254780848

254780848

co-chaperonin GroES

GeneID in NCBI database:8209861Locus tag:CLIBASIA_03715
Protein GI in NCBI database:254780848Protein Accession:YP_003065261.1
Gene range:+(818317, 818652)Protein Length:111aa
Gene description:co-chaperonin GroES
COG prediction:[O] Co-chaperonin GroES (HSP10)
KEGG prediction:groES; co-chaperonin GroES; K04078 chaperonin GroES
SEED prediction:Heat shock protein 60 family co-chaperone GroES
Pathway involved in KEGG:not defined
Subsystem involved in SEED:GroEL GroES
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-
MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK
ccccccccEEEcccEEEEEEccccccEEccEEEccccccccccccEEEEEEEccccccccccccccccccccEEEEcccccEEEEEccccEEEEEEHHHEEEEEEcccccc
ccHHHcccccccccEEEEEEEccHcccccccEEEcccccccccccccEEEEEccccccccccEEEcEEEcccEEEEEccccEEEEEccccEEEEEcHHHHHHHHHHHHccc
mvgehknylrptrgRVVVRRLQSEIKtatgnilipdtvsekpsassgeimwvgagvmdqsgkviepevskgdivlfgkwsgteiklndgeeylVMQESDIMGIVVEEKKNK
mvgehknylrptrgrvvVRRLQSeiktatgnilipdtvsekpsaSSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSgteiklndgeeylvmqesdimgivveekknk
MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK
******N*LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEE****
********LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK
MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKK**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK
MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK
MVGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEKKNK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
315122728107 co-chaperonin GroES [Candidatus Liberibacter solanacear 1 1e-36
9041996998 chaperonin groES [Aurantimonas manganoxydans SI85-9A1] 1 3e-23
1347677798 co-chaperonin GroES [Mesorhizobium loti MAFF303099] Len 1 5e-23
11470580398 co-chaperonin GroES [Fulvimarina pelagi HTCC2506] Lengt 1 6e-23
260461327130 chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075] 1 8e-23
260463303112 chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075] 1 8e-23
1348836698 co-chaperonin GroES [Mesorhizobium loti MAFF303099] Len 1 1e-22
31978549298 chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrula 1 2e-22
239833539121 chaperonin Cpn10 [Ochrobactrum intermedium LMG 3301] Le 1 2e-22
1347483898 co-chaperonin GroES [Mesorhizobium loti MAFF303099] Len 1 2e-22
>gi|315122728|ref|YP_004063217.1| co-chaperonin GroES [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 107 Back     alignment and organism information
 Score =  156 bits (394), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 89/104 (85%), Gaps = 1/104 (0%)

Query: 5   HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVI 64
            K YLRP+RGRVV+RRLQSE  T +G ++IPDTVSEKPSA  GE++WVGAGV DQSGKVI
Sbjct: 3   DKRYLRPSRGRVVIRRLQSETMTESG-LIIPDTVSEKPSACGGEVVWVGAGVTDQSGKVI 61

Query: 65  EPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVVEEK 108
           EPEV  GD+VLFGKWSGTEIKL   EEYLVMQESDI+G+VV ++
Sbjct: 62  EPEVKPGDVVLFGKWSGTEIKLGSDEEYLVMQESDIIGVVVGDR 105


