254780868

254780868

birA bifunctional protein

GeneID in NCBI database:8209883Locus tag:CLIBASIA_03815
Protein GI in NCBI database:254780868Protein Accession:YP_003065281.1
Gene range:+(837166, 837924)Protein Length:252aa
Gene description:birA bifunctional protein
COG prediction:[H] Biotin-(acetyl-CoA carboxylase) ligase
KEGG prediction:BirA bifunctional protein; K03524 BirA family transcriptional regulator, biotin operon repressor / biotin-[acetyl-CoA-carboxylase] ligase [EC:6.3.4.15]
SEED prediction:Biotin-protein ligase (EC 6.3.4.15)
Pathway involved in KEGG:Biotin metabolism [PATH:las00780]
Subsystem involved in SEED:Biotin biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250--
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
ccccHHHHcccccccEEEEEccccHHHHHHHHHHccccccEEEEEcccccccccccccEEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccEEEccEEEEEEEEEcccccccEEEEEEEccccccccccccccHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccccEEEEEEcccEEEEEEEEEcccccEEEEcccccEEEEEEccEEc
ccccccccHcccccEEEEEcccccHHHHHHHHHHccccccEEEEEEEccccccccccccEcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEccccEEEcccEEEEEEEEEcccccccEEEEEEEEEEccccccHcccccHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccEEEEEEcccEEEEEEEEcccccEEEEEcccccEEEEEEcEEcc
mfsnlsecqnpysfRYEFFDTISSTNDECMKRAlsgdlgnlWIVASCqtagrgrrdnkwisdkgnLYASLLLIDSISKDSLTLLSFAIAVAMRSVIAstlpvgtdvkikwpndILVFQRKIAGILIETLNLKNGLQAVVVGIGlnvkhcpvdtpypvtslqreggcidlKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGsilgrfvgvddfgYLLLEEKKGCVRQIFTGDIFT
mfsnlsecqnpySFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQtagrgrrdnkwisdKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIAStlpvgtdvkikwPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLeekkgcvrqiftgdift
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYAslllidsiskdsltllsFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
*********NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
**SNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT
MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target252 birA bifunctional protein [Candidatus Liberibacter asia
315122711252 birA bifunctional protein [Candidatus Liberibacter sola 1 1e-111
325292648246 biotin-acetyl-CoA-carboxylase ligase [Agrobacterium sp. 1 3e-54
15888613256 birA bifunctional protein [Agrobacterium tumefaciens st 1 3e-53
218462143254 biotin--[acetyl-CoA carboxylase] synthetase protein [Rh 1 5e-53
209548878254 biotin/acetyl-CoA-carboxylase ligase [Rhizobium legumin 1 3e-52
218672169254 biotin--[acetyl-CoA carboxylase] synthetase protein [Rh 1 6e-52
190891301254 biotin--[acetyl-CoA carboxylase] synthetase [Rhizobium 1 7e-52
222085591256 biotin--(acetyl-CoA carboxylase) synthetase protein [Ag 1 8e-52
86357253254 biotin--[acetyl-CoA carboxylase] synthetase protein [Rh 1 9e-52
116251481254 biotin transcriptional regulator bifunctional protein [ 1 1e-51
>gi|315122711|ref|YP_004063200.1| birA bifunctional protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 252 Back     alignment and organism information
 Score =  406 bits (1044), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 196/251 (78%), Positives = 222/251 (88%)

Query: 1   MFSNLSECQNPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWI 60
           M S+LSEC+  Y+FRYEFFDTI STNDECMKRALSGDLGNLWI+AS QT+GRGR   KW+
Sbjct: 1   MLSDLSECKKLYNFRYEFFDTIVSTNDECMKRALSGDLGNLWIIASRQTSGRGRGGKKWV 60

Query: 61  SDKGNLYASLLLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRK 120
           SDKGNLYASLLLIDSISKDSLTLLSFA++VAM S+IAS LP   DVKIKWPND+LVFQRK
Sbjct: 61  SDKGNLYASLLLIDSISKDSLTLLSFAVSVAMHSIIASILPAEVDVKIKWPNDLLVFQRK 120

Query: 121 IAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGGCIDLKDIFSLLFQDV 180
           IAGILIETL+LK+GLQA+V+GIGLNV++CP DT YPVTSL++EGGCIDLK I  + FQ++
Sbjct: 121 IAGILIETLDLKSGLQAIVIGIGLNVEYCPKDTSYPVTSLRKEGGCIDLKSILPIFFQEI 180

Query: 181 ARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKG 240
           A++L +WKKDTGREEIM LWRCFA GIG+ ITIKL   SI G FVGVDDFGYLLLEEKKG
Sbjct: 181 AKMLAIWKKDTGREEIMKLWRCFAYGIGNPITIKLPQFSISGHFVGVDDFGYLLLEEKKG 240

