254780869

254780869

beta-lactamase domain-containing protein

GeneID in NCBI database:8209884Locus tag:CLIBASIA_03820
Protein GI in NCBI database:254780869Protein Accession:YP_003065282.1
Gene range:+(837943, 839622)Protein Length:559aa
Gene description:beta-lactamase domain-containing protein
COG prediction:[R] Predicted hydrolase of the metallo-beta-lactamase superfamily
KEGG prediction:beta-lactamase domain-containing protein; K07021
SEED prediction:Metallo-beta-lactamase family protein, RNA-specific
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial RNA-metabolizing Zn-dependent hydrolases
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------56
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR
ccccEEEEEEEcccccccccEEEEEEEcccccEEEEEEccccccccccccccEEcccHHHHHHccccccEEEEEcccHHHHccHHHHHHHccccEEEcHHHHHHHHHHHHHccccccccEEEEccccEEEEccEEEEEEEcccccccEEEEEEEEcccEEEEEccccccccccccccccHHHHHHcccccccEEEccccccccccccccHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHccEEEEEcHHHHHHHHHHHHccccccccccccHHHHHccccccEEEEEccccccHHHHHHHHccccccccccccccEEEEEccccccccHHHHHHHHHHHHcccEEEcccccccEEEEccccHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEccccEEEEEccccEEEEcccccccEEEEccccccccHHHHHHHHHHHHccEEEEEEEEcccccEEEccEEEEcccccccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccc
cccccEEEEEcccccccccccEEEEEEEEccccEEEEEccccccccccccccEEEccHHHHHccHHHEEEEEEEcccccccccHHHHHHHccccEccHHHHHHHHHHHHHHHccccccEEEEEccccEEEEEcEEEEEEEEcccccccEEEEEEccccEEEEccccEEcccccccccccHHHHHHHHcccEEEEEccccccccccccccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHHHHHHcccEEEEEcHHHHHHHHHHHHccccccccccccHHHHHccccccEEEEEccccccHHHHHHHHHcccccEEEEEcccEEEEEcccccccHHHHHHHHHHHHHcccEEEEEcccccEEEcccccHHHHHHHHHHcccccEccccHHHHHHHHHHHHHHHcccccEEEEEcccEEEEccccEEEcccEccccEEEcccccccccHHHHHHHHHHHcccEEEEEEEEccccEEEEcccEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccc
mkneelvflplggvgeigmnmalygygspssrkwimidcgvsfpkddlpgvdlvfpDITFIMKERKNLMAIFITHAHEDHYGALHDLWSflhvpvyaspfaIGLLEAKRVYERVskkipcisfqagdkvdvgAFSIESVRVNHSIPETMALVIrspvgnivhtgdwkldddailgdvtdkdslcaigNEGILALMCdstnamregtcisekGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVgiikkdqlflsdesfglypreQLIVIAtgsqgeprsalAQLSrgemrnvklaekdtvifssraipgnevaiGHIKNRLVEQGVRVIaedaecpvhvsghpypndlkRMYQWIRPQVLVAIHGEPLHLVAHKELALqegiacvppvrngkmlrlfpdpiEIIDEVVHGlflkdgfligkfADLGIAKRRQLSFVGHLSVNVLLdnhynifgvpeivdigipaydgdggkIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIpcisfqagdkvdVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTtfsssvsrirSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIViatgsqgepRSALAqlsrgemrnvklaekdtvifssraipgnevaighIKNRLVEQGVRVIAedaecpvhvSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVIttvvdlpqfrrKDLKLLRESISSALRsllkkvwgkkplvtvfinkisrqr
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFsssvsrirsiidiAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR
***EELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVD**********LLRESISSALRSLLKKVWGKKPLVTVFINKIS***
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR
**NEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISR**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR
MKNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCISFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFINKISRQR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target559 beta-lactamase domain-containing protein [Candidatus Li
315122710560 beta-lactamase domain-containing protein [Candidatus Li 1 0.0
150396128555 beta-lactamase domain-containing protein [Sinorhizobium 1 0.0
116251482556 beta-lactamase family protein [Rhizobium leguminosarum 1 0.0
325292649555 metal dependent hydrolase [Agrobacterium sp. H13-3] Len 1 0.0
159184692555 metal dependent hydrolase [Agrobacterium tumefaciens st 1 0.0
241204103556 beta-lactamase [Rhizobium leguminosarum bv. trifolii WS 1 0.0
222085592557 metallo-beta-lactamase family protein [Agrobacterium ra 1 0.0
195970182555 hypothetical protein SMc01929 [Sinorhizobium meliloti 1 1 0.0
227821634555 metal dependent hydrolase [Sinorhizobium fredii NGR234] 1 0.0
190891302556 metallo-beta-lactamase family protein [Rhizobium etli C 1 0.0
>gi|315122710|ref|YP_004063199.1| beta-lactamase domain-containing protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 560 Back     alignment and organism information
 Score =  917 bits (2371), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/558 (77%), Positives = 510/558 (91%)

Query: 2   KNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFI 61
           + E+LVFLPLGGVGEIGMNMALYG+G+P++RKWIM+DCGVSFPKDDLPGVDLVFPDITF+
Sbjct: 3   EQEDLVFLPLGGVGEIGMNMALYGFGNPNNRKWIMVDCGVSFPKDDLPGVDLVFPDITFV 62

Query: 62  MKERKNLMAIFITHAHEDHYGALHDLWSFLHVPVYASPFAIGLLEAKRVYERVSKKIPCI 121
           ++ERKNLMAI ITHAHEDHYGALHDLWSFL+VPVYASPFAIGLLEAK VYER  K IPCI
Sbjct: 63  LEERKNLMAIIITHAHEDHYGALHDLWSFLNVPVYASPFAIGLLEAKGVYERFPKNIPCI 122

Query: 122 SFQAGDKVDVGAFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILGDVTDKD 181
           SFQAGD++D+G FSI+S++VNHSIPE+MAL+IRSPVGNIVHTGDWKLDD ++LGD+TD+D
Sbjct: 123 SFQAGDQIDIGPFSIKSIQVNHSIPESMALIIRSPVGNIVHTGDWKLDDTSVLGDLTDED 182

Query: 182 SLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSSSVSRIR 241
           SL AIG+EG+LALMCDSTNAM  GT +SEK + +N+Y+I+K  +G  ++T F+SSVSRIR
Sbjct: 183 SLRAIGDEGVLALMCDSTNAMLHGTPVSEKDVAQNLYNIIKKTEGYAVITAFASSVSRIR 242

Query: 242 SIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGS 301
           SIID++E++GRK++LLGSSLKRVV+V+I +G+IKKDQ F+S+ESFGLYPRE+L+VIATGS
Sbjct: 243 SIIDVSEKLGRKVLLLGSSLKRVVNVSIGIGLIKKDQSFVSEESFGLYPREKLVVIATGS 302

Query: 302 QGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDA 361
           QGEPRSALAQLSRGEMRN+KL+ KD VIFSSR+IPGNEVAIG +KN+L+EQGV+++++DA
Sbjct: 303 QGEPRSALAQLSRGEMRNLKLSNKDKVIFSSRSIPGNEVAIGQLKNQLIEQGVQIVSDDA 362

Query: 362 ECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVPPVRNGKM 421
           E PVHVSGHPY  DLKRMYQWIRP+++VAIHGE  HLVA KELALQ GIA VP VRNGKM
Sbjct: 363 EHPVHVSGHPYRKDLKRMYQWIRPKIMVAIHGELSHLVAQKELALQSGIAQVPFVRNGKM 422

Query: 422 LRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLLDNHYNIFG 481
           LRLFPDP+EI+DEVVHG FLKDGFL+GKF +LGIAKR+QLSFVGH+SVNVLLDNHY+I G
Sbjct: 423 LRLFPDPVEIVDEVVHGRFLKDGFLVGKFEELGIAKRKQLSFVGHISVNVLLDNHYDIIG 482

