254780858

254780858

NADH dehydrogenase I subunit F

GeneID in NCBI database:8209873Locus tag:CLIBASIA_03765
Protein GI in NCBI database:254780858Protein Accession:YP_003065271.1
Gene range:+(826256, 827533)Protein Length:425aa
Gene description:NADH dehydrogenase I subunit F
COG prediction:none
KEGG prediction:nuoF; NADH dehydrogenase I subunit F (EC:1.6.99.5); K00335 NADH dehydrogenase I subunit F [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain F (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-----
MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ
ccHHHHHHHHHHcccccccHHHHHHcccHHHHHHHHHccHHHHHHHHHHccccccccccccHHHHcccccccccccccEEEEEccccccHHHHHHHHHHHcHHHHHHHHHHHHHHccccEEEEEEEcccHHHHHHHHHHHHHHHHccccccccccccccEEEEEEccccccccHHHHHHHHHccccccccccccccccccccccccEEEcHHHHHHHHHHHHccHHHHHHHccccccccEEEEEEcccccccEEEEEccccHHHHHHHHccccccccccccEEEEcccccccccHHHHccccccHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcHHHHHHHHHHccccccc
ccccHcHHHHcccccccccHHHHHHccccHHHHHHHHcccHHHHHHHHHcccccccccccccccEEEccccccccccEEEEEEcccccccccccHHHHccccccHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccccEcccHHHHHHHHHcccccccccccccccccccccccccccccccHcccHHHHHccHHHHHHccccccccEEEEEEEcccccccccHHHccccHHHHHHHHccccccccHHHEEEcccccccccccHHHHHcccccHHHHHHHccccccEEEEEEcccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHcccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
MLTDQDRIFTNlyglqgkslsdsmsrghwdNVDKILEKGRDWIINEVkasglrgrggagfstgmkwsfmpkvcsdrphylvvnadesepgtckdrdimrhephtliegcviasfaIGAHCAFIYVRGEFIRERESLQAAVDECYasgllgsnsklgydvdiivhhgagayicGEETALLESlegkkgqprlkppfpanvglygcpttvnnvesiaVVPTILRrgaswysgfgrennrgtklfsisghvnypctveeSMSITFDELIEKHcggirggwdnllavipggssvpclpagqmrgaimdydglkemgsglGTAAVIVMDRSTDIIKAIWRLSVFykhescgqctpcregtgWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDqyhrcnfq
MLTDQDRIFTNLYglqgkslsdsmsrgHWDNVDKILEKGRDWIINevkasglrgrggaGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVfykhescgqctpcregtgWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ
MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ
***DQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQY******
MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ
*LTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRC***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ
MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ
MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRGAIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCNFQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
254781101472 UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diamino 0.001
>gi|254781101|ref|YP_003065514.1| UDP-N-acetylmuramoylalanyl-D-glutamyl-2, 6-diaminopimelate/D-alanyl-D-alanyl ligase [Candidatus Liberibacter asiaticus str. psy62] Length = 472 Back     alignment
 Score = 36.2 bits (82), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 47/107 (43%), Gaps = 12/107 (11%)

Query: 297 QMRGAIMD-------YDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCT 349
           Q++G  M+       Y   + M   LG  +++  D  T    AI  LSVF+  E  G+  
Sbjct: 275 QLQGKSMEVVHHGIGYHMAQNMLMTLGIVSILTADVDT----AIKALSVFHPKEGRGKRY 330

Query: 350 PCREGTGWMMRVMERLVKGIAQ-KREIDLLYEVSKNIEGRTICALGD 395
            C    G+   + E      A  K  I +L ++S + EGR I  LGD
Sbjct: 331 RCALNQGFFTLIDESYNANPASMKAAISVLSQISPHGEGRRIAVLGD 377

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
315122721424 NADH dehydrogenase I subunit F [Candidatus Liberibacter 1 0.0
150396117434 NADH dehydrogenase I subunit F [Sinorhizobium medicae W 1 0.0
15965023434 NADH dehydrogenase I subunit F [Sinorhizobium meliloti 1 0.0
227821623434 NADH dehydrogenase I subunit F [Sinorhizobium fredii NG 1 0.0
163759536435 nadh dehydrogenase i chain f transmembrane protein [Hoe 1 0.0
110633381434 NADH dehydrogenase I subunit F [Mesorhizobium sp. BNC1] 1 0.0
116251471434 NADH dehydrogenase I subunit F [Rhizobium leguminosarum 1 0.0
222148279434 NADH dehydrogenase I subunit F [Agrobacterium vitis S4] 1 0.0
209548868434 NADH dehydrogenase I subunit F [Rhizobium leguminosarum 1 0.0
222085581434 NADH-quinone oxidoreductase, F subunit [Agrobacterium r 1 0.0
>gi|315122721|ref|YP_004063210.1| NADH dehydrogenase I subunit F [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 424 Back     alignment and organism information
 Score =  805 bits (2080), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/424 (90%), Positives = 401/424 (94%)

Query: 1   MLTDQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILEKGRDWIINEVKASGLRGRGGAGF 60
           ML DQDRIFTNLYGL+GKSL +SM+RGHWD  D IL KGRDWII+EVKASGLRGRGGAGF
Sbjct: 1   MLKDQDRIFTNLYGLKGKSLDESMARGHWDGTDNILGKGRDWIISEVKASGLRGRGGAGF 60