Query: 241 CVRQIFTGDIF 251
           C R+IFTGDIF
Sbjct: 241 CFRKIFTGDIF 251


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|325292648|ref|YP_004278512.1| biotin-acetyl-CoA-carboxylase ligase [Agrobacterium sp. H13-3] Length = 246 Back     alignment and organism information
>gi|15888613|ref|NP_354294.1| birA bifunctional protein [Agrobacterium tumefaciens str. C58] Length = 256 Back     alignment and organism information
>gi|218462143|ref|ZP_03502234.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli Kim 5] Length = 254 Back     alignment and organism information
>gi|209548878|ref|YP_002280795.1| biotin/acetyl-CoA-carboxylase ligase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 254 Back     alignment and organism information
>gi|218672169|ref|ZP_03521838.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli GR56] Length = 254 Back     alignment and organism information
>gi|190891301|ref|YP_001977843.1| biotin--[acetyl-CoA carboxylase] synthetase [Rhizobium etli CIAT 652] Length = 254 Back     alignment and organism information
>gi|222085591|ref|YP_002544121.1| biotin--(acetyl-CoA carboxylase) synthetase protein [Agrobacterium radiobacter K84] Length = 256 Back     alignment and organism information
>gi|86357253|ref|YP_469145.1| biotin--[acetyl-CoA carboxylase] synthetase protein [Rhizobium etli CFN 42] Length = 254 Back     alignment and organism information
>gi|116251481|ref|YP_767319.1| biotin transcriptional regulator bifunctional protein [Rhizobium leguminosarum bv. viciae 3841] Length = 254 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target252 birA bifunctional protein [Candidatus Liberibacter asia
TIGR00121237 TIGR00121, birA_ligase, birA, biotin-[acetyl-CoA-carbox 4e-36
PRK11886319 PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-ca 3e-30
PRK08330236 PRK08330, PRK08330, biotin--protein ligase; Provisional 3e-26
PRK06955300 PRK06955, PRK06955, biotin--protein ligase; Provisional 2e-20
KOG1536649 KOG1536, KOG1536, KOG1536, Biotin holocarboxylase synth 6e-12
PRK13325 592 PRK13325, PRK13325, bifunctional biotin--[acetyl-CoA-ca 1e-10
COG0340238 COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [ 5e-51
PRK08477211 PRK08477, PRK08477, biotin--protein ligase; Provisional 1e-17
PRK05935190 PRK05935, PRK05935, biotin--protein ligase; Provisional 2e-15
PTZ00276245 PTZ00276, PTZ00276, biotin/lipoate protein ligase; Prov 7e-15
PTZ00275285 PTZ00275, PTZ00275, biotin-acetyl-CoA-carboxylase ligas 4e-12
pfam03099124 pfam03099, BPL_LplA_LipB, Biotin/lipoate A/B protein li 9e-17
pfam0223747 pfam02237, BPL_C, Biotin protein ligase C terminal doma 2e-04
>gnl|CDD|161719 TIGR00121, birA_ligase, birA, biotin-[acetyl-CoA-carboxylase] ligase region Back     alignment and domain information
>gnl|CDD|183359 PRK11886, PRK11886, bifunctional biotin--[acetyl-CoA-carboxylase] synthetase/biotin operon repressor; Provisional Back     alignment and domain information
>gnl|CDD|169384 PRK08330, PRK08330, biotin--protein ligase; Provisional Back     alignment and domain information
>gnl|CDD|180776 PRK06955, PRK06955, biotin--protein ligase; Provisional Back     alignment and domain information
>gnl|CDD|36749 KOG1536, KOG1536, KOG1536, Biotin holocarboxylase synthetase/biotin-protein ligase [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|183976 PRK13325, PRK13325, bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|30688 COG0340, BirA, Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181443 PRK08477, PRK08477, biotin--protein ligase; Provisional Back     alignment and domain information
>gnl|CDD|168301 PRK05935, PRK05935, biotin--protein ligase; Provisional Back     alignment and domain information
>gnl|CDD|140302 PTZ00276, PTZ00276, biotin/lipoate protein ligase; Provisional Back     alignment and domain information
>gnl|CDD|185536 PTZ00275, PTZ00275, biotin-acetyl-CoA-carboxylase ligase; Provisional Back     alignment and domain information
>gnl|CDD|145963 pfam03099, BPL_LplA_LipB, Biotin/lipoate A/B protein ligase family Back     alignment and domain information
>gnl|CDD|111161 pfam02237, BPL_C, Biotin protein ligase C terminal domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 252 birA bifunctional protein [Candidatus Liberibacter asia
PRK11886319 biotin--protein ligase; Provisional 100.0
PRK06955300 biotin--protein ligase; Provisional 100.0
COG0340238 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme m 100.0
PRK08330236 biotin--protein ligase; Provisional 100.0
PTZ00276245 biotin/lipoate protein ligase; Provisional 100.0
PTZ00275288 biotin-acetyl-CoA-carboxylase ligase; Provisional 100.0
PRK13325 592 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pa 100.0
PRK08477214 biotin--protein ligase; Provisional 100.0
KOG1536649 consensus 100.0
TIGR00121248 birA_ligase biotin-[acetyl-CoA-carboxylase] ligase; Int 100.0
PRK05935190 biotin--protein ligase; Provisional 100.0
COG0095248 LplA Lipoate-protein ligase A [Coenzyme metabolism] 95.42
pfam03099124 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family. 99.93
pfam0223747 BPL_C Biotin protein ligase C terminal domain. The func 98.46
PRK03822338 lplA lipoate-protein ligase A; Provisional 95.6
PRK00008212 lipB lipoyltransferase; Reviewed 95.18
COG0321221 LipB Lipoate-protein ligase B [Coenzyme metabolism] 90.66
pfam04017183 DUF366 Domain of unknown function (DUF366). Archaeal do 90.58
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>PRK06955 biotin--protein ligase; Provisional Back     alignment and domain information
>COG0340 BirA Biotin-(acetyl-CoA carboxylase) ligase [Coenzyme metabolism] Back     alignment and domain information
>PRK08330 biotin--protein ligase; Provisional Back     alignment and domain information
>PTZ00276 biotin/lipoate protein ligase; Provisional Back     alignment and domain information
>PTZ00275 biotin-acetyl-CoA-carboxylase ligase; Provisional Back     alignment and domain information
>PRK13325 bifunctional biotin--[acetyl-CoA-carboxylase] ligase/pantothenate kinase; Reviewed Back     alignment and domain information
>PRK08477 biotin--protein ligase; Provisional Back     alignment and domain information
>KOG1536 consensus Back     alignment and domain information
>TIGR00121 birA_ligase biotin-[acetyl-CoA-carboxylase] ligase; InterPro: IPR004408 The biotin operon of Escherichia coli contains 5 structural genes involved in the synthesis of biotin Back     alignment and domain information
>PRK05935 biotin--protein ligase; Provisional Back     alignment and domain information
>COG0095 LplA Lipoate-protein ligase A [Coenzyme metabolism] Back     alignment and domain information
>pfam03099 BPL_LplA_LipB Biotin/lipoate A/B protein ligase family Back     alignment and domain information
>pfam02237 BPL_C Biotin protein ligase C terminal domain Back     alignment and domain information
>PRK03822 lplA lipoate-protein ligase A; Provisional Back     alignment and domain information
>PRK00008 lipB lipoyltransferase; Reviewed Back     alignment and domain information
>COG0321 LipB Lipoate-protein ligase B [Coenzyme metabolism] Back     alignment and domain information
>pfam04017 DUF366 Domain of unknown function (DUF366) Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target252 birA bifunctional protein [Candidatus Liberibacter asia
1hxd_A321 Crystal Structure Of E. Coli Biotin Repressor With 2e-32
1wnl_A235 Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase 6e-30
2djz_A235 Crystal Structure Of Biotin Protein Ligase From Pyr 7e-30
2dxt_A235 Crystal Structure Of Biotin Protein Ligase From Pyr 8e-30
2deq_A235 Crystal Structure Of Biotin Protein Ligase From Pyr 1e-29
1wpy_A235 Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase 3e-29
2dve_A235 Crystal Structure Of Biotin Protein Ligase From Pyr 7e-29
2dxu_A235 Crystal Structure Of Biotin Protein Ligase From Pyr 1e-28
2e41_A235 Crystal Structure Of Biotin Protein Ligase From Pyr 2e-28
3l1a_A266 Structural Ordering Of Disordered Ligand Binding Lo 2e-26
2cgh_A268 Crystal Structure Of Biotin Ligase From Mycobacteri 2e-26
2eay_A233 Crystal Structure Of Biotin Protein Ligase From Aqu 6e-23
3efs_A233 Biotin Protein Ligase From Aquifex Aeolicus In Comp 7e-23
2ej9_A237 Crystal Structure Of Biotin Protein Ligase From Met 7e-23
3efr_A233 Biotin Protein Ligase R40g Mutant From Aquifex Aeol 9e-22
gi|14488672|pdb|1HXD|A Chain A, Crystal Structure Of E. Coli Biotin Repressor With Bound Biotin Length = 321 Back     alignment and structure
 Score =  143 bits (361), Expect = 2e-32,   Method: Composition-based stats.
 Identities = 63/243 (25%), Positives = 102/243 (41%), Gaps = 9/243 (3%)