Query: 482 VPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKV 541
           VPE++DIGIP Y  DG KI+KLL KTVITTVV+ PQ RRKDLK LRESI  +LRS LK+ 
Sbjct: 483 VPEVIDIGIPTYGEDGIKINKLLSKTVITTVVNFPQNRRKDLKALRESIGRSLRSCLKQA 542

Query: 542 WGKKPLVTVFINKISRQR 559
           WGKKP+VTVF+++ISRQR
Sbjct: 543 WGKKPIVTVFVSRISRQR 560


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396128|ref|YP_001326595.1| beta-lactamase domain-containing protein [Sinorhizobium medicae WSM419] Length = 555 Back     alignment and organism information
>gi|116251482|ref|YP_767320.1| beta-lactamase family protein [Rhizobium leguminosarum bv. viciae 3841] Length = 556 Back     alignment and organism information
>gi|325292649|ref|YP_004278513.1| metal dependent hydrolase [Agrobacterium sp. H13-3] Length = 555 Back     alignment and organism information
>gi|159184692|ref|NP_354295.2| metal dependent hydrolase [Agrobacterium tumefaciens str. C58] Length = 555 Back     alignment and organism information
>gi|241204103|ref|YP_002975199.1| beta-lactamase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 556 Back     alignment and organism information
>gi|222085592|ref|YP_002544122.1| metallo-beta-lactamase family protein [Agrobacterium radiobacter K84] Length = 557 Back     alignment and organism information
>gi|195970182|ref|NP_385387.2| hypothetical protein SMc01929 [Sinorhizobium meliloti 1021] Length = 555 Back     alignment and organism information
>gi|227821634|ref|YP_002825604.1| metal dependent hydrolase [Sinorhizobium fredii NGR234] Length = 555 Back     alignment and organism information
>gi|190891302|ref|YP_001977844.1| metallo-beta-lactamase family protein [Rhizobium etli CIAT 652] Length = 556 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target559 beta-lactamase domain-containing protein [Candidatus Li
TIGR00649422 TIGR00649, MG423, conserved hypothetical protein 4e-86
COG1236427 COG1236, YSH1, Predicted exonuclease of the beta-lactam 3e-14
smart00849183 smart00849, Lactamase_B, Metallo-beta-lactamase superfa 3e-16
COG1782637 COG1782, COG1782, Predicted metal-dependent RNase, cons 1e-05
KOG1136501 KOG1136, KOG1136, KOG1136, Predicted cleavage and polya 2e-04
KOG1137668 KOG1137, KOG1137, KOG1137, mRNA cleavage and polyadenyl 3e-15
pfam00753148 pfam00753, Lactamase_B, Metallo-beta-lactamase superfam 3e-13
TIGR03675630 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH 7e-05
COG0491252 COG0491, GloB, Zn-dependent hydrolases, including glyox 9e-05
COG1235269 COG1235, PhnP, Metal-dependent hydrolases of the beta-l 8e-04
KOG1361481 KOG1361, KOG1361, KOG1361, Predicted hydrolase involved 8e-08
pfam0752143 pfam07521, RMMBL, RNA-metabolising metallo-beta-lactama 1e-04
TIGR03413248 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase 1e-04
KOG1137 668 KOG1137, KOG1137, KOG1137, mRNA cleavage and polyadenyl 0.003
COG0595555 COG0595, COG0595, Predicted hydrolase of the metallo-be 1e-141
>gnl|CDD|161977 TIGR00649, MG423, conserved hypothetical protein Back     alignment and domain information
>gnl|CDD|31429 COG1236, YSH1, Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129082 smart00849, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|31968 COG1782, COG1782, Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|36351 KOG1136, KOG1136, KOG1136, Predicted cleavage and polyadenylation specificity factor (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|36352 KOG1137, KOG1137, KOG1137, mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|144377 pfam00753, Lactamase_B, Metallo-beta-lactamase superfamily Back     alignment and domain information
>gnl|CDD|132714 TIGR03675, arCOG00543, arCOG00543 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>gnl|CDD|30837 COG0491, GloB, Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>gnl|CDD|31428 COG1235, PhnP, Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>gnl|CDD|36575 KOG1361, KOG1361, KOG1361, Predicted hydrolase involved in interstrand cross-link repair [Replication, recombination and repair] Back     alignment and domain information
>gnl|CDD|148882 pfam07521, RMMBL, RNA-metabolising metallo-beta-lactamase Back     alignment and domain information
>gnl|CDD|163252 TIGR03413, GSH_gloB, hydroxyacylglutathione hydrolase Back     alignment and domain information
>gnl|CDD|36352 KOG1137, KOG1137, KOG1137, mRNA cleavage and polyadenylation factor II complex, BRR5 (CPSF subunit) [RNA processing and modification] Back     alignment and domain information
>gnl|CDD|30940 COG0595, COG0595, Predicted hydrolase of the metallo-beta-lactamase superfamily [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 559 beta-lactamase domain-containing protein [Candidatus Li
TIGR00649593 MG423 conserved hypothetical protein; InterPro: IPR0046 100.0
COG0595555 mRNA degradation ribonucleases J1/J2 (metallo-beta-lact 100.0
TIGR03675630 arCOG00543 arCOG01782 universal archaeal KH-domain/beta 100.0
COG1782637 Predicted metal-dependent RNase, consists of a metallo- 100.0
COG1236427 YSH1 Predicted exonuclease of the beta-lactamase fold i 100.0
KOG1137668 consensus 99.97
KOG1137668 consensus 99.95
KOG1136501 consensus 100.0
PRK00055259 ribonuclease Z; Reviewed 99.84
PRK02113252 putative hydrolase; Provisional 99.79
PRK11244250 phnP carbon-phosphorus lyase complex accessory protein; 99.75
TIGR03307249 PhnP phosphonate metabolism protein PhnP. This family o 99.74
KOG1135 764 consensus 99.61
COG1234292 ElaC Metal-dependent hydrolases of the beta-lactamase s 99.49
PRK00685228 metal-dependent hydrolase; Provisional 99.32
PRK04286294 hypothetical protein; Provisional 98.74
COG2248304 Predicted hydrolase (metallo-beta-lactamase superfamily 98.53
KOG1361481 consensus 99.8
PRK11921395 metallo-beta-lactamase/flavodoxin domain-containing pro 99.03
KOG1138653 consensus 98.59
TIGR02651327 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA mo 99.75
PRK02126334 ribonuclease Z; Provisional 99.7
smart00849183 Lactamase_B Metallo-beta-lactamase superfamily. Apart f 99.63
pfam00753148 Lactamase_B Metallo-beta-lactamase superfamily. 99.34
PRK11539754 hypothetical protein; Provisional 99.05
COG0491252 GloB Zn-dependent hydrolases, including glyoxylases [Ge 99.05
COG2220258 Predicted Zn-dependent hydrolases of the beta-lactamase 98.77
TIGR02649304 true_RNase_BN ribonuclease BN; InterPro: IPR013469 Prot 98.14
KOG0814237 consensus 97.1
PRK05184302 pyrroloquinoline quinone biosynthesis protein PqqB; Pro 99.55
PRK11709355 putative L-ascorbate 6-phosphate lactonase; Provisional 98.47
pfam02112323 PDEase_II cAMP phosphodiesterases class-II. 99.38
COG1235269 PhnP Metal-dependent hydrolases of the beta-lactamase s 99.36
TIGR02108314 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; Inter 95.81
TIGR03413248 GSH_gloB hydroxyacylglutathione hydrolase. Members of t 99.36
PRK10241251 hydroxyacylglutathione hydrolase; Provisional 99.2
TIGR02650277 RNase_Z_T_toga ribonuclease Z, Thermotoga type; InterPr 97.45
KOG4736302 consensus 96.03
TIGR00361731 ComEC_Rec2 DNA internalization-related competence prote 93.15
COG0426388 FpaA Uncharacterized flavoproteins [Energy production a 99.11
COG1237259 Metal-dependent hydrolases of the beta-lactamase superf 98.89
COG2015655 Alkyl sulfatase and related hydrolases [Secondary metab 96.44
PRK05452479 anaerobic nitric oxide reductase flavorubredoxin; Provi 98.87
KOG0813265 consensus 98.57
COG5212356 PDE1 Low-affinity cAMP phosphodiesterase [Signal transd 98.48
COG2333293 ComEC Predicted hydrolase (metallo-beta-lactamase super 98.85
KOG2121 746 consensus 98.74
pfam0752143 RMMBL RNA-metabolising metallo-beta-lactamase. The meta 98.27
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotran 96.96
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family 90.9
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotran 96.18
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional 95.58
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzyme app 94.79
PRK13508309 tagatose-6-phosphate kinase; Provisional 93.45
COG0329299 DapA Dihydrodipicolinate synthase/N-acetylneuraminate l 91.33