Query: 61  STGMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHC 120
           STGMKWSFMPK CSDRPHYLVVNADESEPGTCKDRDIMRHEPH LIEGCVIASFAIGAHC
Sbjct: 61  STGMKWSFMPKTCSDRPHYLVVNADESEPGTCKDRDIMRHEPHVLIEGCVIASFAIGAHC 120

Query: 121 AFIYVRGEFIRERESLQAAVDECYASGLLGSNSKLGYDVDIIVHHGAGAYICGEETALLE 180
            FIYVRGEFIRERESLQ AVDECYA GLLG NSKLGYDVDIIVHHGAGAYICGEETALLE
Sbjct: 121 VFIYVRGEFIRERESLQTAVDECYARGLLGRNSKLGYDVDIIVHHGAGAYICGEETALLE 180

Query: 181 SLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTK 240
           SLEGKKG PRLKPPFPAN+GLYGCPTTVNNVESIAVVPTILRRGASWYS FGRENNRGTK
Sbjct: 181 SLEGKKGLPRLKPPFPANMGLYGCPTTVNNVESIAVVPTILRRGASWYSSFGRENNRGTK 240

Query: 241 LFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMRG 300
           LFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCL   QMRG
Sbjct: 241 LFSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLTGDQMRG 300

Query: 301 AIMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTGWMMR 360
           AIMDYD LK MGSGLGTAAVIVMDRSTDII+AIWRLSVFYKHESCGQCTPCREGTGWMMR
Sbjct: 301 AIMDYDSLKAMGSGLGTAAVIVMDRSTDIIRAIWRLSVFYKHESCGQCTPCREGTGWMMR 360

Query: 361 VMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYH 420
           +MER+V+G+AQK EID+L+EVSKNIEGRTICALGDAAAWPIQGLIKNFR ++EERIDQY+
Sbjct: 361 LMERMVRGVAQKHEIDMLFEVSKNIEGRTICALGDAAAWPIQGLIKNFRHVMEERIDQYN 420