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|90419969|ref|ZP_01227878.1| chaperonin groES [Aurantimonas manganoxydans SI85-9A1] Length = 98 Back     alignment and organism information
>gi|13476777|ref|NP_108346.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099] Length = 98 Back     alignment and organism information
>gi|114705803|ref|ZP_01438706.1| co-chaperonin GroES [Fulvimarina pelagi HTCC2506] Length = 98 Back     alignment and organism information
>gi|260461327|ref|ZP_05809575.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075] Length = 130 Back     alignment and organism information
>gi|260463303|ref|ZP_05811504.1| chaperonin Cpn10 [Mesorhizobium opportunistum WSM2075] Length = 112 Back     alignment and organism information
>gi|13488366|ref|NP_085868.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099] Length = 98 Back     alignment and organism information
>gi|319785492|ref|YP_004144968.1| chaperonin Cpn10 [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 98 Back     alignment and organism information
>gi|239833539|ref|ZP_04681867.1| chaperonin Cpn10 [Ochrobactrum intermedium LMG 3301] Length = 121 Back     alignment and organism information
>gi|13474838|ref|NP_106408.1| co-chaperonin GroES [Mesorhizobium loti MAFF303099] Length = 98 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
PRK0036495 PRK00364, groES, co-chaperonin GroES; Reviewed 4e-25
cd0032093 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or GroE 4e-19
pfam0016692 pfam00166, Cpn10, Chaperonin 10 Kd subunit 1e-17
KOG1641104 KOG1641, KOG1641, KOG1641, Mitochondrial chaperonin [Po 1e-12
PTZ00414100 PTZ00414, PTZ00414, 10 kDa heat shock protein; Provisio 2e-07
PRK1453391 PRK14533, groES, co-chaperonin GroES; Provisional 6e-07
COG023496 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttransla 6e-20
>gnl|CDD|178988 PRK00364, groES, co-chaperonin GroES; Reviewed Back     alignment and domain information
>gnl|CDD|73192 cd00320, cpn10, Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>gnl|CDD|109232 pfam00166, Cpn10, Chaperonin 10 Kd subunit Back     alignment and domain information
>gnl|CDD|36854 KOG1641, KOG1641, KOG1641, Mitochondrial chaperonin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|173604 PTZ00414, PTZ00414, 10 kDa heat shock protein; Provisional Back     alignment and domain information
>gnl|CDD|184730 PRK14533, groES, co-chaperonin GroES; Provisional Back     alignment and domain information
>gnl|CDD|30583 COG0234, GroS, Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
COG023496 GroS Co-chaperonin GroES (HSP10) [Posttranslational mod 100.0
PRK0036495 groES co-chaperonin GroES; Reviewed 99.98
cd0032093 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 99.96
pfam0016692 Cpn10 Chaperonin 10 Kd subunit. This family contains Gr 99.96
KOG1641104 consensus 99.94
>COG0234 GroS Co-chaperonin GroES (HSP10) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK00364 groES co-chaperonin GroES; Reviewed Back     alignment and domain information
>cd00320 cpn10 Chaperonin 10 Kd subunit (cpn10 or GroES); Cpn10 cooperates with chaperonin 60 (cpn60 or GroEL), an ATPase, to assist the folding and assembly of proteins and is found in eubacterial cytosol, as well as in the matrix of mitochondria and chloroplasts Back     alignment and domain information
>pfam00166 Cpn10 Chaperonin 10 Kd subunit Back     alignment and domain information
>KOG1641 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
1we3_O100 Crystal Structure Of The Chaperonin Complex Cpn60CP 7e-22
1wnr_A94 Crystal Structure Of The Cpn10 From Thermus Thermop 3e-21
1hx5_A99 Crystal Structure Of M. Tuberculosis Chaperonin-10 4e-21
1lep_A99 Three-Dimensional Structure Of The Immunodominant H 4e-19
1aon_O97 Crystal Structure Of The Asymmetric Chaperonin Comp 4e-19
3nx6_A95 Crystal Structure Of Co-Chaperonin, Groes (Xoo4289) 1e-18
>gi|50514047|pdb|1WE3|O Chain O, Crystal Structure Of The Chaperonin Complex Cpn60CPN10(ADP)7 FROM THERMUS THERMOPHILUS Length = 100 Back     alignment and structure
 Score =  106 bits (266), Expect = 7e-22,   Method: Composition-based stats.
 Identities = 43/104 (41%), Positives = 70/104 (67%), Gaps = 4/104 (3%)