PRK00685228 metal-dependent hydrolase; Provisional 91.13
>TIGR00649 MG423 conserved hypothetical protein; InterPro: IPR004613 This is a family of conserved hypothetical proteins, the members of which contain an ATP-binding domain at the N-terminal end of the protein Back     alignment and domain information
>COG0595 mRNA degradation ribonucleases J1/J2 (metallo-beta-lactamase superfamily) [Translation, ribosomal structure and biogenesis; Replication, recombination and repair] Back     alignment and domain information
>TIGR03675 arCOG00543 arCOG01782 universal archaeal KH-domain/beta-lactamase-domain protein Back     alignment and domain information
>COG1782 Predicted metal-dependent RNase, consists of a metallo-beta-lactamase domain and an RNA-binding KH domain [General function prediction only] Back     alignment and domain information
>COG1236 YSH1 Predicted exonuclease of the beta-lactamase fold involved in RNA processing [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1137 consensus Back     alignment and domain information
>KOG1137 consensus Back     alignment and domain information
>KOG1136 consensus Back     alignment and domain information
>PRK00055 ribonuclease Z; Reviewed Back     alignment and domain information
>PRK02113 putative hydrolase; Provisional Back     alignment and domain information
>PRK11244 phnP carbon-phosphorus lyase complex accessory protein; Provisional Back     alignment and domain information
>TIGR03307 PhnP phosphonate metabolism protein PhnP Back     alignment and domain information
>KOG1135 consensus Back     alignment and domain information
>COG1234 ElaC Metal-dependent hydrolases of the beta-lactamase superfamily III [General function prediction only] Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information
>PRK04286 hypothetical protein; Provisional Back     alignment and domain information
>COG2248 Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG1361 consensus Back     alignment and domain information
>PRK11921 metallo-beta-lactamase/flavodoxin domain-containing protein; Provisional Back     alignment and domain information
>KOG1138 consensus Back     alignment and domain information
>TIGR02651 RNase_Z ribonuclease Z; InterPro: IPR013471 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule Back     alignment and domain information
>PRK02126 ribonuclease Z; Provisional Back     alignment and domain information
>smart00849 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>pfam00753 Lactamase_B Metallo-beta-lactamase superfamily Back     alignment and domain information
>PRK11539 hypothetical protein; Provisional Back     alignment and domain information
>COG0491 GloB Zn-dependent hydrolases, including glyoxylases [General function prediction only] Back     alignment and domain information
>COG2220 Predicted Zn-dependent hydrolases of the beta-lactamase fold [General function prediction only] Back     alignment and domain information
>TIGR02649 true_RNase_BN ribonuclease BN; InterPro: IPR013469 Proteins in this entry include ribonuclease BN of Escherichia coli (strain K-12) and closely related proteins believed to be equivalent in function Back     alignment and domain information
>KOG0814 consensus Back     alignment and domain information
>PRK05184 pyrroloquinoline quinone biosynthesis protein PqqB; Provisional Back     alignment and domain information
>PRK11709 putative L-ascorbate 6-phosphate lactonase; Provisional Back     alignment and domain information
>pfam02112 PDEase_II cAMP phosphodiesterases class-II Back     alignment and domain information
>COG1235 PhnP Metal-dependent hydrolases of the beta-lactamase superfamily I [General function prediction only] Back     alignment and domain information
>TIGR02108 PQQ_syn_pqqB coenzyme PQQ biosynthesis protein B; InterPro: IPR011842 This entry describes coenzyme PQQ biosynthesis protein B, a gene required for the biosynthesis of pyrrolo-quinoline-quinone (coenzyme PQQ) Back     alignment and domain information
>TIGR03413 GSH_gloB hydroxyacylglutathione hydrolase Back     alignment and domain information
>PRK10241 hydroxyacylglutathione hydrolase; Provisional Back     alignment and domain information
>TIGR02650 RNase_Z_T_toga ribonuclease Z, Thermotoga type; InterPro: IPR013470 All tRNA molecules are synthesised as long precursors with extra sequence at both the 5' and 3' ends, which undergo several processing steps to form the mature tRNA molecule Back     alignment and domain information
>KOG4736 consensus Back     alignment and domain information
>TIGR00361 ComEC_Rec2 DNA internalization-related competence protein ComEC/Rec2; InterPro: IPR004797 This is the DNA internalisation-related competence protein ComEC/Rec2 family Back     alignment and domain information
>COG0426 FpaA Uncharacterized flavoproteins [Energy production and conversion] Back     alignment and domain information
>COG1237 Metal-dependent hydrolases of the beta-lactamase superfamily II [General function prediction only] Back     alignment and domain information
>COG2015 Alkyl sulfatase and related hydrolases [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK05452 anaerobic nitric oxide reductase flavorubredoxin; Provisional Back     alignment and domain information
>KOG0813 consensus Back     alignment and domain information
>COG5212 PDE1 Low-affinity cAMP phosphodiesterase [Signal transduction mechanisms] Back     alignment and domain information
>COG2333 ComEC Predicted hydrolase (metallo-beta-lactamase superfamily) [General function prediction only] Back     alignment and domain information
>KOG2121 consensus Back     alignment and domain information
>pfam07521 RMMBL RNA-metabolising metallo-beta-lactamase Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13508 tagatose-6-phosphate kinase; Provisional Back     alignment and domain information
>COG0329 DapA Dihydrodipicolinate synthase/N-acetylneuraminate lyase [Amino acid transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00685 metal-dependent hydrolase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target559 beta-lactamase domain-containing protein [Candidatus Li
3bk1_A562 Crystal Structure Analysis Of Rnase J Length = 562 1e-126
2xr1_A640 Dimeric Archaeal Cleavage And Polyadenylation Speci 1e-22
2zdf_B431 Crystal Structure Of S378q Mutant Ttha0252 From The 8e-19
2zde_B431 Crystal Structure Of H380a Mutant Ttha0252 From The 8e-19
2zdd_B431 Crystal Structure Of S378y Mutant Ttha0252 From The 8e-19
2yvd_B431 Crystal Structure Of H400v Mutant Ttha0252 From The 8e-19
3iek_A431 Crystal Structure Of Native Ttha0252 From Thermus T 8e-19
2dkf_A431 Crystal Structure Of Ttha0252 From Thermus Thermoph 1e-17
2zdw_B431 Crystal Structure Of H61a Mutant Ttha0252 From Ther 9e-17
3af5_A651 The Crystal Structure Of An Archaeal Cpsf Subunit, 1e-22
2i7t_A459 Structure Of Human Cpsf-73 Length = 459 3e-22
2az4_A429 Crystal Structure Of A Protein Of Unknown Function 7e-13
1zkp_A268 1.5a Resolution Crystal Structure Of A Metallo Beta 2e-07
2zwr_A207 Crystal Structure Of Ttha1623 From Thermus Thermoph 4e-07
3adr_A261 The First Crystal Structure Of An Archaeal Metallo- 1e-05
2p4z_A284 A Ferredoxin-Like Metallo-Beta-Lactamase Superfamil 0.004
2nxa_A221 Structure Of Zn-Dependent Metallo-Beta-Lactamase Fr 2e-04
2nzf_A221 Structure Of Beta-Lactamase Ii From Bacillus Cereus 3e-04
2nze_A222 Structure Of Beta-Lactamase Ii From Bacillus Cereus 3e-04
1jje_A222 Imp-1 Metallo Beta-Lactamase From Pseudomonas Aerug 2e-04
1dd6_A228 Imp-1 Metallo Beta-Lactamase From Pseudomonas Aerug 2e-04
1ddk_A220 Crystal Structure Of Imp-1 Metallo Beta-Lactamase F 2e-04
2xf4_A210 Crystal Structure Of Salmonella Enterica Serovar Ty 5e-04
1wup_A228 Crystal Structure Of Metallo-Beta-Lactamase Imp-1 M 0.003
>gi|166007339|pdb|3BK1|A Chain A, Crystal Structure Analysis Of Rnase J Length = 562 Back     alignment and structure
 Score =  457 bits (1177), Expect = e-126,   Method: Composition-based stats.
 Identities = 175/561 (31%), Positives = 278/561 (49%), Gaps = 22/561 (3%)