Query: 421 RCNF 424
             +F
Sbjct: 421 VHHF 424


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396117|ref|YP_001326584.1| NADH dehydrogenase I subunit F [Sinorhizobium medicae WSM419] Length = 434 Back     alignment and organism information
>gi|15965023|ref|NP_385376.1| NADH dehydrogenase I subunit F [Sinorhizobium meliloti 1021] Length = 434 Back     alignment and organism information
>gi|227821623|ref|YP_002825593.1| NADH dehydrogenase I subunit F [Sinorhizobium fredii NGR234] Length = 434 Back     alignment and organism information
>gi|163759536|ref|ZP_02166621.1| nadh dehydrogenase i chain f transmembrane protein [Hoeflea phototrophica DFL-43] Length = 435 Back     alignment and organism information
>gi|110633381|ref|YP_673589.1| NADH dehydrogenase I subunit F [Mesorhizobium sp. BNC1] Length = 434 Back     alignment and organism information
>gi|116251471|ref|YP_767309.1| NADH dehydrogenase I subunit F [Rhizobium leguminosarum bv. viciae 3841] Length = 434 Back     alignment and organism information
>gi|222148279|ref|YP_002549236.1| NADH dehydrogenase I subunit F [Agrobacterium vitis S4] Length = 434 Back     alignment and organism information
>gi|209548868|ref|YP_002280785.1| NADH dehydrogenase I subunit F [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 434 Back     alignment and organism information
>gi|222085581|ref|YP_002544111.1| NADH-quinone oxidoreductase, F subunit [Agrobacterium radiobacter K84] Length = 434 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
KOG2658478 KOG2658, KOG2658, KOG2658, NADH:ubiquinone oxidoreducta 0.0
PRK13596433 PRK13596, PRK13596, NADH dehydrogenase I subunit F; Pro 0.0
PLN03132461 PLN03132, PLN03132, NADH dehydrogenase (ubiquinone) fla 0.0
PTZ00304461 PTZ00304, PTZ00304, NADH dehydrogenase [ubiquinone] fla 0.0
TIGR01959411 TIGR01959, nuoF_fam, NADH-quinone oxidoreductase, F sub 0.0
COG1894424 COG1894, NuoF, NADH:ubiquinone oxidoreductase, NADH-bin 0.0
PRK11278448 PRK11278, PRK11278, NADH dehydrogenase I subunit F; Pro 8e-93
pfam01512150 pfam01512, Complex1_51K, Respiratory-chain NADH dehydro 4e-48
COG4656529 COG4656, RnfC, Predicted NADH:ubiquinone oxidoreductase 3e-08
pfam1058946 pfam10589, NADH_4Fe-4S, NADH-ubiquinone oxidoreductase- 1e-14
TIGR01945435 TIGR01945, rnfC, electron transport complex, RnfABCDGE 4e-06
PRK05035 695 PRK05035, PRK05035, electron transport complex protein 9e-06
pfam1053152 pfam10531, SLBB, SLBB domain 3e-05
>gnl|CDD|37869 KOG2658, KOG2658, KOG2658, NADH:ubiquinone oxidoreductase, NDUFV1/51kDa subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|184170 PRK13596, PRK13596, NADH dehydrogenase I subunit F; Provisional Back     alignment and domain information
>gnl|CDD|178678 PLN03132, PLN03132, NADH dehydrogenase (ubiquinone) flavoprotein 1; Provisional Back     alignment and domain information
>gnl|CDD|185547 PTZ00304, PTZ00304, NADH dehydrogenase [ubiquinone] flavoprotein 1; Provisional Back     alignment and domain information
>gnl|CDD|131014 TIGR01959, nuoF_fam, NADH-quinone oxidoreductase, F subunit Back     alignment and domain information
>gnl|CDD|32078 COG1894, NuoF, NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|183071 PRK11278, PRK11278, NADH dehydrogenase I subunit F; Provisional Back     alignment and domain information
>gnl|CDD|144926 pfam01512, Complex1_51K, Respiratory-chain NADH dehydrogenase 51 Kd subunit Back     alignment and domain information
>gnl|CDD|34275 COG4656, RnfC, Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|151119 pfam10589, NADH_4Fe-4S, NADH-ubiquinone oxidoreductase-F iron-sulfur binding region Back     alignment and domain information
>gnl|CDD|162617 TIGR01945, rnfC, electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>gnl|CDD|179919 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|151080 pfam10531, SLBB, SLBB domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
TIGR01959420 nuoF_fam NADH-quinone oxidoreductase, F subunit; InterP 100.0
PRK13596426 NADH dehydrogenase I subunit F; Provisional 100.0
PTZ00304483 NADH dehydrogenase (ubiquinone); Provisional 100.0
COG1894424 NuoF NADH:ubiquinone oxidoreductase, NADH-binding (51 k 100.0
PRK11278448 NADH dehydrogenase I subunit F; Provisional 100.0
KOG2658478 consensus 100.0
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 100.0
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 100.0
PRK05035 725 electron transport complex protein RnfC; Provisional 100.0
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit A; P 99.86
pfam01512150 Complex1_51K Respiratory-chain NADH dehydrogenase 51 Kd 100.0
pfam05896257 NQRA Na(+)-translocating NADH-quinone reductase subunit 93.38
pfam1058946 NADH_4Fe-4S NADH-ubiquinone oxidoreductase-F iron-sulfu 99.52
pfam1053152 SLBB SLBB domain. 98.79
TIGR03028239 EpsE polysaccharide export protein EpsE. Sequences in t 94.3
COG1596239 Wza Periplasmic protein involved in polysaccharide expo 93.01
pfam1197351 NQRA_SLBB NQRA C-terminal domain. This family consists 91.66
TIGR01936466 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocatin 96.97
COG1726447 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, s 96.61
TIGR03027165 pepcterm_export putative polysaccharide export protein, 94.65
TIGR03028239 EpsE polysaccharide export protein EpsE. Sequences in t 91.82
>TIGR01959 nuoF_fam NADH-quinone oxidoreductase, F subunit; InterPro: IPR011537 This entry describes the F chain of complexes that resemble NADH-quinone oxidoreductases Back     alignment and domain information
>PRK13596 NADH dehydrogenase I subunit F; Provisional Back     alignment and domain information
>PTZ00304 NADH dehydrogenase (ubiquinone); Provisional Back     alignment and domain information
>COG1894 NuoF NADH:ubiquinone oxidoreductase, NADH-binding (51 kD) subunit [Energy production and conversion] Back     alignment and domain information
>PRK11278 NADH dehydrogenase I subunit F; Provisional Back     alignment and domain information
>KOG2658 consensus Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit; InterPro: IPR010208 The six subunit complex RnfABCDGE in Rhodobacter capsulatus encodes an apparent NADH oxidoreductase responsible for electron transport to nitrogenase, necessary for nitrogen fixation Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>pfam01512 Complex1_51K Respiratory-chain NADH dehydrogenase 51 Kd subunit Back     alignment and domain information
>pfam05896 NQRA Na(+)-translocating NADH-quinone reductase subunit A (NQRA) Back     alignment and domain information
>pfam10589 NADH_4Fe-4S NADH-ubiquinone oxidoreductase-F iron-sulfur binding region Back     alignment and domain information
>pfam10531 SLBB SLBB domain Back     alignment and domain information
>TIGR03028 EpsE polysaccharide export protein EpsE Back     alignment and domain information
>COG1596 Wza Periplasmic protein involved in polysaccharide export, contains SLBB domain of b-grasp fold [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>pfam11973 NQRA_SLBB NQRA C-terminal domain Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit; InterPro: IPR008703 This family consists of several bacterial Na^+-translocating NADH-quinone reductase subunit A (NQRA) proteins Back     alignment and domain information
>COG1726 NqrA Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrA [Energy production and conversion] Back     alignment and domain information
>TIGR03027 pepcterm_export putative polysaccharide export protein, PEP-CTERM sytem-associated Back     alignment and domain information
>TIGR03028 EpsE polysaccharide export protein EpsE Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
2fug_1438 Crystal Structure Of The Hydrophilic Domain Of Resp 1e-130
gi|90109654|pdb|2FUG|1 Chain 1, Crystal Structure Of The Hydrophilic Domain Of Respiratory Complex I From Thermus Thermophilus Length = 438 Back     alignment and structure
 Score =  470 bits (1209), Expect = e-130,   Method: Composition-based stats.
 Identities = 189/420 (45%), Positives = 261/420 (62%), Gaps = 8/420 (1%)

Query: 8   IFTNLYGLQGKSLSDSMSRGHWDNVDKIL-EKGRDWIINEVKASGLRGRGGAGFSTGMKW 66
           ++ ++      +L   +  G ++   ++L EK  D +I EVK SGLRGRGGAGF TG+KW
Sbjct: 17  LYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKW 76

Query: 67  SFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVR 126
           SFMPK    + HYL+ NADESEPG+ KDR I+   PH LIEG ++A +AI A   +IYVR
Sbjct: 77  SFMPK-DDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVR 135