Query: 2   VGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG 61
             E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++G
Sbjct: 1   AAEVKTVIKPLGDRVVVKRIEEEPKTKGG-IVLPDTAKEKP--QKGKVIAVGTGRVLENG 57

Query: 62  KVIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIVV 105
           + +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++ 
Sbjct: 58  QRVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVLQ 100


>gi|58177186|pdb|1WNR|A Chain A, Crystal Structure Of The Cpn10 From Thermus Thermophilus Hb8 Length = 94 Back     alignment and structure
>gi|15825763|pdb|1HX5|A Chain A, Crystal Structure Of M. Tuberculosis Chaperonin-10 Length = 99 Back     alignment and structure
>gi|1942632|pdb|1LEP|A Chain A, Three-Dimensional Structure Of The Immunodominant Heat- Shock Protein Chaperonin-10 Of Mycobacterium Leprae Length = 99 Back     alignment and structure
gi|2624786|pdb|1AON|O Chain O, Crystal Structure Of The Asymmetric Chaperonin Complex GroelGROES(ADP)7 Length = 97 Back     alignment and structure
>gi|301598832|pdb|3NX6|A Chain A, Crystal Structure Of Co-Chaperonin, Groes (Xoo4289) From Xanthomonas Oryzae Pv. Oryzae Kacc10331 Length = 95 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escherichia 4e-21
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes, xan 1e-19
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, flexibl 1e-18
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP1 2e-17
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Length = 97 Back     alignment and structure
 Score = 94.8 bits (236), Expect = 4e-21
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R + E K+A G I++  + + K +   GE++ VG G + ++G+V   +V
Sbjct: 3   IRPLHDRVIVKRKEVETKSAGG-IVLTGSAAAKST--RGEVLAVGNGRILENGEVKPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIV+F    G + +  D EE L+M ESDI+ IV
Sbjct: 60  KVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIV 95


>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} Length = 95 Back     alignment and structure
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Length = 99 Back     alignment and structure
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Length = 100 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
1p3h_A99 10 kDa chaperonin; beta barrel, acidic cluster, flexibl 99.97
3nx6_A95 10KDA chaperonin; bacterial blight, XOO4289, groes, xan 99.97
1pcq_O97 Groes protein; chaperone; HET: ADP; 2.81A {Escherichia 99.97
1we3_O100 CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP1 99.97
1g31_A111 GP31; chaperone, CO-chaperonin, groes, in VIVO protein 95.47
>1p3h_A 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} SCOP: b.35.1.1 PDB: 1hx5_A 1lep_A 1p82_A 1p83_A Back     alignment and structure
Probab=99.97  E-value=3.5e-31  Score=192.58  Aligned_cols=98  Identities=38%  Similarity=0.714  Sum_probs=89.2

Q ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCEECCC-CCEECCEECCCCEEEEECCCCCE
Q ss_conf             23242517847999974754212255799457655465302479998238708678-87902203137889970568608
Q gi|254780848|r    5 HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQS-GKVIEPEVSKGDIVLFGKWSGTE   83 (111)
Q Consensus         5 ~~~~ikPl~drVLVk~~~~e~~T~~GgI~lp~~~~ek~~~~~G~VvavG~g~~~~~-G~~~p~~vkvGD~Vl~~~~~g~~   83 (111)
                      ++|+|+||||||||++.+.+++|+ |||+||+++++++  ++|+|+|||+|+++.+ +..+|++||+||+|+|++|+|++
T Consensus         1 ~k~~ikPlgdrVLVk~~~~e~kT~-gGIiLp~~~~~~~--~~G~VvavG~g~~~~~~~~~~p~~vk~GD~Vl~~~~~g~~   77 (99)
T 1p3h_A            1 AKVNIKPLEDKILVQANEAETTTA-SGLVIPDTAKEKP--QEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTE   77 (99)
T ss_dssp             CCCEEEECTTEEEEEECCCCCBCT-TSCBCCCSSCCSE--EEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEE
T ss_pred             CCCCCEECCCEEEEEECCCCCEEE-EEEEECHHHCCCC--EEEEEEEECCEEECCCCCEECCCEEECCCEEEECCCCCEE
T ss_conf             984457758999999821056441-0499880660674--5899999714078168989728878569899980548759