Query: 3   NEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIM 62
            + +  +PLGG GEIG N+ ++ +      +  ++D G++FP++  PGVDL+ P + +++
Sbjct: 14  QDHVEIIPLGGXGEIGKNITVFRF----RDEIFVLDGGLAFPEEGXPGVDLLIPRVDYLI 69

Query: 63  KERKNLMAIFITHAHEDHYGALHDLWSFL-----HVPVYASPFAIGLLEAKRVYERVSKK 117
           + R  + A  +TH HEDH G L  L   +      VP+Y +   +GLL  K     +   
Sbjct: 70  EHRHKIKAWVLTHGHEDHIGGLPFLLPXIFGKESPVPIYGARLTLGLLRGKLEEFGLRPG 129

Query: 118 IPC-ISFQAGDKVDVG-AFSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAILG 175
                     D++ VG  F+++  R  HSIP+   +VIR+P+G IVHTGD+KLD   I G
Sbjct: 130 AFNLKEISPDDRIQVGRYFTLDLFRXTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPIDG 189

Query: 176 DVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSS 235
            V+    +   G EG+L L+ D+TNA R G   SE  I K +  ++  A G V VTTF+S
Sbjct: 190 KVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEXEIAKELDRVIGRAPGRVFVTTFAS 249

Query: 236 SVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLI 295
            + RI+S+I  AE+ GRK+   G S  +   +A+++G +K      + E     P  Q++
Sbjct: 250 HIHRIQSVIWAAEKYGRKVAXEGRSXLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVL 309

Query: 296 VIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVR 355
           ++ATGSQG+P S L +L+        +   DTVI SS  IPGNE A+  + NRL   G  
Sbjct: 310 ILATGSQGQPXSVLHRLAFEGHAKXAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAY 369

Query: 356 VIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIAC--V 413
           V+       VH SGH    +LK +     P+  +  HGE  H    K LA          
Sbjct: 370 VLY-PPTYKVHASGHASQEELKLILNLTTPRFFLPWHGEVRHQXNFKWLAESXSRPPEKT 428

Query: 414 PPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLL 473
               NG + RL  +  E + EV HG+   DG  +G   +  +A RR  +  G + +  L 
Sbjct: 429 LIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHXAEEGLVVITALA 488

Query: 474 DNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSA 533
                   V E+V  G       G ++   + +  +  + +  + ++  L+ +R+ I   
Sbjct: 489 GED----PVVEVVSRGFV---KAGERLLGEVRRXALEALKNGVREKKP-LERIRDDIYYP 540

Query: 534 LRSLLKKVWGKKPLVTVFINK 554
           ++  LKK  G+ P +   + +
Sbjct: 541 VKKFLKKATGRDPXILPVVIE 561


>gi|308198432|pdb|2XR1|A Chain A, Dimeric Archaeal Cleavage And Polyadenylation Specificity Factor With N-Terminal Kh Domains (Kh-Cpsf) From Methanosarcina Mazei Length = 640 Back     alignment and structure
gi|301598475|pdb|3IEK|A Chain A, Crystal Structure Of Native Ttha0252 From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>gi|119389195|pdb|2DKF|A Chain A, Crystal Structure Of Ttha0252 From Thermus Thermophilus Hb8, A Rna Degradation Protein Of The Metallo-Beta-Lactamase Superfamily Length = 431 Back     alignment and structure
gi|294979445|pdb|3AF5|A Chain A, The Crystal Structure Of An Archaeal Cpsf Subunit, Ph1404 From Pyrococcus Horikoshii Length = 651 Back     alignment and structure
>gi|126030713|pdb|2I7T|A Chain A, Structure Of Human Cpsf-73 Length = 459 Back     alignment and structure
gi|82407946|pdb|2AZ4|A Chain A, Crystal Structure Of A Protein Of Unknown Function From Enterococcus Faecalis V583 Length = 429 Back     alignment and structure
>gi|71042373|pdb|1ZKP|A Chain A, 1.5a Resolution Crystal Structure Of A Metallo Beta Lactamase Family Protein, The Elac Homolgue Of Bacillus Anthracis, A Putative Ribonuclease Length = 268 Back     alignment and structure
gi|260656160|pdb|2ZWR|A Chain A, Crystal Structure Of Ttha1623 From Thermus Thermophilus Hb8 Length = 207 Back     alignment and structure
>gi|294979416|pdb|3ADR|A Chain A, The First Crystal Structure Of An Archaeal Metallo-Beta-Lactamase Superfamily Protein; St1585 From Sulfolobus Tokodaii Length = 261 Back     alignment and structure
>gi|170292219|pdb|2P4Z|A Chain A, A Ferredoxin-Like Metallo-Beta-Lactamase Superfamily Protein From Thermoanaerobacter Tengcongensis Length = 284 Back     alignment and structure
>gi|149242517|pdb|2NXA|A Chain A, Structure Of Zn-Dependent Metallo-Beta-Lactamase From Bacillus Cereus R121h, C221d Double Mutant Length = 221 Back     alignment and structure
>gi|149242524|pdb|2NZF|A Chain A, Structure Of Beta-Lactamase Ii From Bacillus Cereus. R121h, C221s Double Mutant. Space Group C2 Length = 221 Back     alignment and structure
>gi|149242522|pdb|2NZE|A Chain A, Structure Of Beta-Lactamase Ii From Bacillus Cereus. R121h, C221s Double Mutant. Space Group P3121. Length = 222 Back     alignment and structure
>gi|15825822|pdb|1JJE|A Chain A, Imp-1 Metallo Beta-Lactamase From Pseudomonas Aeruginosa In Complex With A Biaryl Succinic Acid Inhibitor (11) Length = 222 Back     alignment and structure
>gi|11513826|pdb|1DD6|A Chain A, Imp-1 Metallo Beta-Lactamase From Pseudomonas Aeruginosa In Complex With A Mercaptocarboxylate Inhibitor Length = 228 Back     alignment and structure
>gi|11513751|pdb|1DDK|A Chain A, Crystal Structure Of Imp-1 Metallo Beta-Lactamase From Pseudomonas Aeruginosa Length = 220 Back     alignment and structure
>gi|301598408|pdb|2XF4|A Chain A, Crystal Structure Of Salmonella Enterica Serovar Typhimurium Ycbl Length = 210 Back     alignment and structure
>gi|62738315|pdb|1WUP|A Chain A, Crystal Structure Of Metallo-Beta-Lactamase Imp-1 Mutant (D81e) Length = 228 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target559 beta-lactamase domain-containing protein [Candidatus Li
3bk2_A562 RNAse J, metal dependent hydrolase; endoribonuclease, e 4e-99
2xr1_A640 Cleavage and polyadenylation specificity factor 1 subun 2e-56
2az4_A429 Hypothetical protein EF2904; structural genomics, PSI, 1e-53
3af5_A651 Putative uncharacterized protein PH1404; archaeal CPSF, 8e-52
2zdf_A431 Metallo-beta-lactamase superfamily protein; metallo bet 4e-41
2i7t_A459 Cleavage and polyadenylation specificity factor 73 kDa 3e-35
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductase; HE 2e-21
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DII 2e-18
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like domain, f 7e-08
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase, PRE 4e-10
2vw8_A303 PA1000, PQSE; quinolone signal response protein, signal 2e-07
2q0i_A303 Quinolone signal response protein; quorum sensing, pseu 2e-07
2whg_A230 VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BET 3e-07
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salm 5e-07
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactamase in 2e-06
3adr_A261 Putative uncharacterized protein ST1585; quorum sensing 2e-06
2bib_A547 CBPE, teichoic acid phosphorylcholine esterase/ choline 3e-05
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotics res 3e-04
1ko3_A230 VIM-2 metallo-beta-lactamase; alpha-beta/BETA-alpha fol 5e-04
1ztc_A221 Hypothetical protein TM0894; structural genomics, PSI, 5e-04
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fol 9e-04
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alpha-hel 0.001
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolas 0.003
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hydrolas 0.004
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alph 3e-07
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta protein, P 1e-05
1xto_A311 Coenzyme PQQ synthesis protein B; alpha-beta protein, n 1e-05
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, struc 9e-05
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactamase li 0.001
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus HB27} PDB: 3bk1_A* Length = 562 Back     alignment and structure
 Score =  357 bits (916), Expect = 4e-99
 Identities = 175/560 (31%), Positives = 286/560 (51%), Gaps = 22/560 (3%)

