254780870

254780870

prolyl-tRNA synthetase

GeneID in NCBI database:8209885Locus tag:CLIBASIA_03825
Protein GI in NCBI database:254780870Protein Accession:YP_003065283.1
Gene range:+(839736, 841085)Protein Length:449aa
Gene description:prolyl-tRNA synthetase
COG prediction:none
KEGG prediction:proS; prolyl-tRNA synthetase (EC:6.1.1.15); K01881 prolyl-tRNA synthetase [EC:6.1.1.15]
SEED prediction:Prolyl-tRNA synthetase (EC 6.1.1.15), Bacterial type
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Pro
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNNRPVL
ccccHHHHHHHHHHHHccHHccHHHHHHHHHHHHHccccEEEcccHHHHHHHHHHHHHHHHHHcccEEEEcccEEcHHHHHHcccccccccccEEEEcccccEEEEccccHHHHHHHHHHHHHcHHHccEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEEccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccHHHHHHHHcccccHHHHccccHHHHHccccHHHHHccccccccccccccccHHHHHcccHHHHHHccccccccEEEEEEccccccccHHHHHHccEEEcccccEEEEEEEEEcccHHHHHHHHHHHHccccccccccccccEEEEEEEcccccHHHHHHHHHHHHHHHHcccEEEEEcccccHHHHHHHHHHccccEEEEEcHHHHHccEEEEEEcccccEEEEcHHHHHHHHHHHHHHccccc
cccHHcHHHHHcccHHHHHHHHHHHHHHHHHHHHHccccccccHcHHHHHHHHHHHHHHHHHHccccEccccccccHHHHHHccccHHHHHHHHHcccccccHHcccccccHHHHHHHHcccccccccccHHHHHcccccccccccccEEEEHHEcccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccHHHHHHHHHcHHHHHHHccccccccccccccccccHHHHHHcccccccccccHccccHHHHHcccHHHcccccEEEEEEEEEcccccccccccEEEccccccccEEEEEEEEcHHHHHHHHHHHHccccccEcccccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccEEEEcccccccccEEEEEccccccEEEEEccHHHHccEEEEEEccccccccccHHHHHHHHHHHHHcccccc
mrrskyflpilqenprdaeIASHKLMLRTGmihqhskgiyswlplgqKALDNVNAIIREEQnrtgaiemsvptlqsadlwvesgrydsygKEMLRLADrndkamiygptheEVMTDIFRSHIksyrnlpftFYQIQLKFRDelrprfgvmrsrEFLMkdaysfdltpegskhsyNKMFVSYLRIFHRLglksipmraesgpiggdlsHEFIVLAdtgetqvfcskdfmdfpipsentdfddiisLNSIveqwtapyaatsdvhneklfdslpenkrvsargievGHIFYFgtkyslpmsatfkgadgkdhyvqMGSYGIGAMRVVAAVIEsshdgkgiiwpdsvapFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIvgskfvsdskVEIKHRLTGIREDMSLEEVINYAShrfsnnrpvl
mrrskyflpilqenprdaEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQnrtgaiemsvptlqsadlwVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFdltpegskhsYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVgskfvsdskveikhrltgiredmslEEVINyashrfsnnrpvl
MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNNRPVL
*RRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNN****
MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNNRPVL
*RRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSN*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNNRPVL
MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNNRPVL
MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFDDIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQVCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKHRLTGIREDMSLEEVINYASHRFSNNRPVL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target449 prolyl-tRNA synthetase [Candidatus Liberibacter asiatic
254781004652 threonyl-tRNA synthetase [Candidatus Liberibacter 1e-07
254780680430 seryl-tRNA synthetase [Candidatus Liberibacter asi 0.005
>gi|254781004|ref|YP_003065417.1| threonyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 652 Back     alignment
 Score = 49.3 bits (116), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 76/183 (41%), Gaps = 11/183 (6%)

