254780859

254780859

NADH dehydrogenase subunit G

GeneID in NCBI database:8209874Locus tag:CLIBASIA_03770
Protein GI in NCBI database:254780859Protein Accession:YP_003065272.1
Gene range:+(827567, 829669)Protein Length:700aa
Gene description:NADH dehydrogenase subunit G
COG prediction:none
KEGG prediction:nuoG; NADH dehydrogenase subunit G (EC:1.6.99.5); K00336 NADH dehydrogenase I subunit G [EC:1.6.5.3]
SEED prediction:NADH-ubiquinone oxidoreductase chain G (EC 1.6.5.3)
Pathway involved in KEGG:Oxidative phosphorylation [PATH:las00190]
Subsystem involved in SEED:Respiratory Complex I
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
cccEEEEEEccEEEEEcccccHHHHHHHcccccccccccccccccccccEEEEEEccccccEEEEcccccccccccccccccEEEEccHHHHHHHHHHHHHHHHccccccccccccccccHHHHHHHHcccccccccccccccccccccEEEEcHHHcccccHHHHHHHHHccccccEEcccccccEEEcccccccccccccHHHHHHcccccccccccccccccccEEEEcccccccccccEEEEEEccEEEEEEcccccccccccccHHHHHHHHHcccccccccEEcccccEEEccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHccccEEccccHHHHHHHHHHccccccccHHHHHcccEEEEEcccHHHHHHHHHHHHHHHHHcccEEEEEcccccccccHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEEcHHHHcccHHHHHHHHHHHHHHHcccccccccEEEccccccccccccccccccccHHHHHHHHccccccccccccccccccccccEEEEcccccHHHHcccEEEccccccccccEEEEccccEEEEEcccccccccccHHHHHHHHHHHcccccccccHHHHHHHHHHHccccccccccccccccHHHHccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccc
ccccEEEEEcccEEEccccHHHHHHHHHHccccccccccHHHcccccccEEEEEEcccccccccHcccccccccccccccccEEccccHHHHHHHHcHHHHHHHcccccccccccccccccHHHHHHHccccccccccccccccccccccHcccccccEHcHHHHHHHHHHccccHcccccccccccHcHHHHHccccccccccccccccccccccccEEEcccHHccccccccccccccccEEEEccccEEEEEEccccccHcHHHHHccccccHcccccccccccEEEccccEEEccHHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHccccccEccccccccccccccccccccccccHHHccEEEEEccccHHHHHHHHHHHHHHHHccccEEEEEcccccccEcHHHccccHHHHHHHHccccHHHHHHHHccccEEEEEccHHccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHccccccccccccccHHHHHHcccccEEEEcccccccccccccEEEEEcccccccccEccEEEccccccccccEEEccccccEEEEEccccccccHHHHHHHHHHHHHHccccccccHHHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccHHHcccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHc
MQMMVKLKVDGieievpsgfTILQACELagaeiprfcfherlSIAGNCRMCLVEIkgiaskpqascamnvsdlragpngelpevftkssMVKKARAGVMEFLLInhpldcpicdqggecdlqdqaiffgfgssryseekravedksigpLVKTVMNRCIHCTRCVRFITEVAgvselglvgrgenAEITTYLEQSLTSemqgniidlcpvgaltskpfaftgrsweltktdSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDglkvqrldcpyaringrlkpvSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSlgcenfdcrqngeyldpsygrasyifnptiqgiEEADAMLIIGSNPRLEAAVLNARIRKRwrrgnfpiavigdvGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVgqgalrasdNVEVMANIAKLVIDvggisdswNGFAVLHTVASRVgaldlgfvpaddtinamnildKTDIVFLLgadeldfsdkQALTVYIgshgdrgaqsadvilpgaayteksglwvntegrvqmgmraifppgdakeDWEIICALADElkcslpfsslsqlrshlyshhphfmqldeirpsaTDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSsryseekravedksigplvktVMNRCIHCTRCVRFITEVAGvselglvgrgenAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTgrsweltktdSIDVMDALGSAIRIDARGCEVMRILPRinesineewisdktrfiwDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARirkrwrrgnfpiavigdVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
**MMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDG*************RNFVSTVENFYLANSIARASATMA*********************
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRY********DKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
**MMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG
MQMMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKPQASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQDQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGRGENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSAIRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDYALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRASYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYEHLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGISDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALTVYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICALADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTVENFYLANSIARASATMAQCSLVAQSCEKRIFDSAKELG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target700 NADH dehydrogenase subunit G [Candidatus Liberibacter a
315122719699 NADH dehydrogenase subunit G [Candidatus Liberibacter s 1 0.0
190891293693 NADH-ubiquinone oxidoreductase, chain G [Rhizobium etli 1 0.0
86357245693 NADH dehydrogenase subunit G [Rhizobium etli CFN 42] Le 1 0.0
327188494693 NADH-ubiquinone oxidoreductase protein, chain G [Rhizob 1 0.0
116251473693 NADH dehydrogenase subunit G [Rhizobium leguminosarum b 1 0.0
209548870693 NADH dehydrogenase subunit G [Rhizobium leguminosarum b 1 0.0
241204094693 NADH dehydrogenase subunit G [Rhizobium leguminosarum b 1 0.0
222085583693 NADH-quinone oxidoreductase, chain G [Agrobacterium rad 1 0.0
15965025693 NADH dehydrogenase subunit G [Sinorhizobium meliloti 10 1 0.0
307317831693 NADH-quinone oxidoreductase, chain G [Sinorhizobium mel 1 0.0
>gi|315122719|ref|YP_004063208.1| NADH dehydrogenase subunit G [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 699 Back     alignment and organism information
 Score = 1233 bits (3191), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/690 (84%), Positives = 637/690 (92%)