Query: 2   KNEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFI 61
             + +  +PLGG+GEIG N+ ++ +      +  ++D G++FP++ +PGVDL+ P + ++
Sbjct: 13  PQDHVEIIPLGGMGEIGKNITVFRFR----DEIFVLDGGLAFPEEGMPGVDLLIPRVDYL 68

Query: 62  MKERKNLMAIFITHAHEDHYGALHDLWSFLH-----VPVYASPFAIGLLEAKRVYERVSK 116
           ++ R  + A  +TH HEDH G L  L   +      VP+Y +   +GLL  K     +  
Sbjct: 69  IEHRHKIKAWVLTHGHEDHIGGLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRP 128

Query: 117 K-IPCISFQAGDKVDVGA-FSIESVRVNHSIPETMALVIRSPVGNIVHTGDWKLDDDAIL 174
                      D++ VG  F+++  R+ HSIP+   +VIR+P+G IVHTGD+KLD   I 
Sbjct: 129 GAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRTPIGTIVHTGDFKLDPTPID 188

Query: 175 GDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFS 234
           G V+    +   G EG+L L+ D+TNA R G   SE  I K +  ++  A G V VTTF+
Sbjct: 189 GKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFA 248

Query: 235 SSVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQL 294
           S + RI+S+I  AE+ GRK+ + G S+ +   +A+++G +K      + E     P  Q+
Sbjct: 249 SHIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQV 308

Query: 295 IVIATGSQGEPRSALAQLSRGEMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGV 354
           +++ATGSQG+P S L +L+      + +   DTVI SS  IPGNE A+  + NRL   G 
Sbjct: 309 LILATGSQGQPMSVLHRLAFEGHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGA 368

Query: 355 RVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEPLHLVAHKELALQEGIACVP 414
            V+        H SGH    +LK +     P+  +  HGE  H +  K LA         
Sbjct: 369 YVLYPPTYKV-HASGHASQEELKLILNLTTPRFFLPWHGEVRHQMNFKWLAESMSRPPEK 427

Query: 415 PV--RNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVL 472
            +   NG + RL  +  E + EV HG+   DG  +G   +  +A RR ++  G + +  L
Sbjct: 428 TLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITAL 487

Query: 473 LDNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISS 532
                    V E+V  G       G ++   + +  +  + +  +  +K L+ +R+ I  
Sbjct: 488 AGED----PVVEVVSRGFVK---AGERLLGEVRRMALEALKNGVR-EKKPLERIRDDIYY 539