Q ss_pred             EEECCCCEEEEEEHHHEEEEEEC
Q ss_conf             89769977999853017899845
Q gi|254780848|r   84 IKLNDGEEYLVMQESDIMGIVVE  106 (111)
Q Consensus        84 v~~~dg~~y~i~~e~dIlavi~~  106 (111)
                      |++ ||++|++++++||||++++
T Consensus        78 v~~-~g~~y~ii~e~dIlAvi~e   99 (99)
T 1p3h_A           78 IKY-NGEEYLILSARDVLAVVSK   99 (99)
T ss_dssp             EEE-TTEEEEEEEGGGEEEEEEC
T ss_pred             EEE-CCEEEEEEEHHHEEEEEEC
T ss_conf             999-9999999997878999949



>3nx6_A 10KDA chaperonin; bacterial blight, XOO4289, groes, xanthomonas oryzae PV. ORY KACC10331, chaperone; 1.97A {Xanthomonas oryzae PV} Back     alignment and structure
>1pcq_O Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} SCOP: b.35.1.1 PDB: 1gru_O 1aon_O* 1pf9_O* 1svt_O* 1sx4_O* 2c7c_O 2c7d_O Back     alignment and structure
>1we3_O CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} SCOP: b.35.1.1 PDB: 1wf4_o* 1wnr_A Back     alignment and structure
>1g31_A GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} SCOP: b.35.1.1 PDB: 2cgt_O Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
d1aono_97 b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [ 1e-19
d1we3o_96 b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophil 2e-17
d1p3ha_99 b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tube 2e-17
>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Length = 97 Back     information, alignment and structure

class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Escherichia coli [TaxId: 562]
 Score = 88.3 bits (219), Expect = 1e-19
 Identities = 37/96 (38%), Positives = 59/96 (61%), Gaps = 3/96 (3%)

Query: 9   LRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEV 68
           +RP   RV+V+R + E K+A G I++  + + K +   GE++ VG G + ++G+V   +V
Sbjct: 3   IRPLHDRVIVKRKEVETKSAGG-IVLTGSAAAKST--RGEVLAVGNGRILENGEVKPLDV 59

Query: 69  SKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
             GDIV+F    G + +  D EE L+M ESDI+ IV
Sbjct: 60  KVGDIVIFNDGYGVKSEKIDNEEVLIMSESDILAIV 95


>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Length = 96 Back     information, alignment and structure
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 99 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
d1p3ha_99 Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxI 99.97
d1aono_97 Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} 99.97
d1we3o_96 Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274 99.97
d1g31a_107 GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} 95.05
>d1p3ha_ b.35.1.1 (A:) Chaperonin-10 (GroES) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
class: All beta proteins
fold: GroES-like
superfamily: GroES-like
family: GroES
domain: Chaperonin-10 (GroES)
species: Mycobacterium tuberculosis [TaxId: 1773]
Probab=99.97  E-value=1.6e-31  Score=193.18  Aligned_cols=98  Identities=38%  Similarity=0.714  Sum_probs=89.1