Query: 3   MMVKLKVDGIEIEVPSGFTILQACELAGAEIPRFCFHERLSIAGNCRMCLVEIKGIASKP 62
           MMVKLKVDGIEIEVPS FT+LQACE AG E+PRFC+HERLSIAGNCRMCLVEIKGIASKP
Sbjct: 1   MMVKLKVDGIEIEVPSDFTLLQACEFAGVEVPRFCYHERLSIAGNCRMCLVEIKGIASKP 60

Query: 63  QASCAMNVSDLRAGPNGELPEVFTKSSMVKKARAGVMEFLLINHPLDCPICDQGGECDLQ 122
           QASCAMNV DLRAG NGELPE+FT +SMV+KAR GVMEFLLINHPLDCPICDQGGECDLQ
Sbjct: 61  QASCAMNVFDLRAGSNGELPEIFTTTSMVRKAREGVMEFLLINHPLDCPICDQGGECDLQ 120

Query: 123 DQAIFFGFGSSRYSEEKRAVEDKSIGPLVKTVMNRCIHCTRCVRFITEVAGVSELGLVGR 182
           DQA+FFGFGSSRY + KR+VEDKSIGPLVKTVM RCIHCTRCVRFITEVAGV +LGL+GR
Sbjct: 121 DQAMFFGFGSSRYCDNKRSVEDKSIGPLVKTVMTRCIHCTRCVRFITEVAGVPDLGLIGR 180

Query: 183 GENAEITTYLEQSLTSEMQGNIIDLCPVGALTSKPFAFTGRSWELTKTDSIDVMDALGSA 242
           GE+AEITTYLEQSLTSE+QGNIIDLCPVGALTSKPFAFT RSWELTKTDSIDVMDALGSA
Sbjct: 181 GEDAEITTYLEQSLTSEIQGNIIDLCPVGALTSKPFAFTVRSWELTKTDSIDVMDALGSA 240

Query: 243 IRIDARGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDCPYARINGRLKPVSWDY 302
           IRID RGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLD PY R++GRL+PV WDY
Sbjct: 241 IRIDTRGCEVMRILPRINESINEEWISDKTRFIWDGLKVQRLDRPYVRVDGRLRPVDWDY 300

Query: 303 ALKAIKSAVLSSDVKLGAVVGDLSSVEEIYALKLLMQSLGCENFDCRQNGEYLDPSYGRA 362
           ALK IK+AV  S VKLGA+ GDL+SVEEIYALKL+MQSLGC NFDCRQ+GE LDPSYGR+
Sbjct: 301 ALKVIKTAVSPSGVKLGAIAGDLASVEEIYALKLMMQSLGCNNFDCRQDGESLDPSYGRS 360

Query: 363 SYIFNPTIQGIEEADAMLIIGSNPRLEAAVLNARIRKRWRRGNFPIAVIGDVGELRYKYE 422
           SYIFNPTIQGI+EA+AMLIIGSNPR EAA+LNARIRKRWR GNFPIAVIGDVGELRY Y+
Sbjct: 361 SYIFNPTIQGIDEAEAMLIIGSNPRFEAAILNARIRKRWRLGNFPIAVIGDVGELRYNYQ 420

Query: 423 HLGNGSEALADLVSGQHPFFKKLQEATRPLIIVGQGALRASDNVEVMANIAKLVIDVGGI 482
           HLG GSE+LA+LVSG+ PFFK LQ   +PLI+VGQGAL+  + VEV+AN AKL IDVG +
Sbjct: 421 HLGVGSESLANLVSGKDPFFKTLQGVEKPLIMVGQGALKGFNKVEVLANAAKLAIDVGAV 480

Query: 483 SDSWNGFAVLHTVASRVGALDLGFVPADDTINAMNILDKTDIVFLLGADELDFSDKQALT 542
           SDSWNGFAVLHT +SRVGALDLGFVPADD +NAMN+L KTD+VFLLGADELDFS K+A T
Sbjct: 481 SDSWNGFAVLHTASSRVGALDLGFVPADDNLNAMNLLHKTDVVFLLGADELDFSRKKAFT 540

Query: 543 VYIGSHGDRGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRAIFPPGDAKEDWEIICAL 602
           VYIGSHGD+GAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRA FPPG+++EDWEIICAL
Sbjct: 541 VYIGSHGDKGAQSADVILPGAAYTEKSGLWVNTEGRVQMGMRANFPPGESREDWEIICAL 600

Query: 603 ADELKCSLPFSSLSQLRSHLYSHHPHFMQLDEIRPSATDGIYALAKKVGKMQKRNFVSTV 662
           AD+L C LPF+SL QLRSHLYSH+PHFM+LDEI PS+T+GIY+LAKK G+MQKR FVSTV
Sbjct: 601 ADKLGCILPFNSLLQLRSHLYSHYPHFMRLDEIVPSSTEGIYSLAKKAGEMQKREFVSTV 660

Query: 663 ENFYLANSIARASATMAQCSLVAQSCEKRI 692
            NFYLAN+IARASATMAQCSLVAQ+C K +
Sbjct: 661 NNFYLANAIARASATMAQCSLVAQNCGKSV 690