Query: 127 GEFIRERESLQAAVDECYASGLLGSN-SKLGYDVDIIVHHGAGAYICGEETALLESLEGK 185
           GE+ R  + L+ A+ E  A G LG N     +  D+ VH GAGAYICGEETAL+ SLEG 
Sbjct: 136 GEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSLEGL 195

Query: 186 KGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLFSIS 245
           +  PRLKPPFPA  GL+G PTT+NNVE++A V  I+ RGA W++  G E ++G KL+ IS
Sbjct: 196 RANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLYQIS 255

Query: 246 GHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAGQMR-GAIMD 304
           G V  P   E  M  TF ELI +  GG     + + A+IPGGSS P LP  +      M 
Sbjct: 256 GPVKRPGVYELPMGTTFRELIYEWAGG---PLEPIQAIIPGGSSTPPLPFTEEVLDTPMS 312

Query: 305 YDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGT-GWMMRVME 363
           Y+ L+  GS LGT  VI++     ++ A+W L+ FY HESCG+CTPCREG  G+M+ +  
Sbjct: 313 YEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFA 372

Query: 364 RLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYHRCN 423
           ++  G  ++++++ L  +   IEGR+ C L DAA WP++G +++F+        +     
Sbjct: 373 KIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALAREKRPVP 432


Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
3i9v_1438 NADH-quinone oxidoreductase subunit 1; electron transpo 1e-107
>3i9v_1 NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* Length = 438 Back     alignment and structure
 Score =  382 bits (983), Expect = e-107
 Identities = 189/422 (44%), Positives = 264/422 (62%), Gaps = 9/422 (2%)

Query: 5   QDRIFTNLYGLQGKSLSDSMSRGHWDNVDKIL-EKGRDWIINEVKASGLRGRGGAGFSTG 63
           +  ++ ++      +L   +  G ++   ++L EK  D +I EVK SGLRGRGGAGF TG
Sbjct: 14  ERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTG 73

Query: 64  MKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFI 123
           +KWSFMPK    + HYL+ NADESEPG+ KDR I+   PH LIEG ++A +AI A   +I
Sbjct: 74  LKWSFMPK-DDGKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYI 132

Query: 124 YVRGEFIRERESLQAAVDECYASGLLG-SNSKLGYDVDIIVHHGAGAYICGEETALLESL 182
           YVRGE+ R  + L+ A+ E  A G LG +     +  D+ VH GAGAYICGEETAL+ SL
Sbjct: 133 YVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSL 192

Query: 183 EGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKLF 242
           EG +  PRLKPPFPA  GL+G PTT+NNVE++A V  I+ RGA W++  G E ++G KL+
Sbjct: 193 EGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKLY 252

Query: 243 SISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLP-AGQMRGA 301
            ISG V  P   E  M  TF ELI +  GG     + + A+IPGGSS P LP   ++   
Sbjct: 253 QISGPVKRPGVYELPMGTTFRELIYEWAGGP---LEPIQAIIPGGSSTPPLPFTEEVLDT 309

Query: 302 IMDYDGLKEMGSGLGTAAVIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGT-GWMMR 360
            M Y+ L+  GS LGT  VI++     ++ A+W L+ FY HESCG+CTPCREG  G+M+ 
Sbjct: 310 PMSYEHLQAKGSMLGTGGVILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVN 369

Query: 361 VMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAAWPIQGLIKNFRPLIEERIDQYH 420
           +  ++  G  ++++++ L  +   IEGR+ C L DAA WP++G +++F+        +  
Sbjct: 370 LFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAVWPVKGSLRHFKDQYLALARE-K 428

Query: 421 RC 422
           R 
Sbjct: 429 RP 430


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
3i9v_1438 NADH-quinone oxidoreductase subunit 1; electron transpo 100.0
2j58_A359 WZA, outer membrane lipoprotein WZA; membrane protein; 91.2
>3i9v_1 NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* 3m9s_1* Back     alignment and structure
Probab=100.00  E-value=0  Score=924.42  Aligned_cols=414  Identities=45%  Similarity=0.830  Sum_probs=394.2

Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHCCCHHHHHHHHH-CCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCEEEEE
Q ss_conf             0343675517876779899997799899999982-698999999998397768757112455687423565688619998
Q gi|254780858|r    4 DQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILE-KGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVV   82 (425)
Q Consensus         4 ~~~r~~~~~~~~~~~~l~~y~~~ggy~~l~~~l~-~~~~~ii~~v~~sgl~GrGGAgFPt~~Kw~~~~~~~~~~~~yvv~   82 (425)
                      .++.+|+|.+..++++|++|+++|||++|+|+++ |+|++++++|++||||||||||||||+||+++++.. .+++||||
T Consensus        13 ~~~~~~~~~~~~~~~~~~~y~~~ggy~~~~~~l~~~~p~~ii~~i~~aGl~GrGGAgFPT~vK~~~~~~~~-~~~~~vii   91 (438)
T 3i9v_1           13 FERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDD-GKQHYLIC   91 (438)
T ss_dssp             CCCCSTTSTTSTTTTSHHHHHHTTCTHHHHHHHHSSCHHHHHHHHHTTTCBCTTTTCCBHHHHHTTSCSSC-SCCCEEEE
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCHHHHHHHCCCCC-CCCCEEEE
T ss_conf             42498852799997789999976999999999871899999999998198757767470547777355668-99858999