Query: 32  IHQHSKGIYSWLPLGQKALDNVNAIIREEQNRTGAIEMSVPTLQSADLWVESGRYDSYGK 91
           I +   G+  W   G K    + + +R  + +    E++ P +    LW +SG +DSY  
Sbjct: 258 IAEDGSGVIFWHRKGWKIFQTLISYMRR-KIKDDYEEINTPQVLDQHLWQQSGHWDSYRA 316

Query: 92  EMLRLADRND-----KAMIYGPTHEEVMTDIFRSHIKSYRNLPFTFYQIQLKFRDELRPR 146
            M  +   +D     +     P +      +F   +KSYR LP    +    +R+E    
Sbjct: 317 NMFAVKCADDTIKDLRTFALKPMNCPGHVAVFNHGLKSYRELPVRLAEFGSVYRNEPSGS 376

Query: 147 F-GVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVSYLRIFHRLGLKSIPMRAESGP---I 202
             G+MR R F   DA+ F  T E   +   K+    + I+   G + I ++  + P   +
Sbjct: 377 LHGLMRVRGFTQDDAHVF-CTKEQMFNECLKIHNLIISIYKDFGFEKIMVKLSTRPEKRV 435

Query: 203 GGD 205
           G D
Sbjct: 436 GSD 438

>gi|254780680|ref|YP_003065093.1| seryl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 430 Back     alignment
 Score = 33.9 bits (76), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 58/143 (40%), Gaps = 9/143 (6%)

Query: 65  GAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRSHIKS 124
           G  E+S P L   +    +G+   +  +M    D   + +I  PT E  +T+++   I  
Sbjct: 191 GYTEVSAPLLVRDEAMYGTGQIPKFADDMFCTTD--GRWLI--PTSEVSLTNLYSHEIIE 246

Query: 125 YRNLPFTFYQIQLKFRDEL----RPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVS 180
            ++LP  F  +   FR E     R   G++R  +F   +  S     E S   + +M   
Sbjct: 247 SKSLPLRFTTLAPSFRSEAGSAGRDTRGMLRQHQFWKCELVSIT-REEDSFTEHERMLSC 305

Query: 181 YLRIFHRLGLKSIPMRAESGPIG 203
              I  RL L    +   +G +G
Sbjct: 306 AEEILKRLDLHYRVVSLCTGDLG 328

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target449 prolyl-tRNA synthetase [Candidatus Liberibacter asiatic
315122709453 prolyl-tRNA synthetase [Candidatus Liberibacter solanac 1 0.0
327194827440 prolyl-tRNA synthetase protein [Rhizobium etli CNPAF512 1 0.0
190891305440 prolyl-tRNA synthetase [Rhizobium etli CIAT 652] Length 1 0.0
162329642440 prolyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 1 0.0
241204106440 prolyl-tRNA synthetase [Rhizobium leguminosarum bv. tri 1 0.0
218463078440 prolyl-tRNA synthetase [Rhizobium etli Kim 5] Length = 1 0.0
116251485440 prolyl-tRNA synthetase [Rhizobium leguminosarum bv. vic 1 0.0
222085595475 prolyl-tRNA synthetase protein [Agrobacterium radiobact 1 1e-180
209548882440 prolyl-tRNA synthetase [Rhizobium leguminosarum bv. tri 1 1e-180
150396141442 prolyl-tRNA synthetase [Sinorhizobium medicae WSM419] L 1 1e-177
>gi|315122709|ref|YP_004063198.1| prolyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 453 Back     alignment and organism information
 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/442 (80%), Positives = 398/442 (90%)

Query: 1   MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREE 60
           M+RSKYFLP +QENP+DAEI SHK+MLRTGMI QHSKG+YSWLPLG KAL  VNAIIREE
Sbjct: 1   MKRSKYFLPAMQENPKDAEIISHKMMLRTGMISQHSKGMYSWLPLGNKALSKVNAIIREE 60

Query: 61  QNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRS 120
           Q+R GA+EMS PTLQSADLW+ESGRY+SYGKEMLR+ DRNDK+M+YGPT+EE+MTDIFRS
Sbjct: 61  QDRIGALEMSNPTLQSADLWIESGRYESYGKEMLRIVDRNDKSMLYGPTNEEMMTDIFRS 120