Query: 12  YSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDK-GNLYASL 70
                     I STN   + R           +A  Q AGRGRR  KW S    NLY S+
Sbjct: 77  DGGSVAVLPVIDSTNQYLLDRIGELK-SGDACIAEYQQAGRGRRGRKWFSPFGANLYLSM 135

Query: 71  LLIDSISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLN 130
                    +   LS  I + M  V+         V++KWPND+ +  RK+AGIL+E   
Sbjct: 136 FWRLEQGPAAAIGLSLVIGIVMAEVLRKLGAD--KVRVKWPNDLYLQDRKLAGILVELTG 193

Query: 131 LKNGLQAVVVGIGLNVKHC---PVDTPYPVTSLQREGGCIDLKDIFSLLFQDVARVLDLW 187
                  +V+G G+N+               +LQ  G  +D   + ++L +++   L+L+
Sbjct: 194 KTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLDRNTLAAMLIRELRAALELF 253

Query: 188 KKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFT 247
           +++      ++ W      I   + + +    I G   G+D  G LLLE+  G ++    
Sbjct: 254 EQEG-LAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPWMG 311

Query: 248 GDI 250
           G+I
Sbjct: 312 GEI 314


gi|75765346|pdb|1WNL|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase) Ligase From Pyrococcus Horikoshii Ot3 In Complex With Adp Length = 235 Back     alignment and structure
>gi|118137515|pdb|2DJZ|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111a Mutation Length = 235 Back     alignment and structure
>gi|134104167|pdb|2DXT|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With Atp And Biotin, Mutation D104a Length = 235 Back     alignment and structure
>gi|114793686|pdb|2DEQ|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, K111g Mutation Length = 235 Back     alignment and structure
>gi|78100836|pdb|1WPY|A Chain A, Crystal Structure Of Biotin-(Acetyl-Coa-Carboxylase) Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotin Length = 235 Back     alignment and structure
>gi|126030326|pdb|2DVE|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Ot3 In Complex With Biotinyl-5'-Amp, Mutation Arg51ala Length = 235 Back     alignment and structure
>gi|134104169|pdb|2DXU|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With Biotinyl-5'-Amp, Mutation R48a Length = 235 Back     alignment and structure
>gi|149241260|pdb|2E41|A Chain A, Crystal Structure Of Biotin Protein Ligase From Pyrococcus Horikoshii Complexed With The Reaction Product Analog Biotinol-5'-Amp, Mutations R48a And K111a Length = 235 Back     alignment and structure
gi|290790143|pdb|3L1A|A Chain A, Structural Ordering Of Disordered Ligand Binding Loops Of Biotin Protein Ligase Into Active Conformations As A Consequence Of Dehydration Length = 266 Back     alignment and structure
>gi|146386418|pdb|2CGH|A Chain A, Crystal Structure Of Biotin Ligase From Mycobacterium Tuberculosis Length = 268 Back     alignment and structure
>gi|157834878|pdb|2EAY|A Chain A, Crystal Structure Of Biotin Protein Ligase From Aquifex Aeolicus Length = 233 Back     alignment and structure
>gi|239781819|pdb|3EFS|A Chain A, Biotin Protein Ligase From Aquifex Aeolicus In Complex With Biotin And Atp Length = 233 Back     alignment and structure
gi|170292160|pdb|2EJ9|A Chain A, Crystal Structure Of Biotin Protein Ligase From Methanococcus Jannaschii Length = 237 Back     alignment and structure
>gi|239781817|pdb|3EFR|A Chain A, Biotin Protein Ligase R40g Mutant From Aquifex Aeolicus In Complex With Biotin Length = 233 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target252 birA bifunctional protein [Candidatus Liberibacter asia
3bfm_A235 Biotin protein ligase-like protein of unknown function; 1e-28
2ej9_A237 Putative biotin ligase; biotin biosynthesis, monomer, X 3e-25
1bia_A321 BIRA bifunctional protein; transcription regulation; 2. 7e-25
2cgh_A268 Biotin ligase; 1.8A {Mycobacterium tuberculosis} Length 2e-23
2eay_A233 Biotin [acetyl-COA-carboxylase] ligase; biotin biosynth 2e-22
2dxu_A235 Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynt 3e-22
>3bfm_A Biotin protein ligase-like protein of unknown function; YP_612389.1, structural genomics, joint center for structural genomics, JCSG; HET: 2PE; 1.70A {Silicibacter SP} Length = 235 Back     alignment and structure
 Score =  121 bits (305), Expect = 1e-28
 Identities = 35/225 (15%), Positives = 68/225 (30%), Gaps = 10/225 (4%)