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|190891293|ref|YP_001977835.1| NADH-ubiquinone oxidoreductase, chain G [Rhizobium etli CIAT 652] Length = 693 Back     alignment and organism information
>gi|86357245|ref|YP_469137.1| NADH dehydrogenase subunit G [Rhizobium etli CFN 42] Length = 693 Back     alignment and organism information
>gi|327188494|gb|EGE55708.1| NADH-ubiquinone oxidoreductase protein, chain G [Rhizobium etli CNPAF512] Length = 693 Back     alignment and organism information
>gi|116251473|ref|YP_767311.1| NADH dehydrogenase subunit G [Rhizobium leguminosarum bv. viciae 3841] Length = 693 Back     alignment and organism information
>gi|209548870|ref|YP_002280787.1| NADH dehydrogenase subunit G [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 693 Back     alignment and organism information
>gi|241204094|ref|YP_002975190.1| NADH dehydrogenase subunit G [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 693 Back     alignment and organism information
>gi|222085583|ref|YP_002544113.1| NADH-quinone oxidoreductase, chain G [Agrobacterium radiobacter K84] Length = 693 Back     alignment and organism information
>gi|15965025|ref|NP_385378.1| NADH dehydrogenase subunit G [Sinorhizobium meliloti 1021] Length = 693 Back     alignment and organism information
>gi|307317831|ref|ZP_07597269.1| NADH-quinone oxidoreductase, chain G [Sinorhizobium meliloti AK83] Length = 693 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target700 NADH dehydrogenase subunit G [Candidatus Liberibacter a
COG1034693 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxido 0.0
PRK09130687 PRK09130, PRK09130, NADH dehydrogenase subunit G; Valid 0.0
KOG2282708 KOG2282, KOG2282, KOG2282, NADH-ubiquinone oxidoreducta 0.0
TIGR01973603 TIGR01973, NuoG, NADH-quinone oxidoreductase, chain G 0.0
PRK09129776 PRK09129, PRK09129, NADH dehydrogenase subunit G; Valid 1e-157
cd02773375 cd02773, MopB_Res-Cmplx1_Nad11, MopB_Res_Cmplx1_Nad11: 1e-146
cd02768386 cd02768, MopB_NADH-Q-OR-NuoG2, MopB_NADH-Q-OR-NuoG2: Th 1e-105
cd02774366 cd02774, MopB_Res-Cmplx1_Nad11-M, MopB_Res_Cmplx1_Nad11 2e-66
cd00368374 cd00368, Molybdopterin-Binding, Molybdopterin-Binding ( 3e-49
cd02772414 cd02772, MopB_NDH-1_NuoG2, MopB_NDH-1_NuoG2: The second 4e-41
cd02771472 cd02771, MopB_NDH-1_NuoG2-N7, MopB_NDH-1_NuoG2-N7: The 2e-35
TIGR01591671 TIGR01591, Fdh-alpha, formate dehydrogenase, alpha subu 2e-16
pfam00384358 pfam00384, Molybdopterin, Molybdopterin oxidoreductase 6e-86
PRK07860797 PRK07860, PRK07860, NADH dehydrogenase subunit G; Valid 2e-77
COG3383 978 COG3383, COG3383, Uncharacterized anaerobic dehydrogena 1e-53
PRK08493 819 PRK08493, PRK08493, NADH dehydrogenase subunit G; Valid 2e-34
PRK08166847 PRK08166, PRK08166, NADH dehydrogenase subunit G; Valid 8e-68
PTZ00305297 PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase; Pro 1e-44
PRK07569234 PRK07569, PRK07569, bidirectional hydrogenase complex p 8e-29
cd02753512 cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Fo 1e-14
COG3383 978 COG3383, COG3383, Uncharacterized anaerobic dehydrogena 3e-13
cd02754565 cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, 6e-11
COG0243 765 COG0243, BisC, Anaerobic dehydrogenases, typically sele 5e-07
PRK07860797 PRK07860, PRK07860, NADH dehydrogenase subunit G; Valid 5e-06
PRK13532 830 PRK13532, PRK13532, nitrate reductase catalytic subunit 1e-05
TIGR01706 830 TIGR01706, NAPA, periplasmic nitrate reductase, large s 3e-05
TIGR02693 806 TIGR02693, arsenite_ox_L, arsenite oxidase, large subun 9e-04
cd02759477 cd02759, MopB_Acetylene-hydratase, The MopB_Acetylene-h 0.002
pfam1058841 pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreduct 6e-14
PRK12814652 PRK12814, PRK12814, putative NADPH-dependent glutamate 2e-11
cd0020784 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domai 8e-05
cd02753512 cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Fo 5e-10
cd02750461 cd02750, MopB_Nitrate-R-NarG-like, Respiratory nitrate 6e-09
pfam0932648 pfam09326, DUF1982, Domain of unknown function (DUF1982 1e-08
TIGR03479 912 TIGR03479, DMSO_red_II_alp, DMSO reductase family type 2e-08
cd02752 649 cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase 1e-04
TIGR02512374 TIGR02512, Fe_only_hydrog, hydrogenases, Fe-only 2e-06
cd02754565 cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, 4e-04
COG0243 765 COG0243, BisC, Anaerobic dehydrogenases, typically sele 0.001
cd02752 649 cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase 0.002
cd02766501 cd02766, MopB_3, The MopB_3 CD includes a group of rela 0.003
>gnl|CDD|31237 COG1034, NuoG, NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181665 PRK09130, PRK09130, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|37493 KOG2282, KOG2282, KOG2282, NADH-ubiquinone oxidoreductase, NDUFS1/75 kDa subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|162633 TIGR01973, NuoG, NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>gnl|CDD|181664 PRK09129, PRK09129, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|29469 cd02773, MopB_Res-Cmplx1_Nad11, MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1 Back     alignment and domain information
>gnl|CDD|29464 cd02768, MopB_NADH-Q-OR-NuoG2, MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) Back     alignment and domain information