Query: 121 HIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVS 180
           H+KSYR+LP   YQ+QLKFRDELRPRFG MRSREFLMKDAYSFDLT E S HSYNKMFVS
Sbjct: 121 HVKSYRDLPLILYQMQLKFRDELRPRFGTMRSREFLMKDAYSFDLTFEDSVHSYNKMFVS 180

Query: 181 YLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFD 240
           YLRIFHRLGLKSIPMRAESGPIGG LSHEFIVL++TGETQ+FCSKDFM+FPIPSENTDFD
Sbjct: 181 YLRIFHRLGLKSIPMRAESGPIGGSLSHEFIVLSNTGETQLFCSKDFMNFPIPSENTDFD 240

Query: 241 DIISLNSIVEQWTAPYAATSDVHNEKLFDSLPENKRVSARGIEVGHIFYFGTKYSLPMSA 300
           DI+SL  IV QWT PYAATSDVHNEKLF SL E  R+ ARGIEVGHIF+FGTKYS PMSA
Sbjct: 241 DIVSLKDIVRQWTTPYAATSDVHNEKLFHSLSEEDRIVARGIEVGHIFHFGTKYSHPMSA 300

Query: 301 TFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQV 360
           TF+GADGK HYVQMGSYGIG MRVVAA+IESSHD +GIIWPDSV+PF ISLIN+K HDQ 
Sbjct: 301 TFQGADGKKHYVQMGSYGIGPMRVVAAIIESSHDAQGIIWPDSVSPFHISLINLKIHDQA 360

Query: 361 CRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIKH 420
           C  A +KIY +LS+ GCDVF DD+ EQ GS+FA+ADLLGFPLQ+I+GSKF+SDSKVEIK+
Sbjct: 361 CCSASDKIYTQLSQAGCDVFLDDVDEQAGSKFALADLLGFPLQIIIGSKFISDSKVEIKN 420

