution Length = 547 Back     alignment and structure
>gi|29726355|pdb|1KP8|A Chain A, Structural Basis For Groel-Assisted Protein Folding From The Crystal Structure Of (Groel-Kmgatp)14 At 2.0 A Resolution Length = 547 Back     alignment and structure
>gi|61679937|pdb|1SX3|A Chain A, Groel14-(Atpgammas)14 Length = 525 Back     alignment and structure
>gi|197725088|pdb|3CAU|A Chain A, D7 Symmetrized Structure Of Unliganded Groel At 4.2 Angstrom Resolution By Cryoem Length = 526 Back     alignment and structure
>gi|61679903|pdb|1SS8|A Chain A, Groel Length = 524 Back     alignment and structure
>gi|4699705|pdb|1A6D|A Chain A, Thermosome From T. Acidophilum Length = 545 Back     alignment and structure
>gi|42543365|pdb|1Q3R|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form Of Single Mutant) Length = 548 Back     alignment and structure
>gi|42543369|pdb|1Q3S|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Formiii Crystal Complexed With Adp) Length = 548 Back     alignment and structure
>gi|42543350|pdb|1Q2V|A Chain A, Crystal Structure Of The Chaperonin From Thermococcus Strain Ks-1 (Nucleotide-Free Form) Length = 548 Back     alignment and structure
>gi|291191269|pdb|3LOS|A Chain A, Atomic Model Of Mm-Cpn In The Closed State Length = 543 Back     alignment and structure
>gi|321159663|pdb|3IZH|A Chain A, Mm-Cpn D386a With Atp Length = 513 Back     alignment and structure
>gi|321159679|pdb|3IZI|A Chain A, Mm-Cpn Rls With Atp Length = 513 Back     alignment and structure
>gi|285803421|pdb|3IYF|A Chain A, Atomic Model Of The Lidless Mm-Cpn In The Open State Length = 521 Back     alignment and structure
>gi|321159759|pdb|3IZN|A Chain A, Mm-Cpn Deltalid With Atp Length = 491 Back     alignment and structure
>gi|321159711|pdb|3IZK|A Chain A, Mm-Cpn Rls Deltalid With Atp Length = 491 Back     alignment and structure
>gi|291191151|pdb|3IYG|H Chain H, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>gi|310942706|pdb|3KO1|A Chain A, Cystal Structure Of Thermosome From Acidianus Tengchongensis Strain S5 Length = 553 Back     alignment and structure
gi|4699706|pdb|1A6D|B Chain B, Thermosome From T. Acidophilum Length = 543 Back     alignment and structure
>gi|291191147|pdb|3IYG|D Chain D, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 518 Back     alignment and structure
>gi|291191145|pdb|3IYG|G Chain G, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>gi|291191148|pdb|3IYG|B Chain B, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 513 Back     alignment and structure
>gi|291191150|pdb|3IYG|A Chain A, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 529 Back     alignment and structure
>gi|291191149|pdb|3IYG|E Chain E, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 515 Back     alignment and structure
>gi|291191146|pdb|3IYG|Z Chain Z, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 517 Back     alignment and structure
>gi|291191144|pdb|3IYG|Q Chain Q, Ca Model Of Bovine TricCCT DERIVED FROM A 4.0 ANGSTROM Cryo-Em Map Length = 512 Back     alignment and structure