>gnl|CDD|29470 cd02774, MopB_Res-Cmplx1_Nad11-M, MopB_Res_Cmplx1_Nad11_M: Mitochondrial-encoded NADH-quinone oxidoreductase/respiratory complex I, the second domain of the Nad11/75-kDa subunit of some protists Back     alignment and domain information
>gnl|CDD|73198 cd00368, Molybdopterin-Binding, Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor Back     alignment and domain information
>gnl|CDD|29468 cd02772, MopB_NDH-1_NuoG2, MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria Back     alignment and domain information
>gnl|CDD|29467 cd02771, MopB_NDH-1_NuoG2-N7, MopB_NDH-1_NuoG2-N7: The second domain of the NuoG subunit (with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria Back     alignment and domain information
>gnl|CDD|130652 TIGR01591, Fdh-alpha, formate dehydrogenase, alpha subunit, archaeal-type Back     alignment and domain information
>gnl|CDD|144102 pfam00384, Molybdopterin, Molybdopterin oxidoreductase Back     alignment and domain information
>gnl|CDD|181150 PRK07860, PRK07860, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|33190 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181450 PRK08493, PRK08493, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|181263 PRK08166, PRK08166, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|140326 PTZ00305, PTZ00305, NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|181037 PRK07569, PRK07569, bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>gnl|CDD|73321 cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>gnl|CDD|33190 COG3383, COG3383, Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>gnl|CDD|29450 cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite Back     alignment and domain information
>gnl|CDD|30592 COG0243, BisC, Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|181150 PRK07860, PRK07860, NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>gnl|CDD|184119 PRK13532, PRK13532, nitrate reductase catalytic subunit; Provisional Back     alignment and domain information
>gnl|CDD|130767 TIGR01706, NAPA, periplasmic nitrate reductase, large subunit Back     alignment and domain information
>gnl|CDD|131740 TIGR02693, arsenite_ox_L, arsenite oxidase, large subunit Back     alignment and domain information
>gnl|CDD|73326 cd02759, MopB_Acetylene-hydratase, The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins Back     alignment and domain information
>gnl|CDD|151118 pfam10588, NADH-G_4Fe-4S_3, NADH-ubiquinone oxidoreductase-G iron-sulfur binding region Back     alignment and domain information
>gnl|CDD|139246 PRK12814, PRK12814, putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>gnl|CDD|29262 cd00207, fer2, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|73321 cd02753, MopB_Formate-Dh-H, Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>gnl|CDD|73319 cd02750, MopB_Nitrate-R-NarG-like, Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins Back     alignment and domain information
>gnl|CDD|150105 pfam09326, DUF1982, Domain of unknown function (DUF1982) Back     alignment and domain information
>gnl|CDD|132519 TIGR03479, DMSO_red_II_alp, DMSO reductase family type II enzyme, molybdopterin subunit Back     alignment and domain information
>gnl|CDD|73320 cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E Back     alignment and domain information
>gnl|CDD|162896 TIGR02512, Fe_only_hydrog, hydrogenases, Fe-only Back     alignment and domain information
>gnl|CDD|29450 cd02754, MopB_Nitrate-R-NapA-like, Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite Back     alignment and domain information
>gnl|CDD|30592 COG0243, BisC, Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|73320 cd02752, MopB_Formate-Dh-Na-like, Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E Back     alignment and domain information
>gnl|CDD|73330 cd02766, MopB_3, The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 700 NADH dehydrogenase subunit G [Candidatus Liberibacter a
PRK09130680 NADH dehydrogenase subunit G; Validated 100.0
PRK09129777 NADH dehydrogenase subunit G; Validated 100.0
PRK07860809 NADH dehydrogenase subunit G; Validated 100.0
KOG2282708 consensus 100.0
COG1034693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 100.0
TIGR01973715 NuoG NADH-quinone oxidoreductase, chain G; InterPro: IP 100.0
PRK08166 858 NADH dehydrogenase subunit G; Validated 100.0
COG3383 978 Uncharacterized anaerobic dehydrogenase [General functi 100.0
PRK08493819 NADH dehydrogenase subunit G; Validated 100.0
TIGR01591694 Fdh-alpha formate dehydrogenase, alpha subunit; InterPr 100.0
cd02773375 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The second 100.0
cd02774366 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: Mitoch 100.0
cd02772414 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second domain of 100.0
cd02752649 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha 100.0
cd02768386 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad 100.0
PRK13532 828 nitrate reductase; Provisional 100.0
cd02755454 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-like CD 100.0
cd02750461 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase 100.0
cd02762539 MopB_1 The MopB_1 CD includes a group of related unchar 100.0
cd02759477 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase C 100.0
cd02756676 MopB_Arsenite-Ox Arsenite oxidase (Arsenite-Ox) oxidize 100.0