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCEE
Q ss_conf             5767784860048999862589999999999971836389981555178999999999999868997767-678866406
Q gi|254780858|r   83 NADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSN-SKLGYDVDI  161 (425)
Q Consensus        83 N~~E~EPgt~kDr~Ll~~~p~~vieG~~i~a~a~gA~~~~I~ir~ey~~~~~~l~~ai~ea~~~g~lg~~-~~~g~~~~i  161 (425)
                      ||+||||++||||+||+++||+|||||+|+++++||+++|||||+||++++++|++||++++++|+||+| ++++++++|
T Consensus        92 Ng~EcEP~~~kD~~Lm~~~p~~vieG~~i~~~a~gA~~~~I~i~~~~~~ai~~l~~ai~~a~~~g~lg~~~~g~~~~~~i  171 (438)
T 3i9v_1           92 NADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDL  171 (438)
T ss_dssp             ECCCCSTTCCSHHHHHHHCHHHHHHHHHHHHHHHTCCEEEEEECTTCHHHHHHHHHHHHHHHHTTSSBTTGGGSSCCBEE
T ss_pred             ECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCE
T ss_conf             68678623441399997778999999999999858875899823035999999999999988748656545688887207


Q ss_pred             EEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCHHHHHHCCCCCCCCEEE
Q ss_conf             99745751001107889986308999868889986227830378500028999999999960568886338987743047
Q gi|254780858|r  162 IVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGTKL  241 (425)
Q Consensus       162 ~v~~g~g~Yi~GeEtali~sieG~r~~Pr~kPP~p~~~Gl~g~PT~V~NVeTla~v~~i~~~G~~~y~~~G~~~~~Gtkl  241 (425)
                      +|++++++|||||||+||+|+||+|+.||.|||||+++|+|++||+||||||+++|+.|+++|.+||+++|++.++|||+
T Consensus       172 ~V~~~~~~Yp~GeE~aLi~al~G~r~~pr~~pP~p~~~Gl~~~pt~v~NVeT~~~v~~ii~~G~~~~~~~gt~~~~Gtkl  251 (438)
T 3i9v_1          172 HVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGMKL  251 (438)
T ss_dssp             EEEECCSCGGGGSHHHHHHHHTTSCCCCCCCSSCTTTSCGGGSCEEEEEHHHHHTHHHHHHSCHHHHHTBBCSSSBSEEE
T ss_pred             EEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCEEEEEHHHHHHHHHHHHHCHHHHHCCCCCCCCCEEE
T ss_conf             99978984235789999998639757999999975321223787366529999987899984969885348778997179


Q ss_pred             EECCCCCCCCEEEEECCCCCHHHHHHHHHCCCCCCCCCEEEEEECCCCCCCCCCC--CCCCCCCCCCCHHHCCCCCCCCE
Q ss_conf             6426788787268935898799999986155678711004898524565653210--02456334220110387346651
Q gi|254780858|r  242 FSISGHVNYPCTVEESMSITFDELIEKHCGGIRGGWDNLLAVIPGGSSVPCLPAG--QMRGAIMDYDGLKEMGSGLGTAA  319 (425)
Q Consensus       242 ~tvsG~V~~Pg~~evp~Gt~l~eli~~~~GG~~~~~~~~kav~~GG~~~g~l~~~--~ld~~~ld~~~l~~~Gs~LGsg~  319 (425)
                      +||||+|++|++||||+|||++|||+.++|+..   .+++++++||+++++++..  .+| +|+||+++.+.|+++||++
T Consensus       252 ~tvsG~V~~P~~~evp~Gt~l~eli~~~gG~~~---~~~~~v~~gG~~~~~~~~~~~~~d-~p~~~~~l~~~g~~lgtg~  327 (438)
T 3i9v_1          252 YQISGPVKRPGVYELPMGTTFRELIYEWAGGPL---EPIQAIIPGGSSTPPLPFTEEVLD-TPMSYEHLQAKGSMLGTGG  327 (438)
T ss_dssp             EEEESSBSSCEEEEEETTCBHHHHHHTTTCCBS---SCEEEEECSSSSSCCEESCHHHHT-SBCSTTTTGGGSSCCSSSE
T ss_pred             EEECCCCCCCEEEEECCCCCHHHHHHHHCCCCC---CCCEEEEECCCCCCCCCCHHHHCC-CCCCHHHHHHCCCEECCCC
T ss_conf             971576368806996798728999998658766---674399956877664321012126-7674677986297303676


Q ss_pred             EEEECCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHH-HHHHHHHHHHCCCCCHHHHHHHHHHHHHHCCCCCCCCCHHHH
Q ss_conf             7994286528999999999998762799885230289-999999999828999899999999998622366677650247
Q gi|254780858|r  320 VIVMDRSTDIIKAIWRLSVFYKHESCGQCTPCREGTG-WMMRVMERLVKGIAQKREIDLLYEVSKNIEGRTICALGDAAA  398 (425)
Q Consensus       320 iiV~de~~~iv~~~~~~~~F~a~ESCGkCtPCR~Gt~-~l~~il~~i~~G~a~~~Dl~~L~~la~~i~~~S~C~lG~~a~  398 (425)
                      |+|+|+++||++.+.++++||++||||||+|||+|++ ++.++++++..|+++.+|+++|+++++.|..+|+|+|++.++
T Consensus       328 iivl~~~~~~v~~~~~~~~f~a~ESCgqC~pCr~G~p~~l~~il~~i~~g~~~~~dl~~l~~l~~~i~~~s~C~~~~~a~  407 (438)
T 3i9v_1          328 VILIPERVSMVDAMWNLTRFYAHESCGKCTPCREGVAGFMVNLFAKIGTGQGEEKDVENLEALLPLIEGRSFCPLADAAV  407 (438)
T ss_dssp             EEEEETTSCHHHHHHHHHHHHHHHCCSCCHHHHTTTTTHHHHHHHHHTTTCCCHHHHHHHHHHHHHHTTCCSSTHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHCCCCCCCCCCHHHH
T ss_conf             32578301489999999875047778999584888699999999999967999899999999997614998267977889