Query: 533 ALRSLLKKVWGKKPLVTVFI 552
            ++  LKK  G+ P++   +
Sbjct: 540 PVKKFLKKATGRDPMILPVV 559


>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Length = 640 Back     alignment and structure
>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10 Length = 429 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Length = 651 Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Length = 459 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Length = 398 Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Length = 402 Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A* Length = 404 Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Length = 717 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Length = 303 Back     alignment and structure
>2q0i_A Quinolone signal response protein; quorum sensing, pseudomonas quinolone signal, PQS, metall- beta-lactamase, iron, phosphodiesterase; 1.57A {Pseudomonas aeruginosa} SCOP: d.157.1.14 PDB: 2q0j_A 3dh8_A* Length = 303 Back     alignment and structure
>2whg_A VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BETA-alpha fold; HET: FLC; 1.90A {Pseudomonas aeruginosa} PDB: 2wrs_A* 1ko3_A 1ko2_A Length = 230 Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Length = 210 Back     alignment and structure
>1jjt_A IMP-1 metallo beta-lactamase; metallo-beta-lactamase inhibitor, succinic acid inhibitor, hydrolase; HET: BDS; 1.80A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1dd6_A* 1vgn_A* 2doo_A* 1wup_A 1wuo_A 1jje_A* 1ddk_A Length = 228 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Length = 261 Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline binding protein; PCE, hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Length = 547 Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Length = 219 Back     alignment and structure
>1ko3_A VIM-2 metallo-beta-lactamase; alpha-beta/BETA-alpha fold, hydrolase; 1.91A {Pseudomonas aeruginosa} SCOP: d.157.1.1 PDB: 1ko2_A Length = 230 Back     alignment and structure
>1ztc_A Hypothetical protein TM0894; structural genomics, PSI, protein structure initiative, joint center for structural genomics, JCSG; HET: MSE; 2.10A {Thermotoga maritima} SCOP: d.157.1.11 Length = 221 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Length = 223 Back     alignment and structure
>2p18_A Glyoxalase II; metalloprotein, beta sandwich, alpha-helical domain, hydrolase; HET: SPD; 1.80A {Leishmania infantum} PDB: 2p1e_A* Length = 311 Back     alignment and structure
>1mqo_A Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolase; HET: CIT; 1.35A {Bacillus cereus} SCOP: d.157.1.1 PDB: 1bc2_A 1bvt_A* 3i0v_A 3i11_A 3i13_A 3i14_A 3i15_A 2uyx_A 2bc2_A 3bc2_A 2bfl_A 2bfk_A 2bfz_B 2bg2_A 2bg7_A 2bg8_A 1dxk_A 2bfz_A 2bg6_A 2bga_A ... Length = 227 Back     alignment and structure
>1qh5_A Glyoxalase II, protein (hydroxyacylglutathione hydrolase); metallo-hydrolase; HET: GTT GBP; 1.45A {Homo sapiens} SCOP: d.157.1.2 PDB: 1qh3_A* Length = 260 Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER assymmetric UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Length = 263 Back     alignment and structure
>3jxp_A Coenzyme PQQ synthesis protein B; alpha-beta protein, PQQ biosynthesis, transport, biosyntheti; 2.20A {Pseudomonas putida KT2440} PDB: 1xto_A Length = 321 Back     alignment and structure
>1xto_A Coenzyme PQQ synthesis protein B; alpha-beta protein, northeast structural genomics consortium, NESG, protein structure initiative; 2.80A {Pseudomonas putida KT2440} SCOP: d.157.1.6 Length = 311 Back     alignment and structure
>2e7y_A TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.97A {Thermotoga maritima} SCOP: d.157.1.7 PDB: 1ww1_A Length = 280 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Length = 414 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target559 beta-lactamase domain-containing protein [Candidatus Li
3bk2_A562 RNAse J, metal dependent hydrolase; endoribonuclease, e 100.0
2az4_A429 Hypothetical protein EF2904; structural genomics, PSI, 100.0
3af5_A651 Putative uncharacterized protein PH1404; archaeal CPSF, 100.0
2xr1_A640 Cleavage and polyadenylation specificity factor 1 subun 100.0
2i7t_A459 Cleavage and polyadenylation specificity factor 73 kDa 100.0
2i7x_A 717 Protein CFT2; polyadenylation, metallo-B-lactamase, PRE 99.98
1zkp_A268 Hypothetical protein BA1088; zinc binding protein, stru 99.88
3g1p_A258 Protein PHNP; C-P lyase, phosphodiesterase, phosphonate 99.81
2bib_A547 CBPE, teichoic acid phosphorylcholine esterase/ choline 99.44
3kl7_A235 Putative metal-dependent hydrolase; structural genomics 99.18
1e5d_A402 Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DII 99.83
1ycg_A398 Nitric oxide reductase; DIIRON site, oxidoreductase; HE 99.8
2ohh_A404 Type A flavoprotein FPRA; beta-lactamase like domain, f 99.75
2cbn_A306 Ribonuclease Z; phosphodiesterase beta lactamase tRNAse 99.72
2q9u_A414 A-type flavoprotein; flavodoxin like, beta lactamase li 99.6
1vme_A410 Flavoprotein; TM0755, structural genomics, JCSG, protei 99.55
3adr_A261 Putative uncharacterized protein ST1585; quorum sensing 99.54
2xf4_A210 Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salm 99.51
1sml_A269 Protein (penicillinase); metallo-beta-lactamase, antibi 99.48
1a7t_A232 Metallo-beta-lactamase; hydrolase (beta-lactamase), zin 99.45
3l6n_A219 Metallo-beta-lactamase; zinc, hydolase, antibiotics res 99.44
2zo4_A317 Metallo-beta-lactamase family protein; hydrolase; 2.10A 99.43
1y44_A320 Ribonuclease Z; zinc-dependent metal hydrolase; HET: ME 99.42
2zwr_A207 Metallo-beta-lactamase superfamily protein; hydrolase; 99.4
1k07_A263 FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alph 99.39
2gmn_A274 Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobiu 99.39
1m2x_A223 Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fol 99.38
2vw8_A303 PA1000, PQSE; quinolone signal response protein, signal 99.36
2whg_A230 VIM-4 metallo-beta-lactamase; hydrolase, alpha-beta/BET 99.32
2gcu_A245 Putative hydroxyacylglutathione hydrolase 3; ethylmalon 99.29
2yz3_A266 Metallo-beta-lactamase; enzyme-inhibitor complex, hydro 99.29
3hnn_A262 Putative diflavin flavoprotein A 5; PSI-2, protein stru 99.29
3iog_A227 Beta-lactamase; hydrolase, antibiotic resistance, metal 99.28
3dha_A254 N-acyl homoserine lactone hydrolase; zinc bimetallohydr 99.28
1p9e_A331 Methyl parathion hydrolase; Zn containing; 2.40A {Pseud 99.26
1xm8_A254 Glyoxalase II; structural genomics, protein structure i 99.26
1mqo_A227 Beta-lactamase II; alpha-beta/BETA-alpha fold, hydrolas 99.26
3esh_A280 Protein similar to metal-dependent hydrolase; structura 99.25
2qed_A258 Hydroxyacylglutathione hydrolase; metallo-B- lactamase 99.22
2p18_A311 Glyoxalase II; metalloprotein, beta sandwich, alpha-hel 99.2
1qh5_A260 Glyoxalase II, protein (hydroxyacylglutathione hydrolas 99.19
1jjt_A228 IMP-1 metallo beta-lactamase; metallo-beta-lactamase in 99.19
2r2d_A276 AGR_PTI_140P, Zn-dependent hydrolases; lactonase, N-acy 99.16
2fhx_A246 SPM-1; metallo-beta-lactamase, dinuclear zinc, antibiot 99.15
1ztc_A221 Hypothetical protein TM0894; structural genomics, PSI, 98.99
2cfu_A658 SDSA1; SDS-hydrolase, lactamase, hydrolase; HET: 1DB; 1 98.95
2p97_A201 Hypothetical protein; putative metal-dependent hydrolas 98.53
3jxp_A321 Coenzyme PQQ synthesis protein B; alpha-beta protein, P 99.54
2e7y_A280 TRNAse Z; tRNA maturation, metallo-beta-lactaMSe, struc 99.44
1vjn_A220 Zn-dependent hydrolase of metallo-beta-lactamase superf 98.95
3bv6_A379 Metal-dependent hydrolase; metallo protein, beta-lactam 99.45
2wyl_A360 L-ascorbate-6-phosphate lactonase ULAG; hydrolase; 2.59 99.26
2p4z_A284 Metal-dependent hydrolases of the beta-lactamase superf 99.04
3md7_A293 Beta-lactamase-like; ssgcid, hydrolase, structural geno 98.96
3h3e_A267 Uncharacterized protein TM1679; structural genomics, su 98.53
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sugar bi 96.43
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, deoxysu 93.14
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fold; HE 92.41
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase; X-R 92.19
3bb8_A 437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartate ami 90.38
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyridoxal p 95.02
3frk_A373 QDTB; aminotransferase, sugar-modification, natural por 93.95
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT 92.0
>3bk2_A RNAse J, metal dependent hydrolase; endoribonuclease, exoribonuclease, metallo-beta-lactamase; HET: U5P; 2.10A {Thermus thermophilus HB27} PDB: 3bk1_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=987.59  Aligned_cols=539  Identities=32%  Similarity=0.550  Sum_probs=511.2

Q ss_pred             CCEEEEEECCCCCCCCCEEEEEEECCCCCCEEEEEECCCCCCCCCCCCEEEECCCHHHHHHHHHCCCEEEEECCCCCCCC
Q ss_conf             86399994068683466069999517778648999776767888767502870795798766412468996054301216
Q gi|254780869|r    3 NEELVFLPLGGVGEIGMNMALYGYGSPSSRKWIMIDCGVSFPKDDLPGVDLVFPDITFIMKERKNLMAIFITHAHEDHYG   82 (559)
Q Consensus         3 ~~~i~~~~lGG~~eiG~N~~~~~~~~~~~~~~iiiD~G~~fp~~~~~gid~iiPd~~~l~~~~~~i~~i~iTH~H~DHiG   82 (559)
                      +++|+|+||||++|||+|||++++    ++++||+|||++||+++.||+|+++|||+||++++++|+||||||||+||+|
T Consensus        14 ~~~i~i~pLGG~~EIG~n~~~~e~----~~~~iliD~G~~f~~~~~~gid~iiPd~~~l~~~~~~i~ai~lTHaH~DH~G   89 (562)
T 3bk2_A           14 QDHVEIIPLGGMGEIGKNITVFRF----RDEIFVLDGGLAFPEEGMPGVDLLIPRVDYLIEHRHKIKAWVLTHGHEDHIG   89 (562)
T ss_dssp             CCCEEEEEEESBSBSSCCEEEEEE----TTEEEEECCCCBCCCTTSTTCCEEEECCHHHHHTGGGEEEEECCCCCHHHHT
T ss_pred             CCEEEEEECCCCCHHHHCEEEEEE----CCEEEEEECCCCCCCCCCCCCCEEECCCHHHHHCCCCCEEEEECCCCHHHHC
T ss_conf             882899966888904516799999----9959999589998975688975893696898737667259997998556537


Q ss_pred             CHHHHHHH-----CCCCEECCHHHHHHHHHHHHHCCCCC-CCCEEEECCCCEEEECC-EEEEEEECCCCCCCCCEEEEEE
Q ss_conf             07888986-----29977929999999999998548865-56225517555577634-8999985567777653567987
Q gi|254780869|r   83 ALHDLWSF-----LHVPVYASPFAIGLLEAKRVYERVSK-KIPCISFQAGDKVDVGA-FSIESVRVNHSIPETMALVIRS  155 (559)
Q Consensus        83 alp~l~~~-----~~~pIY~s~~t~~li~~~~~~~~~~~-~~~~~~i~~~~~~~~g~-~~v~~~~~~Hsip~a~~~~I~t  155 (559)
                      ||||||+.     +++|||||++|++|++.++.+++... .....++++++.+++|+ |+|+||+++||||||+|++|+|
T Consensus        90 alp~Ll~~~~~~~~~~PIY~T~~T~~Ll~~kl~e~~~~~~~~~~~~i~~~~~~~~g~~f~v~~~~v~hsipga~~~~i~t  169 (562)
T 3bk2_A           90 GLPFLLPMIFGKESPVPIYGARLTLGLLRGKLEEFGLRPGAFNLKEISPDDRIQVGRYFTLDLFRMTHSIPDNSGVVIRT  169 (562)
T ss_dssp             THHHHHHHHHCSCCCSEEEEEHHHHHHHHHHHHHTTCCSTTSEEEEECTTCEEEETTTEEEEEEECCCSSSSCEEEEEEE
T ss_pred             CHHHHHHHHCCCCCCCCEECCHHHHHHHHHHHHHCCCCCCCCCEEEECCCCEEEEEEEEEEEEEECCCCCCCCEEEEEEE
T ss_conf             72878875214568858887999999999999972998555531473699659982118999885367777646999982