cd02770617 MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the DmsA e 100.0
cd02757523 MopB_Arsenate-R This CD includes the respiratory arsena 100.0
TIGR03129421 one_C_dehyd_B formylmethanofuran dehydrogenase subunit 100.0
cd00368374 Molybdopterin-Binding Molybdopterin-Binding (MopB) doma 100.0
cd02761415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molyb 100.0
COG0243 765 BisC Anaerobic dehydrogenases, typically selenocysteine 100.0
cd02751609 MopB_DMSOR-like The MopB_DMSOR-like CD contains dimethy 100.0
cd02769609 MopB_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD cont 100.0
TIGR03479 912 DMSO_red_II_alp DMSO reductase family type II enzyme, m 100.0
cd02763679 MopB_2 The MopB_2 CD includes a group of related unchar 100.0
cd02760760 MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA-OR C 100.0
cd02758735 MopB_Tetrathionate-Ra The MopB_Tetrathionate-Ra CD cont 100.0
TIGR01706 930 NAPA periplasmic nitrate reductase, large subunit; Inte 100.0
cd02764524 MopB_PHLH The MopB_PHLH CD includes a group of related 100.0
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [Energy 100.0
TIGR02164 847 torA trimethylamine-N-oxide reductase TorA; InterPro: I 99.97
TIGR00509 802 bisC_fam molybdopterin guanine dinucleotide-containing 99.93
COG5013 1227 NarG Nitrate reductase alpha subunit [Energy production 99.92
TIGR01580 1248 narG nitrate reductase, alpha subunit; InterPro: IPR006 99.9
cd02753512 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H 100.0
cd02771472 MopB_NDH-1_NuoG2-N7 MopB_NDH-1_NuoG2-N7: The second dom 100.0
cd02754565 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitr 100.0
cd02766501 MopB_3 The MopB_3 CD includes a group of related unchar 100.0
cd02765567 MopB_4 The MopB_4 CD includes a group of related unchar 100.0
TIGR02166 849 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A sub 100.0
TIGR02693 858 arsenite_ox_L arsenite oxidase, large subunit; InterPro 100.0
PRK07569236 bidirectional hydrogenase complex protein HoxU; Validat 100.0
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 100.0
PRK12385243 fumarate reductase iron-sulfur subunit; Provisional 98.54
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S p 98.52
PRK12386250 fumarate reductase iron-sulfur subunit; Provisional 98.26
PRK13552240 frdB fumarate reductase iron-sulfur subunit; Provisiona 98.19
PRK08640252 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 98.15
PRK05950235 sdhB succinate dehydrogenase iron-sulfur subunit; Revie 98.12
PRK12576311 succinate dehydrogenase iron-sulfur subunit; Provisiona 97.96
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provisiona 97.87
TIGR00384236 dhsB succinate dehydrogenase and fumarate reductase iro 90.07
TIGR01553 1043 formate-DH-alph formate dehydrogenase, alpha subunit; I 100.0
pfam00384358 Molybdopterin Molybdopterin oxidoreductase. 100.0
PRK09939759 putative oxidoreductase; Provisional 100.0
cd02767574 MopB_ydeP The MopB_ydeP CD includes a group of related 100.0
TIGR01701 824 Fdhalpha-like oxidoreductase alpha (molybdopterin) subu 100.0
PRK12814652 putative NADPH-dependent glutamate synthase small subun 99.96
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, small 97.86
CHL0013499 petF ferredoxin; Validated 97.75
PTZ00038172 ferredoxin; Provisional 97.72
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma sub 97.66
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene has be 97.6
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.52
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylas 97.07
COG3894614 Uncharacterized metal-binding protein [General function 96.72
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybdenum-b 95.83
PRK12814652 putative NADPH-dependent glutamate synthase small subun 99.45
TIGR02512380 Fe_only_hydrog hydrogenases, Fe-only; InterPro: IPR0133 98.52
PRK09477287 napH quinol dehydrogenase membrane component; Provision 98.08
PRK07570247 succinate dehydrogenase/fumarate reductase iron-sulfur 97.8
CHL0006581 psaC photosystem I subunit VII 97.79
PRK09476254 napG quinol dehydrogenase periplasmic component; Provis 97.72
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit delta; R 97.65
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase subuni 97.57
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. Membe 97.55
PRK09898208 hypothetical protein; Provisional 97.5
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 97.47
COG1149284 MinD superfamily P-loop ATPase containing an inserted f 97.45
PRK0265181 photosystem I subunit VII; Provisional 97.44
TIGR02163263 napH_ ferredoxin-type protein, NapH/MauN family; InterP 97.37
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 97.03
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subunit Oor 96.72
COG114599 NapF Ferredoxin [Energy production and conversion] 96.65
COG1148622 HdrA Heterodisulfide reductase, subunit A and related p 96.37
PRK05035 725 electron transport complex protein RnfC; Provisional 96.34
PRK11168400 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; P 96.33
PRK07118276 ferredoxin; Validated 96.24
TIGR03379397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, ana 96.22
COG114668 Ferredoxin [Energy production and conversion] 96.2
PRK10330181 electron transport protein HydN; Provisional 96.18
TIGR03224411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protei 96.11