Query: 32  RALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLIDSISKDSLTLLSFAIAVA 91
            A         +       G       +      L A+L+L   +       +     V 
Sbjct: 15  EAAGPGQDPFDLACQKAELGVDAGLVVYELGTDVLRAALVLAPEVPLAKAMAMLPVCGVG 74

Query: 92  MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQA--VVVGIGLNVKHC 149
            ++ + +  P    V + W   + +   +   + I         Q   +VVG+ L +   
Sbjct: 75  FQNALGALAPPEVAVHLDWNGALRINGARCGRLRIAASTDDPDTQPDWLVVGLDLPLWPE 134

Query: 150 PVDTP-YPVTSLQRE-GGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGI 207
                    T+L  E    +    +     +     ++    +   E I   WR  A G+
Sbjct: 135 GDGGETPDETALYAEGCADVAAPRLLESWARHCLHWIN-RWDEGELETIHGEWRGLAHGM 193

Query: 208 GDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQIFTGDIFT 252
           G+  T         G F+GVD+   +LL ++      I    +  
Sbjct: 194 GEARTEA----GRSGTFLGVDEDFGMLLRDETT-THLIPLTTVLV 233


>2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Length = 237 Back     alignment and structure
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Length = 321 Back     alignment and structure
>2cgh_A Biotin ligase; 1.8A {Mycobacterium tuberculosis} Length = 268 Back     alignment and structure
>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Length = 233 Back     alignment and structure
>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Length = 235 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target252 birA bifunctional protein [Candidatus Liberibacter asia
1bia_A321 BIRA bifunctional protein; transcription regulation; 2. 100.0
2cgh_A268 Biotin ligase; 1.8A {Mycobacterium tuberculosis} PDB: 3 100.0
2eay_A233 Biotin [acetyl-COA-carboxylase] ligase; biotin biosynth 100.0
2dxu_A235 Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynt 100.0
2ej9_A237 Putative biotin ligase; biotin biosynthesis, monomer, X 100.0
3bfm_A235 Biotin protein ligase-like protein of unknown function; 100.0
3a7r_A337 Lipoate-protein ligase A; adenylate-forming enzyme, lip 97.34
2e5a_A347 Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10 97.22
2p0l_A288 Lipoate-protein ligase A; PFAM, lopoate-protein ligase 97.26
2p5i_A288 BH3822 protein; PFAM03099, structural genomics, PSI-2, 97.01
1vqz_A341 Lipoate-protein ligase, putative; NP_345629.1, structur 97.05
2qhs_A237 Lipoyltransferase; globular protein; HET: OCA; 1.50A {T 96.31
2c8m_A262 Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A 95.67
1w66_A232 Lipoyltransferase; lipoate-protein ligase B, lipoic aci 94.91
2ddz_A190 190AA long hypothetical protein; hexamer, structural ge 90.11
>1bia_A BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} SCOP: a.4.5.1 b.34.1.1 d.104.1.2 PDB: 1bib_A* 1hxd_A* 2ewn_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=407.24  Aligned_cols=236  Identities=28%  Similarity=0.421  Sum_probs=211.4

Q ss_pred             CCCCEEEEEEECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHCCCHHHHH
Q ss_conf             9997049998164856899999997399997899982446783679985316633-334132235322400021013779
Q gi|254780868|r   10 NPYSFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAI   88 (252)
Q Consensus        10 ~p~~~~i~~~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G-~l~~S~~~~~~~~~~~~~~l~~~~   88 (252)
                      ...++++++|+++||||++|++++.++ +++++|+|++||+||||+||+|+||+| +||||++++++.++..++.+++++
T Consensus        75 ~~~~~~i~~~~~idSTN~~a~~~~~~~-~~g~vviA~~QT~GRGR~GR~W~Sp~g~~l~~S~~l~~~~~~~~~~~lsl~~  153 (321)
T 1bia_A           75 QLDGGSVAVLPVIDSTNQYLLDRIGEL-KSGDACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVI  153 (321)
T ss_dssp             TCCSSCEEECSSBSCHHHHHHTTGGGC-CTTCEEEESCBTTC---------CCTTSEEEEEEEEEECC-CCCTHHHHHHH
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHCC-CCCCEEEECCCCCCCCCCCCEEECCCCCCEEEEEEECCCCCHHHHHHHHHHH
T ss_conf             357974999803682899999875068-9980999897688879998970689999889999826753644668889999


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCC--CCCCCCC-CCCCCCC
Q ss_conf             999999999744542102462146506710221122223323225832676521544444642--2336532-1002367
Q gi|254780868|r   89 AVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPV--DTPYPVT-SLQREGG  165 (252)
Q Consensus        89 ~~ai~~~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~--~~~~~~t-sL~~~~~  165 (252)
                      |+|++++++++..  .+++||||||||+++||+||||+|+....+...+++||||+|++..+.  +....++ ++.+.+.
T Consensus       154 ~~av~~al~~~~~--~~v~iKWPNDI~~~~kKi~GIL~E~~~~~~~~~~~viGiGiN~~~~~~~~~~~~~~~s~~~~~~~  231 (321)
T 1bia_A          154 GIVMAEVLRKLGA--DKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGI  231 (321)
T ss_dssp             HHHHHHHHHHTTC--TTCEEETTTEEEETTEEEEEEEEEEEC----CEEEEEEEEEECCC-----------CCCTTTTTC
T ss_pred             HHHHHHHHHHHCC--CEEEEECCCCHHHCCCCHHEEEEEEEECCCCEEEEEEEECCCCCCCCCCCCCCHHHHHHHHHHCC
T ss_conf             9999999998366--51676369733001101123433322035520379999765335677853310134577876276