Q ss_pred             HHHHHHHHHCHHHHHHHHHHHCCCC
Q ss_conf             9999998638899999986518999
Q gi|254780858|r  399 WPIQGLIKNFRPLIEERIDQYHRCN  423 (425)
Q Consensus       399 ~pv~s~l~~F~dEfe~hI~~~~rCp  423 (425)
                      +|+.|+|++|++||++|+++ +||-
T Consensus       408 ~pl~s~lr~F~~Ef~a~~~~-kr~~  431 (438)
T 3i9v_1          408 WPVKGSLRHFKDQYLALARE-KRPV  431 (438)
T ss_dssp             HHHHHHHHHHHHHHHHHHHT-TCCC
T ss_pred             HHHHHHHHHHHHHHHHHHHC-CCCC
T ss_conf             99999999989999999974-8999



>2j58_A WZA, outer membrane lipoprotein WZA; membrane protein; 2.26A {Escherichia coli} PDB: 2w8i_A 2w8h_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
d2fug12243 c.142.1.1 (1:7-249) NADH-quinone oxidoreductase chain 1 2e-67
d2fug11105 a.29.12.1 (1:334-438) NADH-quinone oxidoreductase chain 1e-28
d2fug1384 d.15.13.1 (1:250-333) NADH-quinone oxidoreductase chain 2e-21
>d2fug12 c.142.1.1 (1:7-249) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} Length = 243 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Nqo1 FMN-binding domain-like
superfamily: Nqo1 FMN-binding domain-like
family: Nqo1 FMN-binding domain-like
domain: NADH-quinone oxidoreductase chain 1, Nqo1
species: Thermus thermophilus [TaxId: 274]
 Score =  250 bits (640), Expect = 2e-67
 Identities = 119/236 (50%), Positives = 156/236 (66%), Gaps = 3/236 (1%)

Query: 5   QDRIFTNLYGLQGKSLSDSMSRGHWDNVDKIL-EKGRDWIINEVKASGLRGRGGAGFSTG 63
           +  ++ ++      +L   +  G ++   ++L EK  D +I EVK SGLRGRGGAGF TG
Sbjct: 8   ERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTG 67

Query: 64  MKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFI 123
           +KWSFMPK      HYL+ NADESEPG+ KDR I+   PH LIEG ++A +AI A   +I
Sbjct: 68  LKWSFMPKDDGK-QHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYI 126

Query: 124 YVRGEFIRERESLQAAVDECYASGLLGSN-SKLGYDVDIIVHHGAGAYICGEETALLESL 182
           YVRGE+ R  + L+ A+ E  A G LG N     +  D+ VH GAGAYICGEETAL+ SL
Sbjct: 127 YVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNSL 186

Query: 183 EGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRG 238
           EG +  PRLKPPFPA  GL+G PTT+NNVE++A V  I+ RGA W++  G E ++G
Sbjct: 187 EGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKG 242


>d2fug11 a.29.12.1 (1:334-438) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} Length = 105 Back     information, alignment and structure
>d2fug13 d.15.13.1 (1:250-333) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} Length = 84 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
d2fug12243 NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus ther 100.0
d2fug11105 NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus ther 99.96
d2fug1384 NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus ther 99.9
>d2fug12 c.142.1.1 (1:7-249) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Nqo1 FMN-binding domain-like
superfamily: Nqo1 FMN-binding domain-like
family: Nqo1 FMN-binding domain-like
domain: NADH-quinone oxidoreductase chain 1, Nqo1
species: Thermus thermophilus [TaxId: 274]
Probab=100.00  E-value=0  Score=593.12  Aligned_cols=235  Identities=51%  Similarity=0.903  Sum_probs=226.3

Q ss_pred             HHHH-HHHHHCCCCCCCHHHHHHCCCHHHHHHHHH-CCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCEEEE
Q ss_conf             0343-675517876779899997799899999982-69899999999839776875711245568742356568861999
Q gi|254780858|r    4 DQDR-IFTNLYGLQGKSLSDSMSRGHWDNVDKILE-KGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLV   81 (425)
Q Consensus         4 ~~~r-~~~~~~~~~~~~l~~y~~~ggy~~l~~~l~-~~~~~ii~~v~~sgl~GrGGAgFPt~~Kw~~~~~~~~~~~~yvv   81 (425)
                      ++.| +|+|.+..++++|++|+++|||++|+|+++ |+|++|+++|++||||||||||||||+||+++++.. ..++|||
T Consensus         6 k~~~vi~~~~~~~~~~~l~~Y~~~GGY~~l~kal~~~~pe~ii~~v~~sgL~GrGGAgFPt~~Kw~~~~~~~-~~~~yvV   84 (243)
T d2fug12           6 RFERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDD-GKQHYLI   84 (243)
T ss_dssp             TCTTCCCCSSCCCSCCSHHHHHTTTTTHHHHHHHHHSCHHHHHHHHHTTTCBCTTSSCCBHHHHHHTSCSSS-CCCCEEE
T ss_pred             CHHHHHHHCCCCCCCCCHHHHHHCCCHHHHHHHHHCCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHCCHHC-CCCEEEE
T ss_conf             054698842799999999999986999999999973999999999998544421456898514565230104-8860798