COG2768354 Uncharacterized Fe-S center protein [General function p 96.07
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subuni 95.84
PRK10194164 ferredoxin-type protein; Provisional 95.81
PRK10882329 hydrogenase 2 protein HybA; Provisional 95.76
PRK09625130 porD pyruvate flavodoxin oxidoreductase subunit delta; 95.36
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 95.24
PRK11274407 glcF glycolate oxidase iron-sulfur subunit; Provisional 95.19
COG0247388 GlpC Fe-S oxidoreductase [Energy production and convers 94.66
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 94.63
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 94.57
COG4624411 Iron only hydrogenase large subunit, C-terminal domain 94.34
TIGR00276297 TIGR00276 iron-sulfur cluster binding protein, putative 93.08
TIGR0293696 fdxN_nitrog ferredoxin III, nif-specific; InterPro: IPR 93.03
PRK09326346 F420H2 dehydrogenase subunit F; Provisional 92.21
pfam0690264 DUF1271 Protein of unknown function (DUF1271). This fam 91.64
TIGR02700237 flavo_MJ0208 archaeoflavoprotein, MJ0208 family; InterP 91.28
pfam1058841 NADH-G_4Fe-4S_3 NADH-ubiquinone oxidoreductase-G iron-s 99.43
pfam0487955 Molybdop_Fe4S4 Molybdopterin oxidoreductase Fe4S4 domai 99.37
COG3862117 Uncharacterized protein with conserved CXXC pairs [Func 93.71
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 metall 90.68
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 98.85
CHL00014173 ndhI NADH dehydrogenase subunit I 98.78
PRK08222181 hydrogenase 4 subunit H; Validated 98.72
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 98.66
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone ox 98.56
PRK05888172 NADH dehydrogenase subunit I; Provisional 98.45
TIGR02494305 PFLE_PFLC glycyl-radical enzyme activating protein fami 98.2
PRK05113184 electron transport complex protein RnfB; Provisional 98.1
TIGR01971129 NuoI NADH-quinone oxidoreductase, chain I; InterPro: IP 98.07
KOG3256212 consensus 98.03
PRK13984604 putative oxidoreductase; Provisional 97.86
PRK06991274 ferredoxin; Provisional 97.67
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB 97.38
TIGR00403187 ndhI NADH-plastoquinone oxidoreductase, I subunit; Inte 97.35
PRK08764138 ferredoxin; Provisional 97.03
PRK07118276 ferredoxin; Validated 96.85
TIGR01944213 rnfB electron transport complex, RnfABCDGE type, B subu 96.09
TIGR01591694 Fdh-alpha formate dehydrogenase, alpha subunit; InterPr 91.28
PRK06259491 succinate dehydrogenase/fumarate reductase iron-sulfur 98.68
pfam0932648 DUF1982 Domain of unknown function (DUF1982). Members o 98.45
PRK12577330 succinate dehydrogenase iron-sulfur subunit; Provisiona 98.18
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Iron-su 98.1
PRK05713312 hypothetical protein; Provisional 97.99
PRK05464408 Na(+)-translocating NADH-quinone reductase subunit F; P 97.79
PRK07609337 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated 97.72
pfam0011178 Fer2 2Fe-2S iron-sulfur cluster binding domain. Several 97.67
PRK11872340 antC anthranilate dioxygenase reductase; Provisional 97.49
TIGR01941425 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocatin 97.49
COG2871410 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, s 97.22
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 96.88
COG0633102 Fdx Ferredoxin [Energy production and conversion] 96.68
COG210468 ThiS Sulfur transfer protein involved in thiamine biosy 92.0
PRK0744070 hypothetical protein; Provisional 91.96
TIGR021761194 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoredu 97.79
PRK10194164 ferredoxin-type protein; Provisional 97.68
PRK09898208 hypothetical protein; Provisional 97.58
TIGR02912323 sulfite_red_C sulfite reductase, subunit C; InterPro: I 97.47
PRK10330181 electron transport protein HydN; Provisional 97.19
COG0437203 HybA Fe-S-cluster-containing hydrogenase components 1 [ 97.06
TIGR00402161 napF ferredoxin-type protein NapF; InterPro: IPR004496 96.65
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 96.57
COG1142165 HycB Fe-S-cluster-containing hydrogenase components 2 [ 95.86
PRK12769654 putative oxidoreductase Fe-S binding subunit; Reviewed 95.68
PRK12809639 putative oxidoreductase Fe-S binding subunit; Reviewed 95.6
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein; Int 95.45
PRK10882329 hydrogenase 2 protein HybA; Provisional 97.66
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 97.44
PRK09326346 F420H2 dehydrogenase subunit F; Provisional 93.29
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. Memb 90.72
PRK11433217 putative xanthine dehydrogenase iron-sulfur-binding sub 96.95
COG1139459 Uncharacterized conserved protein containing a ferredox 96.92
COG2221317 DsrA Dissimilatory sulfite reductase (desulfoviridin), 95.46
PRK13795630 hypothetical protein; Provisional 94.64
TIGR00273450 TIGR00273 iron-sulfur cluster binding protein; InterPro 96.58
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S prote 95.23
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzyme, i 92.52
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alp 96.12
TIGR02418553 acolac_catab acetolactate synthase, catabolic; InterPro 94.51
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha and bet 92.48
pfam00205138 TPP_enzyme_M Thiamine pyrophosphate enzyme, central dom 91.87
PRK08617552 acetolactate synthase; Reviewed 91.26