Q ss_pred             CCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCCCCEEEEEECCEEEEEEEEEECCCCCEEEECCCCCEEEE
Q ss_conf             78978999877799999999873035564889999987523897799997993899999987698748999699989999
Q gi|254780868|r  166 CIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGIGDLITIKLSYGSILGRFVGVDDFGYLLLEEKKGCVRQI  245 (252)
Q Consensus       166 ~~~~~~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~gk~V~i~~~~~~~~G~~~gId~~G~L~i~~~~G~~~~i  245 (252)
                      .++++++++.++.++..++..|.+ .+|++++++|++++.++||.|++..+++.++|++.|||++|+|+|++ +|.++.+
T Consensus       232 ~~~r~~l~~~ll~~l~~~~~~~~~-~g~~~~~~~~~~~~~~~gk~V~v~~~~~~~~G~~~gId~~G~Liv~~-~g~~~~i  309 (321)
T 1bia_A          232 NLDRNTLAAMLIRELRAALELFEQ-EGLAPYLSRWEKLDNFINRPVKLIIGDKEIFGISRGIDKQGALLLEQ-DGIIKPW  309 (321)
T ss_dssp             CCCHHHHHHHHHHHHHHHHHHHHH-HTTGGGHHHHHHHBTTTTSEEEEEETTEEEEEEEEEECTTSCEEEEE-TTEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHHHCCCCCEEEEEECCEEEEEEEEEECCCCEEEEEE-CCEEEEE
T ss_conf             547677999999999999999986-59699999999863324986999979979999999999898599999-9909999


Q ss_pred             EEEEE
Q ss_conf             96311
Q gi|254780868|r  246 FTGDI  250 (252)
Q Consensus       246 ~sGeI  250 (252)
                      ++|||
T Consensus       310 ~sGeV  314 (321)
T 1bia_A          310 MGGEI  314 (321)
T ss_dssp             SSCEE
T ss_pred             EEEEE
T ss_conf             97799



>2cgh_A Biotin ligase; 1.8A {Mycobacterium tuberculosis} PDB: 3l1a_A 3l2z_A Back     alignment and structure
>2eay_A Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>2dxu_A Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>2ej9_A Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bfm_A Biotin protein ligase-like protein of unknown function; YP_612389.1, structural genomics, joint center for structural genomics, JCSG; HET: 2PE; 1.70A {Silicibacter SP} Back     alignment and structure
>3a7r_A Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A* Back     alignment and structure
>2e5a_A Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus} PDB: 3a7u_A Back     alignment and structure
>2p0l_A Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, structural genomics, protein structure initiative, PSI-2; 2.04A {Streptococcus agalactiae COH1} SCOP: d.104.1.3 Back     alignment and structure
>2p5i_A BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125} SCOP: d.104.1.3 Back     alignment and structure
>1vqz_A Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4} SCOP: d.224.1.3 d.104.1.3 Back     alignment and structure
>2qhs_A Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_A Back     alignment and structure
>2c8m_A Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum} SCOP: d.104.1.3 PDB: 2art_A* 2aru_A* 2c7i_A 2ars_A* Back     alignment and structure
>1w66_A Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis} SCOP: d.104.1.3 Back     alignment and structure
>2ddz_A 190AA long hypothetical protein; hexamer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.24A {Pyrococcus horikoshii OT3} SCOP: d.104.1.4 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 252 birA bifunctional protein [Candidatus Liberibacter asia
d2zgwa2188 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] li 1e-20
d1biaa3207 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme 1e-16
>d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 188 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Biotin holoenzyme synthetase
domain: Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]
 Score = 93.7 bits (232), Expect = 1e-20
 Identities = 60/188 (31%), Positives = 92/188 (48%), Gaps = 17/188 (9%)

Query: 15  RYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLID 74
           R  +F  I+STN+      L        IVA  QT G G  + KW S +G L+ S++L  
Sbjct: 12  RVIYFQEITSTNEFAKTSYLEE---GTVIVADKQTMGHGALNRKWESPEGGLWLSIVLSP 68

Query: 75  SISKDSLTLLSFAIAVAMRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNG 134
            + +  L  + F  AV +   +        D +IKWPND+LV  + IAG+L+E       
Sbjct: 69  KVPQKDLPKIVFLGAVGVVETLKEFSI---DGRIKWPNDVLVNYKAIAGVLVEGKG---- 121

Query: 135 LQAVVVGIGLNVKHCPVDTPYPVTSLQREGGC-IDLKDIFSLLFQDVARVLDLWKKDTGR 193
              +V+GIGLNV +     P   TS++ E G  + L  +F  L  ++ R+   + K+   
Sbjct: 122 -DKIVLGIGLNVNN---KVPNGATSMKLELGSEVPLLSVFRSLITNLDRLYLNFLKNP-- 175

Query: 194 EEIMNLWR 201
            +I+NL R
Sbjct: 176 MDILNLVR 183


>d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} Length = 207 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target252 birA bifunctional protein [Candidatus Liberibacter asia
d1biaa3207 Biotin repressor/biotin holoenzyme synthetase, catalyti 100.0
d2zgwa2188 Biotin--[acetyl-CoA-carboxylase] ligase catalytic domai 100.0
d1biaa247 Biotin repressor/biotin holoenzyme synthetase, C-termin 98.53
d2zgwa147 Biotin--[acetyl-CoA-carboxylase] ligase C-terminal doma 97.31
d2p0la1269 Lipoate-protein ligase A {Streptococcus agalactiae [Tax 97.29
d1vqza2241 LplA-like protein SP1160, N-terminal domain {Streptococ 97.26
d2p5ia1265 Hypothetical protein BH3822 {Bacillus halodurans [TaxId 96.78
d1x2ga2246 Two-domain LplA, N-terminal domain {Escherichia coli [T 96.46
d2c8ma1256 Lipoate-protein ligase A {Thermoplasma acidophilum [Tax 95.98
d1w66a1216 Lipoyltransferase LipB {Mycobacterium tuberculosis [Tax 95.2
d2ddza1188 Uncharacterized protein PH0223 {Pyrococcus horikoshii [ 91.25
>d1biaa3 d.104.1.2 (A:64-270) Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Class II aaRS and biotin synthetases
superfamily: Class II aaRS and biotin synthetases
family: Biotin holoenzyme synthetase
domain: Biotin repressor/biotin holoenzyme synthetase, catalytic (central) domain
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=0  Score=337.63  Aligned_cols=188  Identities=28%  Similarity=0.435  Sum_probs=166.8