Query: 421 RLTGIREDMSLEEVINYASHRF 442
           R TG +E MSLEEV+NYAS+RF
Sbjct: 421 RSTGTKEYMSLEEVVNYASNRF 442


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|327194827|gb|EGE61661.1| prolyl-tRNA synthetase protein [Rhizobium etli CNPAF512] Length = 440 Back     alignment and organism information
>gi|190891305|ref|YP_001977847.1| prolyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 440 Back     alignment and organism information
>gi|162329642|ref|YP_469149.2| prolyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 440 Back     alignment and organism information
>gi|241204106|ref|YP_002975202.1| prolyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 440 Back     alignment and organism information
>gi|218463078|ref|ZP_03503169.1| prolyl-tRNA synthetase [Rhizobium etli Kim 5] Length = 440 Back     alignment and organism information
>gi|116251485|ref|YP_767323.1| prolyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 440 Back     alignment and organism information
>gi|222085595|ref|YP_002544125.1| prolyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 475 Back     alignment and organism information
>gi|209548882|ref|YP_002280799.1| prolyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 440 Back     alignment and organism information
>gi|150396141|ref|YP_001326608.1| prolyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 442 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target449 prolyl-tRNA synthetase [Candidatus Liberibacter asiatic
PRK12325439 PRK12325, PRK12325, prolyl-tRNA synthetase; Provisional 0.0
KOG2324457 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Tran 7e-84
COG0441589 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, r 1e-22
TIGR00418563 TIGR00418, thrS, threonyl-tRNA synthetase 7e-21
COG0442500 COG0442, ProS, Prolyl-tRNA synthetase [Translation, rib 1e-121
PRK09194 565 PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional 1e-107
TIGR00409 568 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family 1e-84
cd00771298 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) c 1e-12
cd00779255 cd00779, ProRS_core_prok, Prolyl-tRNA synthetase (ProRS 8e-91
cd00772264 cd00772, ProRS_core, Prolyl-tRNA synthetase (ProRS) cla 6e-34
PRK09194565 PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional 5e-56
TIGR00409568 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family 2e-39
TIGR00408472 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I 5e-16
PRK08661477 PRK08661, PRK08661, prolyl-tRNA synthetase; Provisional 1e-15
pfam00587170 pfam00587, tRNA-synt_2b, tRNA synthetase class II core 5e-39
cd00670235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_ 1e-16
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 2e-08
PRK14799545 PRK14799, thrS, threonyl-tRNA synthetase; Provisional 3e-07
COG0124429 COG0124, HisS, Histidyl-tRNA synthetase [Translation, r 5e-04
cd0086194 cd00861, ProRS_anticodon_short, ProRS Prolyl-anticodon 3e-22
pfam0312993 pfam03129, HGTP_anticodon, Anticodon binding domain 1e-14
cd0073894 cd00738, HGTP_anticodon, HGTP anticodon binding domain, 8e-11
cd00858121 cd00858, GlyRS_anticodon, GlyRS Glycyl-anticodon bindin 2e-05
COG0423558 COG0423, GRS1, Glycyl-tRNA synthetase (class II) [Trans 3e-05
cd0086091 cd00860, ThrRS_anticodon, ThrRS Threonyl-anticodon bind 3e-05
TIGR00389551 TIGR00389, glyS_dimeric, glycyl-tRNA synthetase, dimeri 2e-04
COG0124429 COG0124, HisS, Histidyl-tRNA synthetase [Translation, r 8e-04
cd0085991 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon bind 0.002
PRK00037412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 0.004
KOG4163551 KOG4163, KOG4163, KOG4163, Prolyl-tRNA synthetase [Tran 1e-12
cd00778261 cd00778, ProRS_core_arch_euk, Prolyl-tRNA synthetase (P 1e-11
KOG1637560 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Tr 9e-11
PRK08661477 PRK08661, PRK08661, prolyl-tRNA synthetase; Provisional 1e-08
PRK00413638 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed 3e-07
PRK12444639 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed 1e-06
PLN02908686 PLN02908, PLN02908, threonyl-tRNA synthetase 2e-06
PRK12305575 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed 9e-05
COG0423558 COG0423, GRS1, Glycyl-tRNA synthetase (class II) [Trans 7e-04
TIGR00408472 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I 4e-11
KOG2298599 KOG2298, KOG2298, KOG2298, Glycyl-tRNA synthetase and r 2e-09
cd00773261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synt 2e-04
PLN02837614 PLN02837, PLN02837, threonine-tRNA ligase 2e-04
PLN02734684 PLN02734, PLN02734, glycyl-tRNA synthetase 2e-04
TIGR00389551 TIGR00389, glyS_dimeric, glycyl-tRNA synthetase, dimeri 4e-04
KOG2298599 KOG2298, KOG2298, KOG2298, Glycyl-tRNA synthetase and r 0.001
cd00774254 cd00774, GlyRS-like_core, Glycyl-tRNA synthetase (GlyRS 0.002
>gnl|CDD|183440 PRK12325, PRK12325, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|37535 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|30790 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161870 TIGR00418, thrS, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|30791 COG0442, ProS, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181689 PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161864 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family II Back     alignment and domain information
>gnl|CDD|29816 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|73229 cd00779, ProRS_core_prok, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|58340 cd00772, ProRS_core, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|181689 PRK09194, PRK09194, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|161864 TIGR00409, proS_fam_II, prolyl-tRNA synthetase, family II Back     alignment and domain information
>gnl|CDD|161863 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I Back     alignment and domain information
>gnl|CDD|181528 PRK08661, PRK08661, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|144252 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|29810 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|184826 PRK14799, thrS, threonyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|30473 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29801 cd00861, ProRS_anticodon_short, ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria Back     alignment and domain information
>gnl|CDD|145985 pfam03129, HGTP_anticodon, Anticodon binding domain Back     alignment and domain information