Q ss_pred             CCCEEEECCCCEECCCCCCCCCCCHHHHHHCCCCCCEEEEECCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEECHH
Q ss_conf             68179983340246776654238988998608788299996356457888777787999999999862798399994147
Q gi|254780869|r  156 PVGNIVHTGDWKLDDDAILGDVTDKDSLCAIGNEGILALMCDSTNAMREGTCISEKGIKKNIYDIMKNAKGCVLVTTFSS  235 (559)
Q Consensus       156 ~~g~i~ytGDfk~d~~p~~g~~~d~~~l~~~~~~gv~~Li~esT~~~~~~~~~sE~~v~~~i~~~~~~~~grViv~~fas  235 (559)
                      |+|+|+||||||+|.+|..++++|+.++++++++++++|++||||+.++++++||+++.+.+.+++.+++||++++||||
T Consensus       170 ~~g~IlyTGDfr~~~~~~~~~~~d~~~~~~~~~~~vl~l~~~st~~~~~~~~~~E~~~~~~i~~~~~~~~grvii~~fas  249 (562)
T 3bk2_A          170 PIGTIVHTGDFKLDPTPIDGKVSHLAKVAQAGAEGVLLLIADATNAERPGYTPSEMEIAKELDRVIGRAPGRVFVTTFAS  249 (562)
T ss_dssp             TTEEEEECCSCCCCSSCTTSCCCCCHHHHHHHHHCCSEEEEECTTTTCCSCCCCHHHHHHHHHHHHHHCSSCEEEECCTT
T ss_pred             CCEEEEEEECCCCCCCCCCCCCCCHHHHHHCCCCCCEEEECCCCCCCCCCCCCCHHHHHHHHHHHHHHCCCCEEEEEECC
T ss_conf             99789998255577777655656889985227778539976878889899997889999999999985799899997040


Q ss_pred             HHHHHHHHHHHHHHHCCEEEEECHHHHHHHHHHHHCCCCCCCCCCCCHHHHCCCCCCCEEEEEECCCCCHHHHHHHHCCC
Q ss_conf             78999999999987188699844869999998874287677654226566223880208999966963268898852027
Q gi|254780869|r  236 SVSRIRSIIDIAEQIGRKIVLLGSSLKRVVSVAIDVGIIKKDQLFLSDESFGLYPREQLIVIATGSQGEPRSALAQLSRG  315 (559)
Q Consensus       236 ni~Ri~~i~~~a~~~~R~v~i~Grs~~~~~~~a~~~g~l~~~~~~i~~~~~~~~p~~~~~ii~TGsqge~~a~l~ria~~  315 (559)
                      |++|+|+++++|+++||+++++||+|.+++.++.+.+|++.+...+..+...+++++++++++||+|||++++|+|++++
T Consensus       250 ni~Riq~i~~~a~~~~r~v~~~g~~~~~~~~~~~~~~~l~~~~~~i~~~~~~~~~~~~~~ii~tg~q~e~~~~l~ria~~  329 (562)
T 3bk2_A          250 HIHRIQSVIWAAEKYGRKVAMEGRSMLKFSRIALELGYLKVKDRLYTLEEVKDLPDHQVLILATGSQGQPMSVLHRLAFE  329 (562)
T ss_dssp             CHHHHHHHHHHHHHTTCEEEEECHHHHHHHHHHHHTTSCCCSSCCBCTGGGTTSCGGGEEEEECCTTSCSHHHHHHHHTT
T ss_pred             HHHHHHHHHHHHHHHCCEEEECCCHHHHHHHHHHHCCCCCCCCCEECCHHHHCCCCCCCEEECCCCCCCHHHHHHHHHCC
T ss_conf             58899999999998498898505118889999997187657753122054310560111031235546667788766416


Q ss_pred             CCCCCCCCCCCEEEEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCCCEECCCCCCHHHHHHHHHHCCCCEEEEECCCH
Q ss_conf             77653026896699996158861778999997651031134303566641315788978999999754953999704577
Q gi|254780869|r  316 EMRNVKLAEKDTVIFSSRAIPGNEVAIGHIKNRLVEQGVRVIAEDAECPVHVSGHPYPNDLKRMYQWIRPQVLVAIHGEP  395 (559)
Q Consensus       316 ~~~~i~l~~~D~vI~ss~~ipGnE~~~~~~~n~l~~~g~~vi~~~~~~~iH~SGHa~~edl~~li~~ikPk~~IPvHGe~  395 (559)
                      .|+.+++.++|+|||||+++||||....++.|++.+.++++++.. ...+|+||||+++||++|++++|||++|||||||
T Consensus       330 ~~~~~~~~~~d~vI~ss~~ipg~e~~~~~~~~~l~~~~~~vi~~~-~~~ih~SGHA~~edLk~~i~~lkPk~vIPVHGE~  408 (562)
T 3bk2_A          330 GHAKMAIKPGDTVILSSSPIPGNEEAVNRVINRLYALGAYVLYPP-TYKVHASGHASQEELKLILNLTTPRFFLPWHGEV  408 (562)
T ss_dssp             CCSSCCCCTTCEEEECSCCCTTCHHHHHHHHHHHHHTTCEEECTT-TSSSCCCSSCCHHHHHHHHHHHCCSEEEEESBCH
T ss_pred             CCCCCCCCCCCEEEEEEECCCCCHHHHHHHHHHHHHCCCCEEECC-CCCCCCCCCCCHHHHHHHHHHHCCCEEEEECCHH
T ss_conf             643241289998999830267621479999999997287045314-3354045889999999999863988777855529


Q ss_pred             HHHHHHHHHHHHCCC--CCEEEECCCEEEEECCCCEEEEEEEECCCEEECCCCEECCCCHHHHHHHHHHHCCEEEEEEEE
Q ss_conf             999999987874478--631550032278973897045012321320212331002550588999974038749999998
Q gi|254780869|r  396 LHLVAHKELALQEGI--ACVPPVRNGKMLRLFPDPIEIIDEVVHGLFLKDGFLIGKFADLGIAKRRQLSFVGHLSVNVLL  473 (559)
Q Consensus       396 rhl~~h~~la~~~gv--~~i~l~~NGd~i~l~~~~~~i~~~v~~g~~~vDG~~i~~~~~~vl~eR~~Ls~~GiV~V~vii  473 (559)
                      |||.+|+++|+++|+  +++++++|||+++|.++.+++.+++++|++|+||++++++++.+|+||++||+||+|+|++++
T Consensus       409 ~~l~~~~~la~~~g~~~~~~~i~~nG~~~~~~~~~~~~~~~~~~~~~~vdg~~~~~~~~~vl~~R~~l~~~G~~~v~~~~  488 (562)
T 3bk2_A          409 RHQMNFKWLAESMSRPPEKTLIGENGAVYRLTRETFEKVGEVPHGVLYVDGLGVGDITEEILADRRHMAEEGLVVITALA  488 (562)
T ss_dssp             HHHHHHHHHHHTSSSCCSEECCCCTTEEEEECSSCEEEEEECCCCEEEEETTEEEEECHHHHHHHHHHHHHCEEEEEEEE
T ss_pred             HHHHHHHHHHHHHCCCCCCEEEECCCEEEEECCCCCEEECEEEECCEEEECCCCCCCCCHHHHHHHHHHHCCEEEEEEEE
T ss_conf             99999999999819987644880498699954888668154400898994985346767589999999719849999998