Q ss_pred             CEEEEEEECCCCHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCCCCCCCCCC-CCCCCCCCCCCCCCHHCCCHHHHHHHH
Q ss_conf             7049998164856899999997399997899982446783679985316633-334132235322400021013779999
Q gi|254780868|r   13 SFRYEFFDTISSTNDECMKRALSGDLGNLWIVASCQTAGRGRRDNKWISDKG-NLYASLLLIDSISKDSLTLLSFAIAVA   91 (252)
Q Consensus        13 ~~~i~~~~~~~STn~~~~~~~~~~~~~~~~v~A~~Qt~GrGr~gr~W~s~~G-~l~~S~~~~~~~~~~~~~~l~~~~~~a   91 (252)
                      ++++.+||++||||+++++++.+. +++++|+|++||+||||+||.|+||+| +||+|++++++.+....+.+++++|+|
T Consensus        15 ~~~i~~~~~i~STn~~~~~~~~~~-~~~~vv~A~~QT~GrGR~gr~W~S~~G~~l~~S~~~~~~~~~~~~~~l~~~~~la   93 (207)
T d1biaa3          15 GGSVAVLPVIDSTNQYLLDRIGEL-KSGDACIAEYQQAGRGRRGRKWFSPFGANLYLSMFWRLEQGPAAAIGLSLVIGIV   93 (207)
T ss_dssp             SSCEEECSSBSCHHHHHHTTGGGC-CTTCEEEESCBTTC---------CCTTSEEEEEEEEEECC-CCCTHHHHHHHHHH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHCC-CCCCEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             985899802484999999861437-9984999893456788699824466566654122100246704431034577888


Q ss_pred             HHHHHHHHCCCCCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCC--CC-CCCCCCCCCCCCCC
Q ss_conf             9999997445421024621465067102211222233232258326765215444446422--33-65321002367789
Q gi|254780868|r   92 MRSVIASTLPVGTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVD--TP-YPVTSLQREGGCID  168 (252)
Q Consensus        92 i~~~l~~~~~~~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~~--~~-~~~tsL~~~~~~~~  168 (252)
                      ++++++.+.  +.++++|||||||+++||+||||+|+....+...++|||||||++..+.+  .+ .+++++.+.+..++
T Consensus        94 v~~~l~~~~--~~~~~iKWPNDIl~~~kKi~GIL~E~~~~~~~~~~vviGiGiNv~~~~~~~~~~~~~~s~l~~~~~~i~  171 (207)
T d1biaa3          94 MAEVLRKLG--ADKVRVKWPNDLYLQDRKLAGILVELTGKTGDAAQIVIGAGINMAMRRVEESVVNQGWITLQEAGINLD  171 (207)
T ss_dssp             HHHHHHHTT--CTTCEEETTTEEEETTEEEEEEEEEEEC----CEEEEEEEEEECCC-----------CCCTTTTTCCCC
T ss_pred             HHHHHHHCC--CCEEEEEECHHHHCCCCCCCCCEEEEEECCCCCCEEEEECCCCCCCCCCCCCCCCCHHHHHHHHCCCCC
T ss_conf             888876314--530335533155458875104147777516872113541033323688860001012578998689999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHH
Q ss_conf             789998777999999998730355648899999875
Q gi|254780868|r  169 LKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFA  204 (252)
Q Consensus       169 ~~~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~  204 (252)
                      ++++++.++.++..+++.|.+ .+|++++++|++++
T Consensus       172 ~~~l~~~ll~~l~~~l~~~~~-~gf~~~~~~w~~~D  206 (207)
T d1biaa3         172 RNTLAAMLIRELRAALELFEQ-EGLAPYLSRWEKLD  206 (207)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHH-HTTGGGHHHHHHHB
T ss_pred             HHHHHHHHHHHHHHHHHHHHH-CCHHHHHHHHHHHC
T ss_conf             999999999999999999997-39899999999743



>d2zgwa2 d.104.1.2 (A:1-188) Biotin--[acetyl-CoA-carboxylase] ligase catalytic domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1biaa2 b.34.1.1 (A:271-317) Biotin repressor/biotin holoenzyme synthetase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2zgwa1 b.34.1.1 (A:189-235) Biotin--[acetyl-CoA-carboxylase] ligase C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2p0la1 d.104.1.3 (A:4-272) Lipoate-protein ligase A {Streptococcus agalactiae [TaxId: 1311]} Back     information, alignment and structure
>d1vqza2 d.104.1.3 (A:1-241) LplA-like protein SP1160, N-terminal domain {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2p5ia1 d.104.1.3 (A:14-278) Hypothetical protein BH3822 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1x2ga2 d.104.1.3 (A:1-246) Two-domain LplA, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c8ma1 d.104.1.3 (A:1-256) Lipoate-protein ligase A {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1w66a1 d.104.1.3 (A:1-216) Lipoyltransferase LipB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ddza1 d.104.1.4 (A:3-190) Uncharacterized protein PH0223 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 252 birA bifunctional protein [Candidatus Liberibacter
2cgh_A_1-221221 (A:1-221) Biotin ligase; 1.8A {Mycobacterium tuber 2e-36
1bia_A_65-271207 (A:65-271) BIRA bifunctional protein; transcriptio 2e-36
3bfm_A_1-191191 (A:1-191) Biotin protein ligase-like protein of un 1e-35
2eay_A_1-185185 (A:1-185) Biotin [acetyl-COA-carboxylase] ligase; 2e-33
2ej9_A_1-191191 (A:1-191) Putative biotin ligase; biotin biosynthe 1e-29
2dxu_A_1-187187 (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; 8e-28
2qhs_A_237 (A:) Lipoyltransferase; globular protein; HET: OCA 4e-17
1w66_A_232 (A:) Lipoyltransferase; lipoate-protein ligase B, 1e-10
1vqz_A_1-49_92-251209 (A:1-49,A:92-251) Lipoate-protein ligase, putative 7e-04
>2cgh_A (A:1-221) Biotin ligase; 1.8A {Mycobacterium tuberculosis}Length = 221 Back     alignment and structure
 Score =  147 bits (371), Expect = 2e-36
 Identities = 53/204 (25%), Positives = 85/204 (41%), Gaps = 12/204 (5%)