>gnl|CDD|29797 cd00738, HGTP_anticodon, HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS) Back     alignment and domain information
>gnl|CDD|29798 cd00858, GlyRS_anticodon, GlyRS Glycyl-anticodon binding domain Back     alignment and domain information
>gnl|CDD|30772 COG0423, GRS1, Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29800 cd00860, ThrRS_anticodon, ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>gnl|CDD|161851 TIGR00389, glyS_dimeric, glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>gnl|CDD|30473 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29799 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>gnl|CDD|178812 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|39365 KOG4163, KOG4163, KOG4163, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29823 cd00778, ProRS_core_arch_euk, Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>gnl|CDD|36850 KOG1637, KOG1637, KOG1637, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|181528 PRK08661, PRK08661, prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|179011 PRK00413, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183530 PRK12444, PRK12444, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178496 PLN02908, PLN02908, threonyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183422 PRK12305, thrS, threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30772 COG0423, GRS1, Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161863 TIGR00408, proS_fam_I, prolyl-tRNA synthetase, family I Back     alignment and domain information
>gnl|CDD|37509 KOG2298, KOG2298, KOG2298, Glycyl-tRNA synthetase and related class II tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73226 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|178431 PLN02837, PLN02837, threonine-tRNA ligase Back     alignment and domain information
>gnl|CDD|178335 PLN02734, PLN02734, glycyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|161851 TIGR00389, glyS_dimeric, glycyl-tRNA synthetase, dimeric type Back     alignment and domain information
>gnl|CDD|37509 KOG2298, KOG2298, KOG2298, Glycyl-tRNA synthetase and related class II tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73227 cd00774, GlyRS-like_core, Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 449 prolyl-tRNA synthetase [Candidatus Liberibacter asiatic
PRK09194570 prolyl-tRNA synthetase; Provisional 100.0
PRK12325438 prolyl-tRNA synthetase; Provisional 100.0
TIGR00409620 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 100.0
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 100.0
PRK12444639 threonyl-tRNA synthetase; Reviewed 100.0
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 100.0
PRK04483634 threonyl-tRNA synthetase; Validated 100.0
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 100.0
PRK03772642 threonyl-tRNA synthetase; Validated 100.0
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 100.0
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 100.0
KOG2324457 consensus 100.0
PRK03991613 threonyl-tRNA synthetase; Validated 100.0
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 100.0
KOG1637560 consensus 100.0
PRK08661478 prolyl-tRNA synthetase; Provisional 100.0
TIGR00408 533 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 100.0
TIGR00389606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 100.0
PRK04173460 glycyl-tRNA synthetase; Provisional 100.0
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 100.0
KOG2298599 consensus 100.0
KOG4163551 consensus 100.0
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 100.0
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 100.0
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 100.0
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 100.0
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 100.0
PRK05431422 seryl-tRNA synthetase; Provisional 99.93
KOG2509455 consensus 99.74
PRK00960516 seryl-tRNA synthetase; Provisional 99.6
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 100.0
COG0124429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 100.0
CHL00201424 syh histidine-tRNA synthetase; Provisional 100.0
PRK12420421 histidyl-tRNA synthetase; Provisional 100.0
KOG1936518 consensus 100.0
TIGR00442446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 100.0
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 100.0
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 100.0
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 99.96
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 99.95
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 99.93
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 99.93
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 99.91
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 99.71
TIGR00414460 serS seryl-tRNA synthetase; InterPro: IPR002317 The ami 99.36
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 99.35
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 98.88
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 98.79
TIGR00443414 hisS_second histidyl-tRNA synthetase 2, putative; Inter 98.64
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 98.58
PRK07080318 hypothetical protein; Validated 98.54
TIGR00415520 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The 98.33
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 97.92
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 97.74
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 97.69
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 97.01
KOG0556533 consensus 96.42
KOG0555545 consensus 93.96
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 100.0
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 100.0
TIGR00470558 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR 95.74
cd00858121 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain. 99.95
cd0073894 HGTP_anticodon HGTP anticodon binding domain, as found 99.92
cd0086194 ProRS_anticodon_short ProRS Prolyl-anticodon binding do 99.9
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain 99.89
cd02426128 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DN 99.89
cd00862202 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding dom 99.88
pfam0312993 HGTP_anticodon Anticodon binding domain. This domain is 99.85
cd0085991 HisRS_anticodon HisRS Histidyl-anticodon binding domain 99.81
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 99.91
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 99.52
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 98.97
PRK12820 706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 98.96