Q ss_pred             CCCCCEEECCEEEEECCEECCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEE
Q ss_conf             38998800537999401212566588999999999999985220036898999999999999999998288867899999
Q gi|254780869|r  474 DNHYNIFGVPEIVDIGIPAYDGDGGKIHKLLLKTVITTVVDLPQFRRKDLKLLRESISSALRSLLKKVWGKKPLVTVFIN  553 (559)
Q Consensus       474 d~~~~l~~~P~I~~~Gl~~~~~~~~~l~~~i~~~i~~~i~~~~~~~~~d~~~lk~~ir~~irk~~~k~~~KkP~V~v~I~  553 (559)
                      |+++.    |++.++|++   .+++.+.+++++.+.+.+.+..+. .++++.+++.+|+.+|++++++|+|||+|+|+|+
T Consensus       489 ~~~~~----~~~~~~g~~---~~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~~~~~i~~~~~~~~~~~~~k~P~v~~~i~  560 (562)
T 3bk2_A          489 GEDPV----VEVVSRGFV---KAGERLLGEVRRMALEALKNGVRE-KKPLERIRDDIYYPVKKFLKKATGRDPMILPVVI  560 (562)
T ss_dssp             SSSCE----EEEEEESCC---HHHHTSHHHHHHHHHHHHHHHHHT-TCCHHHHHHHHHHHHHHHHHHHHSCCCEEEEEEE
T ss_pred             CCCCC----EEEEEECCC---CCCHHHHHHHHHHHHHHHHHHHCC-CCCHHHHHHHHHHHHHHHHHHHHCCCCEEEEEEE
T ss_conf             89993----489931565---761889999999999999864313-6619999999999999999999789987999995


Q ss_pred             E
Q ss_conf             9
Q gi|254780869|r  554 K  554 (559)
Q Consensus       554 r  554 (559)
                      +
T Consensus       561 e  561 (562)
T 3bk2_A          561 E  561 (562)
T ss_dssp             E
T ss_pred             C
T ss_conf             3



>2az4_A Hypothetical protein EF2904; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.00A {Enterococcus faecalis V583} SCOP: d.157.1.10 Back     alignment and structure
>3af5_A Putative uncharacterized protein PH1404; archaeal CPSF, beta-CAsp family, KH domain, ribonuclease, ME beta-lactamase superfamily, archaea; 2.60A {Pyrococcus horikoshii} PDB: 3af6_A* Back     alignment and structure
>2xr1_A Cleavage and polyadenylation specificity factor 1 subunit; hydrolase, metallo-beta-lactamase, beta-CAsp, RNA processing; 2.59A {Methanosarcina mazei} Back     alignment and structure
>2i7t_A Cleavage and polyadenylation specificity factor 73 kDa subunit; metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination; 2.10A {Homo sapiens} SCOP: d.157.1.10 PDB: 2i7v_A Back     alignment and structure
>2i7x_A Protein CFT2; polyadenylation, metallo-B-lactamase, PRE-mRNA processing, artemis, V(D)J recombination, double-strand break repair; 2.50A {Saccharomyces cerevisiae} SCOP: d.157.1.10 Back     alignment and structure
>1zkp_A Hypothetical protein BA1088; zinc binding protein, structural genomics, PSI, protein structure initiative; 1.50A {Bacillus anthracis str} SCOP: d.157.1.9 Back     alignment and structure
>3g1p_A Protein PHNP; C-P lyase, phosphodiesterase, phosphonate utilization, alkylphosphonate uptake; 1.40A {Escherichia coli} Back     alignment and structure
>2bib_A CBPE, teichoic acid phosphorylcholine esterase/ choline binding protein; PCE, hydrolase; HET: PC BTB; 1.92A {Streptococcus pneumoniae} SCOP: b.109.1.1 d.157.1.8 PDB: 1wra_A* Back     alignment and structure
>3kl7_A Putative metal-dependent hydrolase; structural genomics, joint center for structural genomics, JCSG; 2.30A {Parabacteroides distasonis atcc 8503} Back     alignment and structure
>1e5d_A Rubredoxin\:oxygen oxidoreductase; oxygenreductase, DIIRON-centre, flavoproteins, lactamase-fold; HET: FMN; 2.5A {Desulfovibrio gigas} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>1ycg_A Nitric oxide reductase; DIIRON site, oxidoreductase; HET: FMN; 2.80A {Moorella thermoacetica} SCOP: c.23.5.1 d.157.1.3 PDB: 1ycf_A* 1ych_A* Back     alignment and structure
>2ohh_A Type A flavoprotein FPRA; beta-lactamase like domain, flavodoxine like domain, oxidoreductase; HET: FMN; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2ohi_A* 2ohj_A* Back     alignment and structure
>2cbn_A Ribonuclease Z; phosphodiesterase beta lactamase tRNAse Z, hydrolase, metal- binding, endonuclease, tRNA processing, zinc; 2.9A {Escherichia coli} SCOP: d.157.1.7 Back     alignment and structure
>2q9u_A A-type flavoprotein; flavodoxin like, beta lactamase like, oxidoreductase; HET: FMN; 1.90A {Giardia intestinalis} Back     alignment and structure
>1vme_A Flavoprotein; TM0755, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; HET: MSE; 1.80A {Thermotoga maritima} SCOP: c.23.5.1 d.157.1.3 Back     alignment and structure
>3adr_A Putative uncharacterized protein ST1585; quorum sensing, quinolone signal, metallo-beta-lactamase FOL conserved hypothetical protein; HET: EPE; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>2xf4_A Hydroxyacylglutathione hydrolase; HET: PG4; 2.30A {Salmonella enterica} Back     alignment and structure
>1sml_A Protein (penicillinase); metallo-beta-lactamase, antibiotic resistance, binuclear zinc, hydrolase; 1.70A {Stenotrophomonas maltophilia} SCOP: d.157.1.1 PDB: 2aio_A* 2fm6_A 2fu6_A 2fu7_A* 2fu8_A* 2fu9_A* 2gfj_A* 2gfk_A* 2h6a_A 2hb9_A* 2qdt_A* 2qjs_A 2qin_A Back     alignment and structure
>1a7t_A Metallo-beta-lactamase; hydrolase (beta-lactamase), zinc; HET: MES; 1.85A {Bacteroides fragilis} SCOP: d.157.1.1 PDB: 1a8t_A* 2bmi_A 1kr3_A 1znb_A 2znb_A 3znb_A 4znb_A 1hlk_A* Back     alignment and structure
>3l6n_A Metallo-beta-lactamase; zinc, hydolase, antibiotics resistance, hydrolase; 1.65A {Chryseobacterium indologenes} Back     alignment and structure
>2zo4_A Metallo-beta-lactamase family protein; hydrolase; 2.10A {Thermus thermophilus HB8} Back     alignment and structure
>1y44_A Ribonuclease Z; zinc-dependent metal hydrolase; HET: MES; 2.10A {Bacillus subtilis} SCOP: d.157.1.7 PDB: 2fk6_A* Back     alignment and structure
>2zwr_A Metallo-beta-lactamase superfamily protein; hydrolase; 2.20A {Thermus thermophilus} PDB: 2zzi_A Back     alignment and structure
>1k07_A FEZ-1 beta-lactamase; monomer with alpha-beta/BETA-alpha fold. two monomers PER assymmetric UNIT., hydrolase; HET: GOL; 1.65A {Fluoribacter gormanii} SCOP: d.157.1.1 PDB: 1jt1_A* 1l9y_A Back     alignment and structure
>2gmn_A Metallo-beta-lactamase; hydrolase; 1.40A {Bradyrhizobium japonicum usda 110} SCOP: d.157.1.1 Back     alignment and structure
>1m2x_A Class B carbapenemase BLAB-1; alpha-beta/BETA-alpha fold., hydrolase; HET: MCO; 1.50A {Elizabethkingia meningoseptica} SCOP: d.157.1.1 Back     alignment and structure
>2vw8_A PA1000, PQSE; quinolone signal response protein, signaling protein, SSPF; 1.45A {Pseudomonas aeruginosa PAO1} PDB: 2q0j_A 2q0i_A 3dh8_A* Back     alignment and structure