Query: 9   QNPYSFRYEFFDTISSTNDECMKRALSGDL-GNLWIVASCQTAGRGRRDNKWISDKGNLY 67
                 + +      STN + + RA SG     + ++A  QTAGRGR    W +      
Sbjct: 25  AGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQI 84

Query: 68  ASLLLI--DSISKDSLTLLSFAIAVAMRSVIASTLPV-GTDVKIKWPNDILVFQRKIAGI 124
              + +    +   +   LS A  +A+   +A  + V   +  +KWPND+L    K+AGI
Sbjct: 85  ILSVGVRVVDVPVQAWGWLSLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGI 144

Query: 125 LIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQREGG-CIDLKDIFSLLFQDVARV 183
           L E          VV+G+GLNV   P +     TSL   G    D   I S L +++   
Sbjct: 145 LAEVAQ-----PFVVLGVGLNVTQAPEEVDPDATSLLDLGVAAPDRNRIASRLLRELEAR 199

Query: 184 LDLWKKDTGREEIMNLWRCFACGI 207
           +  W+      ++   +R  +  I
Sbjct: 200 IIQWRN--ANPQLAADYRARSLTI 221


>1bia_A (A:65-271) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli}Length = 207 Back     alignment and structure
>3bfm_A (A:1-191) Biotin protein ligase-like protein of unknown function; YP_612389.1, structural genomics, joint center for structural genomics, JCSG; HET: 2PE; 1.70A {Silicibacter SP}Length = 191 Back     alignment and structure
>2eay_A (A:1-185) Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A*Length = 185 Back     alignment and structure
>2ej9_A (A:1-191) Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii}Length = 191 Back     alignment and structure
>2dxu_A (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ...Length = 187 Back     alignment and structure
>2qhs_A (A:) Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_ALength = 237 Back     alignment and structure
>1w66_A (A:) Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis}Length = 232 Back     alignment and structure
>1vqz_A (A:1-49,A:92-251) Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4}Length = 209 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target252 birA bifunctional protein [Candidatus Liberibacter asia
2cgh_A_1-221221 Biotin ligase; 1.8A {Mycobacterium tuberculosis} ( 100.0
1bia_A_65-271207 BIRA bifunctional protein; transcription regulatio 100.0
2eay_A_1-185185 Biotin [acetyl-COA-carboxylase] ligase; biotin bio 100.0
3bfm_A_1-191191 Biotin protein ligase-like protein of unknown func 100.0
2ej9_A_1-191191 Putative biotin ligase; biotin biosynthesis, monom 100.0
2dxu_A_1-187187 Biotin--[acetyl-COA-carboxylase] ligase; biotin bi 100.0
1w66_A_232 Lipoyltransferase; lipoate-protein ligase B, lipoi 99.41
3a7r_A_1-244244 Lipoate-protein ligase A; adenylate-forming enzyme 97.97
2e5a_A_1-246246 Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 97.54
2qhs_A_237 Lipoyltransferase; globular protein; HET: OCA; 1.5 99.86
1vqz_A_1-49_92-251209 Lipoate-protein ligase, putative; NP_345629.1, str 98.8
2p0l_A_288 Lipoate-protein ligase A; PFAM, lopoate-protein li 97.09
2p5i_A_288 BH3822 protein; PFAM03099, structural genomics, PS 96.99
2c8m_A_262 Lipoate-protein ligase A; lipoylation; HET: LPA; 1 96.98
2ddz_A_190 190AA long hypothetical protein; hexamer, structur 92.1
1bia_A_272-32150 BIRA bifunctional protein; transcription regulatio 98.47
2dxu_A_188-23548 Biotin--[acetyl-COA-carboxylase] ligase; biotin bi 98.46
2cgh_A_222-26847 Biotin ligase; 1.8A {Mycobacterium tuberculosis} ( 97.79
2eay_A_186-23348 Biotin [acetyl-COA-carboxylase] ligase; biotin bio 94.26
2ej9_A_192-23746 Putative biotin ligase; biotin biosynthesis, monom 93.67
>2cgh_A (A:1-221) Biotin ligase; 1.8A {Mycobacterium tuberculosis} Back     alignment and structure
Probab=100.00  E-value=0  Score=334.83  Aligned_cols=193  Identities=27%  Similarity=0.395  Sum_probs=173.5

Q ss_pred             CCCCCCEEEEEEECCCCHHHHHHHHHHCCC-CCCEEEEECCCCCCCCCCCCCCCCCCCCCCCCCCCC-C-CCCCHHCCCH
Q ss_conf             179997049998164856899999997399-997899982446783679985316633334132235-3-2240002101
Q gi|254780868|r    8 CQNPYSFRYEFFDTISSTNDECMKRALSGD-LGNLWIVASCQTAGRGRRDNKWISDKGNLYASLLLI-D-SISKDSLTLL   84 (252)
Q Consensus         8 ~~~p~~~~i~~~~~~~STn~~~~~~~~~~~-~~~~~v~A~~Qt~GrGr~gr~W~s~~G~l~~S~~~~-~-~~~~~~~~~l   84 (252)
                      -..+.+++++||++++|||++|++++.++. +++++|+|++||+||||+||.|+||+|++++|+++. + ..+....+.+
T Consensus        24 ~~~~~~~~i~~~~~~~STn~~~~~~~~~~~~~~~~vv~A~~QT~GrGr~gr~W~Sp~g~~~~s~~~~~~~~~~~~~~~~l  103 (221)
T 2cgh_A           24 GAGSGWRQLDVVAQTGSTNADLLARAASGADIDGVVLIAEHQTAGRGRHGRGWAATARAQIILSVGVRVVDVPVQAWGWL  103 (221)
T ss_dssp             STTCSBCEEEEESCBSCHHHHHHHHHHTTCCCBTEEEEESCBC------------CTTSEEEEEEEEECTTSCGGGTTHH
T ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHHCCCCCCCEEEEECCCCCCCCCCCCEEECCCCCCEEEEEECCCCCCCHHHHHHH
T ss_conf             13688614899955745999999998668998987999892146888089901789999789853102466755664221