PRK09350325 lysyl-tRNA synthetase; Provisional 98.93
TIGR00459 653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 98.83
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 98.75
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 98.73
PRK12445505 lysyl-tRNA synthetase; Reviewed 98.69
PRK06462332 asparagine synthetase A; Reviewed 98.62
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 98.61
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 98.6
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 98.59
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 98.57
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 98.57
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 98.52
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 98.49
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 98.43
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 98.14
KOG2411628 consensus 98.13
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 97.84
KOG1885560 consensus 97.79
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 97.79
KOG10351351 consensus 97.66
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 97.22
TIGR00471605 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; I 96.98
KOG0554446 consensus 96.94
TIGR00458466 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 96.64
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 96.35
TIGR00499538 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 Th 93.32
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 97.94
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 96.61
COG0072650 PheT Phenylalanyl-tRNA synthetase beta subunit [Transla 92.83
PRK09616546 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 96.22
PRK00629 786 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 93.19
KOG2784483 consensus 92.21
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1637 consensus Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2298 consensus Back     alignment and domain information
>KOG4163 consensus Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2509 consensus Back     alignment and domain information
>PRK00960 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1936 consensus Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase; InterPro: IPR002317 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00443 hisS_second histidyl-tRNA synthetase 2, putative; InterPro: IPR004517 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK07080 hypothetical protein; Validated Back     alignment and domain information
>TIGR00415 serS_MJ seryl-tRNA synthetase; InterPro: IPR004503 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0556 consensus Back     alignment and domain information
>KOG0555 consensus Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain Back     alignment and domain information
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS) Back     alignment and domain information
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>cd02426 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DNA polymerase gamma B subunit, which is required for processivity Back     alignment and domain information
>cd00862 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding domain, long version found predominantly in eukaryotes and archaea Back     alignment and domain information
>pfam03129 HGTP_anticodon Anticodon binding domain Back     alignment and domain information
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2411 consensus Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>KOG1035 consensus Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00471 pheT_arch phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004531 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0554 consensus Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>TIGR00499 lysS_bact lysyl-tRNA synthetase; InterPro: IPR002313 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>COG0072 PheT Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09616 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>KOG2784 consensus Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target449 prolyl-tRNA synthetase [Candidatus Liberibacter asiatic
2i4l_A458 Rhodopseudomonas Palustris Prolyl-Trna Synthetase L 1e-112
1qf6_A642 Structure Of E. Coli Threonyl-Trna Synthetase Compl 6e-67
1nyq_A645 Structure Of Staphylococcus Aureus Threonyl-Trna Sy 7e-65
1evk_A401 Crystal Structure Of A Truncated Form Of Threonyl-T 5e-64
1nj1_A501 Crystal Structure Of Prolyl-Trna Synthetase From Me 5e-39
1b76_A442 Glycyl-Trna Synthetase From Thermus Thermophilus Co 3e-24
1ati_A505 Crystal Structure Of Glycyl-Trna Synthetase From Th 1e-20
2j3l_A 572 Prolyl-Trna Synthetase From Enterococcus Faecalis C 2e-55
2j3l_A572 Prolyl-Trna Synthetase From Enterococcus Faecalis C 4e-34
1nj8_A459 Crystal Structure Of Prolyl-Trna Synthetase From Me 6e-37
1h4q_A477 Prolyl-Trna Synthetase From Thermus Thermophilus Co 2e-36
1h4t_B466 Prolyl-Trna Synthetase From Thermus Thermophilus Co 3e-34
3ial_A518 Giardia Lamblia Prolyl-Trna Synthetase In Complex W 3e-26
1qe0_A420 Crystal Structure Of Apo S. Aureus Histidyl-Trna Sy 1e-22
2el9_A431 Crystal Structure Of E.Coli Histidyl-Trna Synthetas 2e-18
1htt_A423 Histidyl-Trna Synthetase Length = 423 2e-18
1kmm_A424 Histidyl-Trna Synthetase Complexed With Histidyl-Ad 2e-18
1wu7_A434 Crystal Structure Of Histidyl-Trna Synthetase From 2e-11
1adj_A421 Histidyl-Trna Synthetase In Complex With Histidine 1e-09
3a32_A471 Crystal Structure Of Putative Threonyl-Trna Synthet 4e-19
3a31_A471 Crystal Structure Of Putative Threonyl-Trna Synthet 5e-18
2q5i_A691 Crystal Structure Of Apo S581l Glycyl-Trna Syntheta 4e-14
2q5h_A691 Crystal Structure Of Apo-Wildtype Glycyl-Trna Synth 5e-14
2pme_A693 The Apo Crystal Structure Of The Glycyl-Trna Synthe 6e-14
2pmf_A693 The Crystal Structure Of A Human Glycyl-Trna Synthe 2e-13
2q5i_A 691 Crystal Structure Of Apo S581l Glycyl-Trna Syntheta 0.001
2q5h_A 691 Crystal Structure Of Apo-Wildtype Glycyl-Trna Synth 0.001
2pme_A 693 The Apo Crystal Structure Of The Glycyl-Trna Synthe 0.001
2pmf_A 693 The Crystal Structure Of A Human Glycyl-Trna Synthe 0.001
3net_A465 Crystal Structure Of Histidyl-Trna Synthetase From 4e-11
2dq3_A425 Crystal Structure Of Aq_298 Length = 425 6e-08
>gi|118138193|pdb|2I4L|A Chain A, Rhodopseudomonas Palustris Prolyl-Trna Synthetase Length = 458 Back     alignment and structure
 Score =  408 bits (1048), Expect = e-112,   Method: Composition-based stats.
 Identities = 249/440 (56%), Positives = 335/440 (76%), Gaps = 3/440 (0%)