PRK06154556 hypothetical protein; Provisional 90.53
PRK08322547 acetolactate synthase; Reviewed 90.3
TIGR02745474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 95.82
TIGR02486338 RDH reductive dehalogenase; InterPro: IPR012832 This en 94.19
PRK12771560 putative glutamate synthase (NADPH) small subunit; Prov 92.15
COG1029429 FwdB Formylmethanofuran dehydrogenase subunit B [Energy 95.18
TIGR03129421 one_C_dehyd_B formylmethanofuran dehydrogenase subunit 94.4
cd02761415 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molyb 94.14
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit 92.49
COG1600337 Uncharacterized Fe-S protein [Energy production and con 91.21
TIGR01945444 rnfC electron transport complex, RnfABCDGE type, C subu 90.7
cd02765567 MopB_4 The MopB_4 CD includes a group of related unchar 90.02
PRK12387178 formate hydrogenlyase complex iron-sulfur subunit; Prov 92.51
PRK08348111 NADH-plastoquinone oxidoreductase subunit; Provisional 92.32
TIGR02745474 ccoG_rdxA_fixG cytochrome c oxidase accessory protein C 92.34
TIGR02160371 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK 92.24
TIGR02066366 dsrB sulfite reductase, dissimilatory-type beta subunit 91.88
PRK08611576 pyruvate oxidase; Provisional 91.66
TIGR01553 1043 formate-DH-alph formate dehydrogenase, alpha subunit; I 90.72
TIGR02720 577 pyruv_oxi_spxB pyruvate oxidase; InterPro: IPR014092 Me 90.24
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>KOG2282 consensus Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G; InterPro: IPR010228 This entry represents the G subunit (one of 14 subunits, A to N) of the NADH-quinone oxidoreductase complex I which generally couples NADH and ubiquinone oxidation/reduction in bacteria and mammalian mitochondria while translocating protons, but may act on NADPH and/or plastoquinone in cyanobacteria and plant chloroplasts Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01591 Fdh-alpha formate dehydrogenase, alpha subunit; InterPro: IPR006478 This group of sequences describe a subset of formate dehydrogenase alpha chains found mainly in the archaea but also in alpha and gamma proteobacteria and a small number of Gram-positive bacteria Back     alignment and domain information
>cd02773 MopB_Res-Cmplx1_Nad11 MopB_Res_Cmplx1_Nad11: The second domain of the Nad11/75-kDa subunit of the NADH-quinone oxidoreductase/respiratory complex I/NADH dehydrogenase-1(NDH-1) of eukaryotes and the Nqo3/G subunit of alphaproteobacteria NDH-1 Back     alignment and domain information
>cd02774 MopB_Res-Cmplx1_Nad11-M MopB_Res_Cmplx1_Nad11_M: Mitochondrial-encoded NADH-quinone oxidoreductase/respiratory complex I, the second domain of the Nad11/75-kDa subunit of some protists Back     alignment and domain information
>cd02772 MopB_NDH-1_NuoG2 MopB_NDH-1_NuoG2: The second domain of the NuoG subunit of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1), found in beta- and gammaproteobacteria Back     alignment and domain information
>cd02752 MopB_Formate-Dh-Na-like Formate dehydrogenase N, alpha subunit (Formate-Dh-Na) is a major component of nitrate respiration in bacteria such as in the E Back     alignment and domain information
>cd02768 MopB_NADH-Q-OR-NuoG2 MopB_NADH-Q-OR-NuoG2: The NuoG/Nad11/75-kDa subunit (second domain) of the NADH-quinone oxidoreductase (NADH-Q-OR)/respiratory complex I/NADH dehydrogenase-1 (NDH-1) Back     alignment and domain information
>PRK13532 nitrate reductase; Provisional Back     alignment and domain information
>cd02755 MopB_Thiosulfate-R-like The MopB_Thiosulfate-R-like CD contains thiosulfate-, sulfur-, and polysulfide-reductases, and other related proteins Back     alignment and domain information
>cd02750 MopB_Nitrate-R-NarG-like Respiratory nitrate reductase A (NarGHI), alpha chain (NarG) and related proteins Back     alignment and domain information
>cd02762 MopB_1 The MopB_1 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02759 MopB_Acetylene-hydratase The MopB_Acetylene-hydratase CD contains acetylene hydratase (Ahy) and other related proteins Back     alignment and domain information
>cd02756 MopB_Arsenite-Ox Arsenite oxidase (Arsenite-Ox) oxidizes arsenite to the less toxic arsenate; it transfers the electrons obtained from the oxidation of arsenite towards the soluble periplasmic electron carriers cytochrome c and/or amicyanin Back     alignment and domain information
>cd02770 MopB_DmsA-EC This CD (MopB_DmsA-EC) includes the DmsA enzyme of the dmsABC operon encoding the anaerobic dimethylsulfoxide reductase (DMSOR) of Escherichia coli and other related DMSOR-like enzymes Back     alignment and domain information
>cd02757 MopB_Arsenate-R This CD includes the respiratory arsenate reductase, As(V), catalytic subunit (ArrA) and other related proteins Back     alignment and domain information
>TIGR03129 one_C_dehyd_B formylmethanofuran dehydrogenase subunit B Back     alignment and domain information
>cd00368 Molybdopterin-Binding Molybdopterin-Binding (MopB) domain of the MopB superfamily of proteins, a large, diverse, heterogeneous superfamily of enzymes that, in general, bind molybdopterin as a cofactor Back     alignment and domain information
>cd02761 MopB_FmdB-FwdB The MopB_FmdB-FwdB CD contains the molybdenum/tungsten formylmethanofuran dehydrogenases, subunit B (FmdB/FwdB), and other related proteins Back     alignment and domain information