Q ss_pred             EECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCE
Q ss_conf             85767784860048999862589999999999971836389981555178999999999999868997767-67886640
Q gi|254780858|r   82 VNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSN-SKLGYDVD  160 (425)
Q Consensus        82 ~N~~E~EPgt~kDr~Ll~~~p~~vieG~~i~a~a~gA~~~~I~ir~ey~~~~~~l~~ai~ea~~~g~lg~~-~~~g~~~~  160 (425)
                      ||||||||++||||+||+++||+|||||+|+|+++||+++|||||+||++++++|++||++++++|+||++ ++++++++
T Consensus        85 vN~~E~EPg~~kDr~Ll~~~Ph~vieG~~iaa~avgA~~~~I~ir~e~~~ai~~l~~ai~~a~~~g~lg~~i~g~~~~~~  164 (243)
T d2fug12          85 CNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFD  164 (243)
T ss_dssp             EEECCCSTTCCSHHHHHHHCHHHHHHHHHHHHHHTTCSEEEEEECTTCHHHHHHHHHHHHHHHHTTSSBSSTTSTTCCBE
T ss_pred             EECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEE
T ss_conf             64578986344789999986999999999999973766389984446588999999999998776987766558899803


Q ss_pred             EEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCHHHHHHCCCCCCCCE
Q ss_conf             6997457510011078899863089998688899862278303785000289999999999605688863389877430
Q gi|254780858|r  161 IIVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASWYSGFGRENNRGT  239 (425)
Q Consensus       161 i~v~~g~g~Yi~GeEtali~sieG~r~~Pr~kPP~p~~~Gl~g~PT~V~NVeTla~v~~i~~~G~~~y~~~G~~~~~Gt  239 (425)
                      |+|++++++||||||||||+||||+|+.||.|||||+++||||+||+||||||+|+||.|+++|++||+++|+++++|.
T Consensus       165 i~v~~~~g~Yi~GEEtaLi~sleG~~~~pr~~pP~p~~~Gl~g~PTvV~NVeTla~v~~ii~~G~~~f~~~G~~~~~G~  243 (243)
T d2fug12         165 LHVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADWFAQMGTEQSKGM  243 (243)
T ss_dssp             EEEEECCSCGGGGSHHHHHHHHTTSCCCCCCSSSCTTTSBGGGBCEEEEEHHHHHHHHHHHHSCHHHHHSSBCSSCBSE
T ss_pred             EEEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEHHHHHHHHHHHHHHHHHHHHHCCCCCCCCC
T ss_conf             8999888753223047889986087067789999851357679988411799999999999976999995699999998



>d2fug11 a.29.12.1 (1:334-438) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fug13 d.15.13.1 (1:250-333) NADH-quinone oxidoreductase chain 1, Nqo1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 425 NADH dehydrogenase I subunit F [Candidatus Liberib
3i9v_1_1-237237 (1:1-237) NADH-quinone oxidoreductase subunit 1; e 2e-66
3i9v_1_335-438104 (1:335-438) NADH-quinone oxidoreductase subunit 1; 2e-29
3i9v_1_238-33497 (1:238-334) NADH-quinone oxidoreductase subunit 1; 8e-25
>3i9v_1 (1:1-237) NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1*Length = 237 Back     alignment and structure
 Score =  247 bits (632), Expect = 2e-66
 Identities = 116/226 (51%), Positives = 150/226 (66%), Gaps = 3/226 (1%)

Query: 4   DQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKIL-EKGRDWIINEVKASGLRGRGGAGFST 62
            +  ++ ++      +L   +  G ++   ++L EK  D +I EVK SGLRGRGGAGF T
Sbjct: 13  FERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPT 72

Query: 63  GMKWSFMPKVCSDRPHYLVVNADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAF 122
           G+KWSFMPK    + HYL+ NADESEPG+ KDR I+   PH LIEG ++A +AI A   +
Sbjct: 73  GLKWSFMPKDD-GKQHYLICNADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGY 131

Query: 123 IYVRGEFIRERESLQAAVDECYASGLLGSNS-KLGYDVDIIVHHGAGAYICGEETALLES 181
           IYVRGE+ R  + L+ A+ E  A G LG N     +  D+ VH GAGAYICGEETAL+ S
Sbjct: 132 IYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDLHVHRGAGAYICGEETALMNS 191

Query: 182 LEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASW 227
           LEG +  PRLKPPFPA  GL+G PTT+NNVE++A V  I+ RGA W
Sbjct: 192 LEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADW 237


>3i9v_1 (1:335-438) NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1*Length = 104 Back     alignment and structure
>3i9v_1 (1:238-334) NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1*Length = 97 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target425 NADH dehydrogenase I subunit F [Candidatus Liberibacter
3i9v_1_1-237237 NADH-quinone oxidoreductase subunit 1; electron tr 100.0
3i9v_1_335-438104 NADH-quinone oxidoreductase subunit 1; electron tr 99.97
3i9v_1_238-33497 NADH-quinone oxidoreductase subunit 1; electron tr 99.92
2j58_A_47-53_151-23289 WZA, outer membrane lipoprotein WZA; membrane prot 95.22
>3i9v_1 (1:1-237) NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* Back     alignment and structure
Probab=100.00  E-value=0  Score=451.53  Aligned_cols=223  Identities=52%  Similarity=0.899  Sum_probs=215.2