Query: 1   MRRSKYFLPILQENPRDAEIASHKLMLRTGMIHQHSKGIYSWLPLGQKALDNVNAIIREE 60
           MR S++FLPIL+ENP++AEI SH+LMLR GM+ Q + GIY+WLPLG + L  +  I+REE
Sbjct: 21  MRLSRFFLPILKENPKEAEIVSHRLMLRAGMLRQEAAGIYAWLPLGHRVLKKIEQIVREE 80

Query: 61  QNRTGAIEMSVPTLQSADLWVESGRYDSYGKEMLRLADRNDKAMIYGPTHEEVMTDIFRS 120
           QNR GAIE+ +PTLQ ADLW ESGRYD+YG EMLR+ADR+ + ++YGPT+EE++T+IFR+
Sbjct: 81  QNRAGAIELLMPTLQLADLWRESGRYDAYGPEMLRIADRHKRELLYGPTNEEMITEIFRA 140

Query: 121 HIKSYRNLPFTFYQIQLKFRDELRPRFGVMRSREFLMKDAYSFDLTPEGSKHSYNKMFVS 180
           +IKSY++LP   Y IQ KFRDE RPRFGVMR REFLMKDAYSFD+   G++ SYNKMFV+
Sbjct: 141 YIKSYKSLPLNLYHIQWKFRDEQRPRFGVMRGREFLMKDAYSFDVDEAGARKSYNKMFVA 200

Query: 181 YLRIFHRLGLKSIPMRAESGPIGGDLSHEFIVLADTGETQVFCSKDFMDFPIPSENTDFD 240
           YLR F R+GLK+IPMRAE+GPIGGDLSHEFIVLA+TGE+ V+  +D ++ P+P EN D+D
Sbjct: 201 YLRTFARMGLKAIPMRAETGPIGGDLSHEFIVLAETGESGVYIDRDVLNLPVPDENVDYD 260

Query: 241 DIISLNSIVEQWTAPYAATSDVHNEKLFDS-LPENKRVSARGIEVGHIFYFGTKYSLPMS 299
               L  I++QWT+ YAAT DVH    ++S +PE  R++ RGIEVG IFYFGTKYS  M 
Sbjct: 261 --GDLTPIIKQWTSVYAATEDVHEPARYESEVPEANRLNTRGIEVGQIFYFGTKYSDSMK 318