Q ss_pred             CCCCCCCCCCEEEEEECCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCEECCCC-CEECCEECCCCEEEEECCCCCE
Q ss_conf             232425178479999747542122557994576554653024799982387086788-7902203137889970568608
Q gi|254780848|r    5 HKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSG-KVIEPEVSKGDIVLFGKWSGTE   83 (111)
Q Consensus         5 ~~~~ikPl~drVLVk~~~~e~~T~~GgI~lp~~~~ek~~~~~G~VvavG~g~~~~~G-~~~p~~vkvGD~Vl~~~~~g~~   83 (111)
                      ++|+|+||||||||++.+.+++|+ |||+||++++++  ..+|+|||||||+++++| ...|++|++||+|+|++|+|++
T Consensus         1 ~km~ikPlgdrVLVk~~~~~~kT~-gGIiLp~~~~~~--~~~G~VvavG~g~~~~~~~~~~~~~vk~GD~Vl~~~~~g~~   77 (99)
T d1p3ha_           1 AKVNIKPLEDKILVQANEAETTTA-SGLVIPDTAKEK--PQEGTVVAVGPGRWDEDGEKRIPLDVAEGDTVIYSKYGGTE   77 (99)
T ss_dssp             CCCEEEECTTEEEEEECCCCCBCT-TSCBCCCSSCCS--EEEEEEEEECCCEECSSSSCEECCSCCTTCEEEEECTTCEE
T ss_pred             CCCCCEECCCEEEEEECCHHCCCC-CCEEECCCCCCC--CEEEEEEEECCCEECCCCCEECCCEEECCCEEEECCCCCEE
T ss_conf             985356869989998852530003-536926301357--43899999889457078979167701449899985648609


Q ss_pred             EEECCCCEEEEEEHHHEEEEEEC
Q ss_conf             89769977999853017899845
Q gi|254780848|r   84 IKLNDGEEYLVMQESDIMGIVVE  106 (111)
Q Consensus        84 v~~~dg~~y~i~~e~dIlavi~~  106 (111)
                      +++ ||++|++++++||+|++++
T Consensus        78 v~~-dg~~y~ii~e~dIlavi~~   99 (99)
T d1p3ha_          78 IKY-NGEEYLILSARDVLAVVSK   99 (99)
T ss_dssp             EEE-TTEEEEEEEGGGEEEEEEC
T ss_pred             EEE-CCEEEEEEEHHHEEEEEEC
T ss_conf             999-9999999997878999969



>d1aono_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1we3o_ b.35.1.1 (O:) Chaperonin-10 (GroES) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1g31a_ b.35.1.1 (A:) GP31 co-chaperonin {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 111 co-chaperonin GroES [Candidatus Liberibacter asiat
1we3_O_100 (O:) CPN10(groes); chaperonin, chaperone, groel, H 5e-21
1pcq_O_97 (O:) Groes protein; chaperone; HET: ADP; 2.81A {Es 1e-19
1p3h_A_99 (A:) 10 kDa chaperonin; beta barrel, acidic cluste 3e-19
>1we3_O (O:) CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus}Length = 100 Back     alignment and structure
 Score = 94.1 bits (234), Expect = 5e-21
 Identities = 43/102 (42%), Positives = 70/102 (68%), Gaps = 4/102 (3%)

Query: 3   GEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGK 62
            E K  ++P   RVVV+R++ E KT  G I++PDT  EKP    G+++ VG G + ++G+
Sbjct: 2   AEVKTVIKPLGDRVVVKRIEEEPKTKGG-IVLPDTAKEKPQ--KGKVIAVGTGRVLENGQ 58

Query: 63  VIEPEVSKGDIVLFGKWSGTEIKLNDGEEYLVMQESDIMGIV 104
            +  EV +GDIV+F K+ GTEI++ DGEEY+++ E D++ ++
Sbjct: 59  RVPLEVKEGDIVVFAKYGGTEIEI-DGEEYVILSERDLLAVL 99


>1pcq_O (O:) Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli}Length = 97 Back     alignment and structure
>1p3h_A (A:) 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis}Length = 99 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target111 co-chaperonin GroES [Candidatus Liberibacter asiaticus
1we3_O_100 CPN10(groes); chaperonin, chaperone, groel, HSP60, 99.97
1pcq_O_97 Groes protein; chaperone; HET: ADP; 2.81A {Escheri 99.97
1p3h_A_99 10 kDa chaperonin; beta barrel, acidic cluster, fl 99.97
1g31_A_111 GP31; chaperone, CO-chaperonin, groes, in VIVO pro 95.49
1vj0_A_41-178_327-380192 Alcohol dehydrogenase, zinc-containing; TM0436, st 90.14
>1we3_O (O:) CPN10(groes); chaperonin, chaperone, groel, HSP60, HSP10, folding, ADP, ATP; HET: ADP; 2.80A {Thermus thermophilus} Back     alignment and structure
Probab=99.97  E-value=4.3e-32  Score=198.48  Aligned_cols=100  Identities=43%  Similarity=0.808  Sum_probs=93.1

Q ss_pred             CCCCCCCCCCCCCEEEEEECCCCCCCCCCEEEECCCCCCCCCCEEEEEEEECCCEECCCCCEECCEECCCCEEEEECCCC
Q ss_conf             86523242517847999974754212255799457655465302479998238708678879022031378899705686
Q gi|254780848|r    2 VGEHKNYLRPTRGRVVVRRLQSEIKTATGNILIPDTVSEKPSASSGEIMWVGAGVMDQSGKVIEPEVSKGDIVLFGKWSG   81 (111)
Q Consensus         2 ~~~~~~~ikPl~drVLVk~~~~e~~T~~GgI~lp~~~~ek~~~~~G~VvavG~g~~~~~G~~~p~~vkvGD~Vl~~~~~g   81 (111)
                      ++..+|+|+||+|||||++.+++++|+ |||+||+++++++  ++|+|+|||||+++.+|+.+|+++++||+|+|++|+|
T Consensus         1 a~~~~~~i~PL~DrVLV~~~e~e~~T~-gGI~Lp~~~~~k~--~~G~VvAvG~g~~~~~G~~~p~~vk~GD~Vlf~~~~g   77 (100)
T 1we3_O            1 AAEVKTVIKPLGDRVVVKRIEEEPKTK-GGIVLPDTAKEKP--QKGKVIAVGTGRVLENGQRVPLEVKEGDIVVFAKYGG   77 (100)
T ss_dssp             ----CCCEEECTTCEEEEECCCCSSCT-TCCCCCTTTSCCC--SEEEESCCCCCEECTTSCEECCSCCTTCEEEECTTCS
T ss_pred             CHHHCCCCEECCCEEEEEECCCCCEEE-CCEEECCCCCCCE--EEEEEEEECCCEECCCCCEECCEEEECCEEEECCCCC
T ss_conf             922525751068999998754033011-5369765014440--6889998546178588989677887488999846787


Q ss_pred             CEEEECCCCEEEEEEHHHEEEEEE
Q ss_conf             088976997799985301789984
Q gi|254780848|r   82 TEIKLNDGEEYLVMQESDIMGIVV  105 (111)
Q Consensus        82 ~~v~~~dg~~y~i~~e~dIlavi~  105 (111)
                      +++++ ||++|+|++++||||+++
T Consensus        78 ~ev~~-~~~~y~ii~~~DIla~ie  100 (100)
T 1we3_O           78 TEIEI-DGEEYVILSERDLLAVLQ  100 (100)
T ss_dssp             EEEEC-SSCEEEEECTTTEEEEEC
T ss_pred             CEEEE-CCEEEEEEEHHHEEEEEC
T ss_conf             29999-999999999799799959



>1pcq_O (O:) Groes protein; chaperone; HET: ADP; 2.81A {Escherichia coli} Back     alignment and structure
>1p3h_A (A:) 10 kDa chaperonin; beta barrel, acidic cluster, flexible loop, structural genomics, PSI, protein structure initiative; 2.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1g31_A (A:) GP31; chaperone, CO-chaperonin, groes, in VIVO protein folding, bacteriophage T4; 2.30A {Enterobacteria phage T4} Back     alignment and structure
>1vj0_A (A:41-178,A:327-380) Alcohol dehydrogenase, zinc-containing; TM0436, structural genomics, JCSG, PSI, protein structure initiative; 2.00A {Thermotoga maritima} Back     alignment and structure