Q ss_pred             HHHHHHHHHCCCCCCCHHHHHHCCCHHHHHHHHH-CCHHHHHHHHHHCCCCCCCCCCCHHHHHHHHCCCCCCCCCEEEEE
Q ss_conf             0343675517876779899997799899999982-698999999998397768757112455687423565688619998
Q gi|254780858|r    4 DQDRIFTNLYGLQGKSLSDSMSRGHWDNVDKILE-KGRDWIINEVKASGLRGRGGAGFSTGMKWSFMPKVCSDRPHYLVV   82 (425)
Q Consensus         4 ~~~r~~~~~~~~~~~~l~~y~~~ggy~~l~~~l~-~~~~~ii~~v~~sgl~GrGGAgFPt~~Kw~~~~~~~~~~~~yvv~   82 (425)
                      .+++++.+....++.+|++|.+.++|+.+.+.+. +++++++++|++||||||||||||||+||+++++.. ..++||||
T Consensus        13 i~~~~~~~~~~~~~i~I~~~~~~~~~~~~~~~~~~~~~~~i~~~v~~aGlvG~GGAgFPt~~K~~~~~~~~-~~~~~liv   91 (237)
T 3i9v_1           13 FERTLYAHVGKEGSWTLDYYLRHGGYETAKRVLKEKTPDEVIEEVKRSGLRGRGGAGFPTGLKWSFMPKDD-GKQHYLIC   91 (237)
T ss_dssp             CCCCSTTSTTSTTTTSHHHHHHTTCTHHHHHHHHSSCHHHHHHHHHTTTCBCTTTTCCBHHHHHTTSCSSC-SCCCEEEE
T ss_pred             HHHHHHHCCCCCCCCCHHHHHHCCCHHHHHHHHHHCCHHHHHHHHHHHCCCCCCCCCCCHHHHHHHCCCCC-CCCEEEEE
T ss_conf             64698851799998889999977999999999870899999999998098747666162446677453567-99628997


Q ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHHHHCCCCCCC-CCCCCCCEE
Q ss_conf             5767784860048999862589999999999971836389981555178999999999999868997767-678866406
Q gi|254780858|r   83 NADESEPGTCKDRDIMRHEPHTLIEGCVIASFAIGAHCAFIYVRGEFIRERESLQAAVDECYASGLLGSN-SKLGYDVDI  161 (425)
Q Consensus        83 N~~E~EPgt~kDr~Ll~~~p~~vieG~~i~a~a~gA~~~~I~ir~ey~~~~~~l~~ai~ea~~~g~lg~~-~~~g~~~~i  161 (425)
                      ||+||||++|+||+||+++||+||||+.|+++++||++++|||+++|++++++|++||+|++.++++|.| .+++++++|
T Consensus        92 N~~EcEP~l~~D~~ll~~~p~~ii~G~~i~~~a~gA~~~~I~i~~~~~~ai~~l~~ai~e~~~~~~~g~~~~~~~~~~~i  171 (237)
T 3i9v_1           92 NADESEPGSFKDRYILEDVPHLLIEGMILAGYAIRATVGYIYVRGEYRRAADRLEQAIKEARARGYLGKNLFGTDFSFDL  171 (237)
T ss_dssp             ECCCCSTTCCSHHHHHHHCHHHHHHHHHHHHHHHTCCEEEEEECTTCHHHHHHHHHHHHHHHHTTSSBTTGGGSSCCBEE
T ss_pred             ECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHCCCEEEEEECCCHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCEE
T ss_conf             26779732047899999869999999999998745554899964430667999999999998748866544588877238


Q ss_pred             EEEECCCCCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHCHHH
Q ss_conf             997457510011078899863089998688899862278303785000289999999999605688
Q gi|254780858|r  162 IVHHGAGAYICGEETALLESLEGKKGQPRLKPPFPANVGLYGCPTTVNNVESIAVVPTILRRGASW  227 (425)
Q Consensus       162 ~v~~g~g~Yi~GeEtali~sieG~r~~Pr~kPP~p~~~Gl~g~PT~V~NVeTla~v~~i~~~G~~~  227 (425)
                      +|+.++++||||||++||++++|++..||.|||+|+++|+|+.||+|||+||+++++.++++|++|
T Consensus       172 ~V~~~~~~Yp~GeE~~Li~~l~G~~~~p~~~~p~~~~~gv~n~~T~v~n~etl~~~~~~i~~G~~w  237 (237)
T 3i9v_1          172 HVHRGAGAYICGEETALMNSLEGLRANPRLKPPFPAQSGLWGKPTTINNVETLASVVPIMERGADW  237 (237)
T ss_dssp             EEEECCSCGGGGSHHHHHHHHTTSCCCCCCCSSCTTTSCGGGSCEEEEEHHHHHTHHHHHHSCHHH
T ss_pred             EEEECCCCCCCCCHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCEEEEHHHHHHHHHHHHCCCHH
T ss_conf             998568632015125789987187366688778873314346764022199999888998519436



>3i9v_1 (1:335-438) NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* Back     alignment and structure
>3i9v_1 (1:238-334) NADH-quinone oxidoreductase subunit 1; electron transport, respiratory chain, 4Fe- 4S, cell membrane, flavoprotein, FMN, iron; HET: FMN; 3.10A {Thermus thermophilus HB8} PDB: 2fug_1* 3iam_1* 3ias_1* Back     alignment and structure
>2j58_A (A:47-53,A:151-232) WZA, outer membrane lipoprotein WZA; membrane protein; 2.26A {Escherichia coli} PDB: 2w8i_A 2w8h_A* Back     alignment and structure