Query: 300 ATFKGADGKDHYVQMGSYGIGAMRVVAAVIESSHDGKGIIWPDSVAPFKISLINIKAHDQ 359
           A   G DG D  +  GSYG+G  R++ A+IE+ HD  GIIWP++VAPF+++++N+K  D 
Sbjct: 319 ANVTGPDGTDAPIHGGSYGVGVSRLLGAIIEACHDDNGIIWPEAVAPFRVTILNLKQGDA 378

Query: 360 VCRDACEKIYARLSKVGCDVFWDDMGEQIGSQFAVADLLGFPLQVIVGSKFVSDSKVEIK 419
               AC+++Y  LS  G DV +DD  ++ G++FA ADL+G P Q+ VG + +++ KVE+K
Sbjct: 379 ATDAACDQLYRELSAKGVDVLYDDTDQRAGAKFATADLIGIPWQIHVGPRGLAEGKVELK 438

Query: 420 HRLTGIREDMSLEEVINYAS 439
            R  G RE+++L +V+   +
Sbjct: 439 RRSDGARENLALADVVARLT 458


gi|5107656|pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna Length = 642 Back     alignment and structure
gi|38492559|pdb|1NYQ|A Chain A, Structure Of Staphylococcus Aureus Threonyl-Trna Synthetase Complexed With An Analogue Of Threonyl Adenylate Length = 645 Back     alignment and structure
>gi|9955215|pdb|1EVK|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna Synthetase With The Ligand Threonine Length = 401 Back     alignment and structure
>gi|28948883|pdb|1NJ1|A Chain A, Crystal Structure Of Prolyl-Trna Synthetase From Methanothermobacter Thermautotrophicus Bound To Cysteine Sulfamoyl Adenylate Length = 501 Back     alignment and structure
>gi|4388929|pdb|1B76|A Chain A, Glycyl-Trna Synthetase From Thermus Thermophilus Complexed With Atp Length = 442 Back     alignment and structure
>gi|2392169|pdb|1ATI|A Chain A, Crystal Structure Of Glycyl-Trna Synthetase From Thermus Thermophilus Length = 505 Back     alignment and structure
gi|118138617|pdb|2J3L|A Chain A, Prolyl-Trna Synthetase From Enterococcus Faecalis Complexed With A Prolyl-Adenylate Analogue ('5'-O-(N-(L-Prolyl)- Sulfamoyl)adenosine) Length = 572 Back     alignment and structure
gi|118138617|pdb|2J3L|A Chain A, Prolyl-Trna Synthetase From Enterococcus Faecalis Complexed With A Prolyl-Adenylate Analogue ('5'-O-(N-(L-Prolyl)- Sulfamoyl)adenosine) Length = 572 Back     alignment and structure
>gi|28948887|pdb|1NJ8|A Chain A, Crystal Structure Of Prolyl-Trna Synthetase From Methanocaldococcus Janaschii Length = 459 Back     alignment and structure
gi|14719699|pdb|1H4Q|A Chain A, Prolyl-Trna Synthetase From Thermus Thermophilus Complexed With Trnapro(Cgg), Atp And Prolinol Length = 477 Back     alignment and structure
>gi|255918003|pdb|3IAL|A Chain A, Giardia Lamblia Prolyl-Trna Synthetase In Complex With Prolyl-Adenylate Length = 518 Back     alignment and structure
>gi|9955267|pdb|1QE0|A Chain A, Crystal Structure Of Apo S. Aureus Histidyl-Trna Synthetase Length = 420 Back     alignment and structure
>gi|170292177|pdb|2EL9|A Chain A, Crystal Structure Of E.Coli Histidyl-Trna Synthetase Complexed With A Histidyl-Adenylate Analogue Length = 431 Back     alignment and structure
>gi|1942448|pdb|1HTT|A Chain A, Histidyl-Trna Synthetase Length = 423 Back     alignment and structure
gi|2781066|pdb|1KMM|A Chain A, Histidyl-Trna Synthetase Complexed With Histidyl-Adenylate Length = 424 Back     alignment and structure