>COG0243 BisC Anaerobic dehydrogenases, typically selenocysteine-containing [Energy production and conversion] Back     alignment and domain information
>cd02751 MopB_DMSOR-like The MopB_DMSOR-like CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins Back     alignment and domain information
>cd02769 MopB_DMSOR-BSOR-TMAOR The MopB_DMSOR-BSOR-TMAOR CD contains dimethylsulfoxide reductase (DMSOR), biotin sulfoxide reductase (BSOR), trimethylamine N-oxide reductase (TMAOR) and other related proteins Back     alignment and domain information
>TIGR03479 DMSO_red_II_alp DMSO reductase family type II enzyme, molybdopterin subunit Back     alignment and domain information
>cd02763 MopB_2 The MopB_2 CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02760 MopB_Phenylacetyl-CoA-OR The MopB_Phenylacetyl-CoA-OR CD contains the phenylacetyl-CoA:acceptor oxidoreductase, large subunit (PadB2), and other related proteins Back     alignment and domain information
>cd02758 MopB_Tetrathionate-Ra The MopB_Tetrathionate-Ra CD contains tetrathionate reductase, subunit A, (TtrA) and other related proteins Back     alignment and domain information
>TIGR01706 NAPA periplasmic nitrate reductase, large subunit; InterPro: IPR010051 This entry represents the large subunit of a family of nitrate reductases found in proteobacteria which are localised to the periplasm Back     alignment and domain information
>cd02764 MopB_PHLH The MopB_PHLH CD includes a group of related uncharacterized putative hydrogenase-like homologs (PHLH) of molybdopterin binding (MopB) proteins Back     alignment and domain information
>COG1029 FwdB Formylmethanofuran dehydrogenase subunit B [Energy production and conversion] Back     alignment and domain information
>TIGR02164 torA trimethylamine-N-oxide reductase TorA; InterPro: IPR011887 Trimethylamine N-oxide (TMAO) is a major low molecular mass compound found in marine fishes and invertebrates where it is thought to act as an osmoprotectant Back     alignment and domain information
>TIGR00509 bisC_fam molybdopterin guanine dinucleotide-containing S/N-oxide reductases; InterPro: IPR006658 This enzyme family shares sequence similarity and a requirement for a molydenum cofactor as the only prosthetic group Back     alignment and domain information
>COG5013 NarG Nitrate reductase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01580 narG nitrate reductase, alpha subunit; InterPro: IPR006468 The nitrate reductase enzyme complex allows bacteria to use nitrate as an electron acceptor during anaerobic growth Back     alignment and domain information
>cd02753 MopB_Formate-Dh-H Formate dehydrogenase H (Formate-Dh-H) catalyzes the reversible oxidation of formate to CO2 with the release of a proton and two electrons Back     alignment and domain information
>cd02771 MopB_NDH-1_NuoG2-N7 MopB_NDH-1_NuoG2-N7: The second domain of the NuoG subunit (with a [4Fe-4S] cluster, N7) of the NADH-quinone oxidoreductase/NADH dehydrogenase-1 (NDH-1) found in various bacteria Back     alignment and domain information
>cd02754 MopB_Nitrate-R-NapA-like Nitrate reductases, NapA (Nitrate-R-NapA), NasA, and NarB catalyze the reduction of nitrate to nitrite Back     alignment and domain information
>cd02766 MopB_3 The MopB_3 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>cd02765 MopB_4 The MopB_4 CD includes a group of related uncharacterized bacterial and archaeal molybdopterin-binding oxidoreductase-like domains with a putative N-terminal iron-sulfur [4Fe-4S] cluster binding site and molybdopterin cofactor binding site Back     alignment and domain information
>TIGR02166 dmsA_ynfE anaerobic dimethyl sulfoxide reductase, A subunit, DmsA/YnfE family; InterPro: IPR011888 Many bacterial species are capable of anaerobic growth by using dimethylsulphoxide (DMSO) as the terminal electron acceptor, with DMSO reductase as the terminal elctron transfer enzyme Back     alignment and domain information
>TIGR02693 arsenite_ox_L arsenite oxidase, large subunit; InterPro: IPR014066 This entry represents the large subunit of an arsenite oxidase complex Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein; InterPro: IPR004489 Succinate dehydrogenase and fumarate reductase are reverse directions of the same enzymatic interconversion, succinate + FAD+ = fumarate + FADH2 (1 Back     alignment and domain information
>TIGR01553 formate-DH-alph formate dehydrogenase, alpha subunit; InterPro: IPR006443 This family of sequences describe a subset of formate dehydrogenase alpha chains found mainly in proteobacteria but also in Aquifex aeolicus Back     alignment and domain information
>pfam00384 Molybdopterin Molybdopterin oxidoreductase Back     alignment and domain information
>PRK09939 putative oxidoreductase; Provisional Back     alignment and domain information
>cd02767 MopB_ydeP The MopB_ydeP CD includes a group of related uncharacterized bacterial molybdopterin-binding oxidoreductase-like domains with a putative molybdopterin cofactor binding site Back     alignment and domain information
>TIGR01701 Fdhalpha-like oxidoreductase alpha (molybdopterin) subunit; InterPro: IPR010046 This entry represents a well-defined clade of molybdopterin-dependent formate dehydrogenases, bacterial type , , , Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information