Q ss_pred             HHHHHHHHHHHHHHHCCC-CCEEEEEECCCEEEECCCCCCCCCCCCCCCCCCEEEEEECCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             377999999999974454-2102462146506710221122223323225832676521544444642233653210023
Q gi|254780868|r   85 SFAIAVAMRSVIASTLPV-GTDVKIKWPNDILVFQRKIAGILIETLNLKNGLQAVVVGIGLNVKHCPVDTPYPVTSLQRE  163 (252)
Q Consensus        85 ~~~~~~ai~~~l~~~~~~-~~~~~iKWPNDi~~~~kKi~GIL~E~~~~~~~~~~~viGiGiNi~~~~~~~~~~~tsL~~~  163 (252)
                      ++++|++++++++++.+. +.+++||||||||+++||+||||+|+..     .++|||||||+++.|++.+..+|||+++
T Consensus       104 s~~~~lav~~al~~~~~~~~~~~~iKWPNDI~v~~kKi~GIL~E~~~-----~~~viGiGiNv~~~~~~~~~~atsL~~~  178 (221)
T 2cgh_A          104 SLAAGLAVLDSVAPLIAVPPAETGLKWPNDVLARGGKLAGILAEVAQ-----PFVVLGVGLNVTQAPEEVDPDATSLLDL  178 (221)
T ss_dssp             HHHHHHHHHHHHGGGSSSCGGGEEEETTTEEEETTEEEEEEEEEEET-----TEEEEEEEEESCCC--------CCTGGG
T ss_pred             HHHHHHHHHHHHHHHCCCCCEEEEEEECCCEEEECCCEEEEEEEECC-----CEEEEEECCCCCCCCHHHHCCHHHHCCC
T ss_conf             17889999988642013521048986325416630130577443011-----1489982344555852320110000124


Q ss_pred             -CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHCC
Q ss_conf             -67789789998777999999998730355648899999875238
Q gi|254780868|r  164 -GGCIDLKDIFSLLFQDVARVLDLWKKDTGREEIMNLWRCFACGI  207 (252)
Q Consensus       164 -~~~~~~~~l~~~l~~~l~~~~~~~~~~~~~~~i~~~~~~~~~~~  207 (252)
                       +..++++++++.++.++...+..|.+  +|+.++++|++++.++
T Consensus       179 ~~~~~~~~~l~~~l~~~l~~~~~~~~~--g~~~~~~~~~~~~~~l  221 (221)
T 2cgh_A          179 GVAAPDRNRIASRLLRELEARIIQWRN--ANPQLAADYRARSLTI  221 (221)
T ss_dssp             TCSSCCHHHHHHHHHHHHHHHHHHHHT--TCHHHHHHHHHTBSST
T ss_pred             CCCCCCHHHHHHHHHHHHHHHHHHHHH--CCCHHHHHHHHHHHHC
T ss_conf             444444257899988999999999751--3413599999988667



>1bia_A (A:65-271) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} Back     alignment and structure
>2eay_A (A:1-185) Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>3bfm_A (A:1-191) Biotin protein ligase-like protein of unknown function; YP_612389.1, structural genomics, joint center for structural genomics, JCSG; HET: 2PE; 1.70A {Silicibacter SP} Back     alignment and structure
>2ej9_A (A:1-191) Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dxu_A (A:1-187) Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>1w66_A (A:) Lipoyltransferase; lipoate-protein ligase B, lipoic acid, acyltransferase, mycobacterium tuberculosis structural proteomics project; HET: DKA; 1.08A {Mycobacterium tuberculosis} Back     alignment and structure
>3a7r_A (A:1-244) Lipoate-protein ligase A; adenylate-forming enzyme, lipoic acid, ATP-binding, cytoplasm, nucleotide-binding, transferase, lipoyl; HET: LAQ; 2.05A {Escherichia coli} PDB: 1x2h_A* 3a7a_A* 1x2g_A* Back     alignment and structure
>2e5a_A (A:1-246) Lipoyltransferase 1; lipoyl-AMP, ligase; HET: LAQ; 2.10A {Bos taurus} Back     alignment and structure
>2qhs_A (A:) Lipoyltransferase; globular protein; HET: OCA; 1.50A {Thermus thermophilus HB8} PDB: 2qht_A 2qhu_A 2qhv_A Back     alignment and structure
>1vqz_A (A:1-49,A:92-251) Lipoate-protein ligase, putative; NP_345629.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.99A {Streptococcus pneumoniae TIGR4} Back     alignment and structure
>2p0l_A (A:) Lipoate-protein ligase A; PFAM, lopoate-protein ligase A, structural genomics, protein structure initiative, PSI-2; 2.04A {Streptococcus agalactiae COH1} Back     alignment and structure
>2p5i_A (A:) BH3822 protein; PFAM03099, structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 2.21A {Bacillus halodurans c-125} Back     alignment and structure
>2c8m_A (A:) Lipoate-protein ligase A; lipoylation; HET: LPA; 1.89A {Thermoplasma acidophilum} Back     alignment and structure
>2ddz_A (A:) 190AA long hypothetical protein; hexamer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.24A {Pyrococcus horikoshii OT3} Back     alignment and structure
>1bia_A (A:272-321) BIRA bifunctional protein; transcription regulation; 2.30A {Escherichia coli} Back     alignment and structure
>2dxu_A (A:188-235) Biotin--[acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; HET: BT5; 1.28A {Pyrococcus horikoshii} PDB: 2dzc_A 2ejg_A* 2e3y_A* 2e41_A* 2e64_A 2ejf_A* 2zgw_A* 1wqw_A* 1wpy_A* 1wq7_A 1wnl_A* 1x01_A* 2dkg_A* 2dth_A* 2dti_A* 2dto_A* 2fyk_A* 2djz_A* 2hni_A 2e10_A ... Back     alignment and structure
>2cgh_A (A:222-268) Biotin ligase; 1.8A {Mycobacterium tuberculosis} Back     alignment and structure
>2eay_A (A:186-233) Biotin [acetyl-COA-carboxylase] ligase; biotin biosynthesis, dimer, X-RAY diffraction, structural genomics, NPPSFA; 1.95A {Aquifex aeolicus} PDB: 3efs_A* 3fjp_A 3efr_A* Back     alignment and structure
>2ej9_A (A:192-237) Putative biotin ligase; biotin biosynthesis, monomer, X-RAY diffraction, structural genomics, NPPSFA; HET: BTN; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure