peg_788

peg_788

GeneID in NCBI database:Locus tag:
Protein GI in NCBI database:not defined in NCBI databaseProtein Accession:
Gene range:+(841098, 841910)Protein Length:270aa
Gene description:
COG prediction:none
KEGG prediction:not defined in KEGG
SEED prediction:Lipoprotein releasing system transmembrane protein LolC
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Lipoprotein sorting system
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
ccccccHHHHHHHHHHHHccccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHccccEEEEEEEEEEEEEEEEccccEEEEEEEEEcHHHHHHHHHHHHHHHcccHHHccccccEEEHHHHHHHcccccccEEEEEEccccccccccccccEEEEEEEEEEcccHHHccEEEEEcHHHHHHHHcccccEEEEEEEEccHHHHHHHHHHHHHHccccEEEEEHHHHHHHHHHHHcc
ccccccHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccEEEEccccccccHHHHHHHHHHcccEEEEEEEEcccEEEEcccccEEEEEEEcccHHHHHHHHHHHHHHHcccHHcccccccEEEcHHHHHHcccccccEEEEEEcccccccccccccEEEEEEEEEEEEccccccccEEEEcHHHHHHHHHccccccEEEEEEccHHHHHHHHHHHHHHccccEEEEcHHHHHcHHHHHHcc
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGhvviqqkyyplvDYQFIANRldfipdvikvlpfvsgqafvsglssggsgvlvrgisnsdfsyLQNSFSRFygnvsndfdrgkgviiGKDLARNLgisigdkinilspygdvtpmgmgirsksYTVLGMfrmrfpdydngmVYMSLQEAQLYFNlenavsgievfvkdpdaieKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
MSIFSRFEVIVAWRYLFSNRKNafisiasfisfiGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFvsglssggsgvlvRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
**IFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYG****DFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
*SIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
iiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES
MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRILGNGVVVIDWQQRYQIFFSCYES

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target270
315122708 416 lipoprotein releasing system, transmembrane protein, Lo 1 1e-112
150396142 436 LolC/E family lipoprotein releasing system, transmembra 1 2e-64
209548883 434 lipoprotein releasing system, transmembrane protein, Lo 1 7e-64
307301112 437 lipoprotein releasing system, transmembrane protein, Lo 1 1e-63
222148296 435 ABC transporter membrane spanning protein [Agrobacteriu 1 2e-63
218682656 421 lipoprotein releasing system, transmembrane protein, Lo 1 4e-63
327194828 434 lipoprotein releasing system, transmembrane protein, Lo 1 6e-63
241204107 434 lipoprotein releasing system, transmembrane protein, Lo 1 1e-62
116251486 434 transmembrane component of ABC transporter [Rhizobium l 1 2e-62
163759521 433 ABC transporter, membrane spanning protein [Hoeflea pho 1 2e-62
>gi|315122708|ref|YP_004063197.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 416 Back     alignment and organism information
 Score =  407 bits (1046), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 192/269 (71%), Positives = 233/269 (86%), Gaps = 1/269 (0%)

Query: 1   MSIFSRFEVIVAWRYLFSNRKNAFISIASFISFIGVMIGVMALIVVMSVMNGFREDMIKR 60
           M  FSRFEV +AWRYLFS RK +FISIAS +SFIGVMIGVMALIVVMSVMNGFR DMIKR
Sbjct: 1   MIFFSRFEVAIAWRYLFSRRKESFISIASSVSFIGVMIGVMALIVVMSVMNGFRADMIKR 60

Query: 61  VLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRG 120
           +LGINGH++IQQKYYPLVDYQ ++ +L  IPDV +V PFV+GQAF+S ++S GSGV VRG
Sbjct: 61  ILGINGHIIIQQKYYPLVDYQSLSKKLSSIPDVTQVSPFVTGQAFISSMNSRGSGVSVRG 120

Query: 121 ISNSDFSYLQNSFSRFYGNVSNDFDRGKGVIIGKDLARNLGISIGDKINILSPYGDVTPM 180
           IS+ DFS+++ SFSRFYG + NDFD+GKG++IG+DLAR LGISIGDKI ILSPYGD+TP+
Sbjct: 121 ISSKDFSHIKKSFSRFYGGL-NDFDQGKGIVIGEDLARVLGISIGDKIKILSPYGDITPL 179

Query: 181 GMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKT 240
           G+G RSKSYTV  +F++R PDYD+GM+YM L+EAQLYFN+ENAVSGIE+FVKDPD IEK+
Sbjct: 180 GIGTRSKSYTVSAIFQIRIPDYDSGMIYMPLEEAQLYFNIENAVSGIEIFVKDPDMIEKS 239

Query: 241 HENIVRILGNGVVVIDWQQRYQIFFSCYE 269
            +NI+ I GN V ++DWQQRYQ+FF   +
Sbjct: 240 RKNIIDIFGNDVSIVDWQQRYQMFFYAMQ 268


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396142|ref|YP_001326609.1| LolC/E family lipoprotein releasing system, transmembrane protein [Sinorhizobium medicae WSM419] Length = 436 Back     alignment and organism information
>gi|209548883|ref|YP_002280800.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 434 Back     alignment and organism information
>gi|307301112|ref|ZP_07580881.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Sinorhizobium meliloti BL225C] Length = 437 Back     alignment and organism information
>gi|222148296|ref|YP_002549253.1| ABC transporter membrane spanning protein [Agrobacterium vitis S4] Length = 435 Back     alignment and organism information
>gi|218682656|ref|ZP_03530257.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium etli CIAT 894] Length = 421 Back     alignment and organism information
>gi|327194828|gb|EGE61662.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium etli CNPAF512] Length = 434 Back     alignment and organism information
>gi|241204107|ref|YP_002975203.1| lipoprotein releasing system, transmembrane protein, LolC/E family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 434 Back     alignment and organism information
>gi|116251486|ref|YP_767324.1| transmembrane component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 434 Back     alignment and organism information
>gi|163759521|ref|ZP_02166606.1| ABC transporter, membrane spanning protein [Hoeflea phototrophica DFL-43] Length = 433 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target270
TIGR02212 411 TIGR02212, lolCE, lipoprotein releasing system, transme 4e-62
PRK11146 412 PRK11146, PRK11146, outer membrane-specific lipoprotein 7e-23
TIGR02213 411 TIGR02213, lolE_release, lipoprotein releasing system, 4e-22
PRK10814 399 PRK10814, PRK10814, outer membrane-specific lipoprotein 2e-18
COG4591 408 COG4591, LolE, ABC-type transport system, involved in l 7e-51
>gnl|CDD|162764 TIGR02212, lolCE, lipoprotein releasing system, transmembrane protein, LolC/E family Back     alignment and domain information
>gnl|CDD|182995 PRK11146, PRK11146, outer membrane-specific lipoprotein transporter subunit LolE; Provisional Back     alignment and domain information
>gnl|CDD|131268 TIGR02213, lolE_release, lipoprotein releasing system, transmembrane protein LolE Back     alignment and domain information
>gnl|CDD|182753 PRK10814, PRK10814, outer membrane-specific lipoprotein transporter subunit LolC; Provisional Back     alignment and domain information
>gnl|CDD|34229 COG4591, LolE, ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 270
TIGR02212 414 lolCE lipoprotein releasing system, transmembrane prote 100.0
COG4591 408 LolE ABC-type transport system, involved in lipoprotein 100.0
PRK11146 412 outer membrane-specific lipoprotein transporter subunit 100.0
PRK10814 396 outer membrane-specific lipoprotein transporter subunit 100.0
TIGR02213 416 lolE_release lipoprotein releasing system, transmembran 100.0
PRK10535 648 macrolide transporter ATP-binding /permease protein; Pr 99.89
TIGR03434 803 ADOP Acidobacterial duplicated orphan permease. Members 99.27
COG3127 829 Predicted ABC-type transport system involved in lysopho 98.66
COG0577 419 SalY ABC-type antimicrobial peptide transport system, p 98.52
TIGR01185 381 devC DevC protein; InterPro: IPR005891 ABC transporters 98.39
COG3127 829 Predicted ABC-type transport system involved in lysopho 97.84
TIGR03434 803 ADOP Acidobacterial duplicated orphan permease. Members 97.76
PRK11026309 ftsX cell division protein FtsX; Provisional 94.78
>TIGR02212 lolCE lipoprotein releasing system, transmembrane protein, LolC/E family; InterPro: IPR011925 This entry describes the LolC protein, and its paralog LolE found in some species Back     alignment and domain information
>COG4591 LolE ABC-type transport system, involved in lipoprotein release, permease component [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11146 outer membrane-specific lipoprotein transporter subunit LolE; Provisional Back     alignment and domain information
>PRK10814 outer membrane-specific lipoprotein transporter subunit LolC; Provisional Back     alignment and domain information
>TIGR02213 lolE_release lipoprotein releasing system, transmembrane protein LolE; InterPro: IPR011926 This protein is part of an unusual ABC transporter complex that releases lipoproteins from the periplasmic side of the bacterial inner membrane, rather than transport any substrate across the inner membrane Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>TIGR03434 ADOP Acidobacterial duplicated orphan permease Back     alignment and domain information
>COG3127 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG0577 SalY ABC-type antimicrobial peptide transport system, permease component [Defense mechanisms] Back     alignment and domain information
>TIGR01185 devC DevC protein; InterPro: IPR005891 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energize diverse biological systems Back     alignment and domain information
>COG3127 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, permease component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03434 ADOP Acidobacterial duplicated orphan permease Back     alignment and domain information
>PRK11026 ftsX cell division protein FtsX; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target270
3ftj_A226 MACB, macrolide export ATP-binding/permease protein MAC 4e-04
>3ftj_A MACB, macrolide export ATP-binding/permease protein MACB; macrolide-specific pump, ABC-type transporter; 2.00A {Actinobacillus actinomycetemcomitans} Length = 226 Back     alignment and structure
 Score = 40.6 bits (94), Expect = 4e-04
 Identities = 19/169 (11%), Positives = 50/169 (29%), Gaps = 15/169 (8%)

Query: 84  ANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSND 143
           AN L     +  V P  S    +   +   +   + GI    F        +      +D
Sbjct: 40  ANTLSKQSYIQSVTPNTSSSGILVVGNKSFTSANLYGIGEQYFDVEGLKLKQGRLLTEDD 99

Query: 144 FDRG-KGVIIGKDLARNLGISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMR---F 199
            D+  + V++ +   + +               +     +    + + V+G+   +    
Sbjct: 100 VDQSNQVVVLDESAKKAIF-----------ANENPLGKTVIFNKRPFRVIGVVSDQQLGG 148

Query: 200 PDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL 248
              ++  +Y             + +  I V + D        +++  +L
Sbjct: 149 FPGNSLNLYSPYSTVLNKITGGSRIGSITVKISDDVNSTVAEKSLTELL 197


Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target270
3ftj_A226 MACB, macrolide export ATP-binding/permease protein MAC 99.58
3is6_A244 Putative permease protein, ABC transporter; domain, PSI 97.6
>3ftj_A MACB, macrolide export ATP-binding/permease protein MACB; macrolide-specific pump, ABC-type transporter; 2.00A {Actinobacillus actinomycetemcomitans} Back     alignment and structure
Probab=99.58  E-value=3.9e-15  Score=103.81  Aligned_cols=192  Identities=13%  Similarity=0.117  Sum_probs=130.8

Q ss_pred             HHHHHHHCCCC-CEEECCCCC--------CCCHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             96311102453-000000000--------121366655542264103466542001111122233221011124310000
Q 537021.9.peg.7   57 MIKRVLGINGH-VVIQQKYYP--------LVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFS  127 (270)
Q Consensus        57 i~~~i~~~~~~-i~i~~~~~~--------~~~~~~~~~~l~~~~~V~~~~p~i~~~~~i~~~~~~~~~v~i~Gv~~~~~~  127 (270)
                      +.+++-++.++ +.|.+....        ........+.|++.|+|+.++|.+...+.+...+.....+.+.|++|++..
T Consensus         4 i~~~i~~lG~n~i~V~p~~~~~~~~~~~~~~lt~~D~~~i~~~~~v~~v~p~~~~~~~~~~~~~~~~~~~v~Gv~~~~~~   83 (226)
T 3ftj_A            4 ILENIRGIGTNTMTIFNGNGFGDRRSRHIQNLKISDANTLSKQSYIQSVTPNTSSSGILVVGNKSFTSANLYGIGEQYFD   83 (226)
T ss_dssp             STTTSTTSSSSEEEEEESSCTTCHHHHHSCCCBHHHHHHHHTSTTEEEEEEEEEEEEEEEETTEEEEEEEEEEECTTHHH
T ss_pred             HHHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEEEECCCEEEEECCEEEEEEEEEEECHHHHH
T ss_conf             99999963897899981788788775553889999999985667885880564133699999858766899998878998


Q ss_pred             CCCCHHHHCCCCCCCCCC---CCCCCCCHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCEEEEEEC--
Q ss_conf             012001100277542111---123421013454554---213332023113442100012211000012210233102--
Q 537021.9.peg.7  128 YLQNSFSRFYGNVSNDFD---RGKGVIIGKDLARNL---GISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRF--  199 (270)
Q Consensus       128 ~~~~~~~~~~~~~~~~~~---~~~~iiiG~~lA~~L---~l~vGD~i~l~~~~~~~~~~~~~~~~~~f~V~GI~~sg~--  199 (270)
                      ...  .....|......+   ..+.|+||+.+|++|   .-.+|.+|.+              ....|+|+||++...  
T Consensus        84 i~~--~~i~~GR~f~~~D~~~~~~v~VIg~~~a~~LF~~~~~iG~~i~i--------------~~~~f~VVGVl~~~~~~  147 (226)
T 3ftj_A           84 VEG--LKLKQGRLLTEDDVDQSNQVVVLDESAKKAIFANENPLGKTVIF--------------NKRPFRVIGVVSDQQLG  147 (226)
T ss_dssp             HHT--CCEEEECCCCHHHHHHTCCEEEEEHHHHHHHHTTSCCTTCEEEE--------------TTEEEEEEEEECCC---
T ss_pred             HCC--CCHHHCCCCCHHHHHCCCCEEEECHHHHHHHCCCCCCCCCEEEE--------------CCCCEEEEEEECCCCCC
T ss_conf             719--72231876995687359949998547878765876677745877--------------89557999998646778


Q ss_pred             -CCCCCCEEEEEHHHHHHHCCCCCCEEEEEEEECCHHHHHHHHHHHHHHC-----CCCEEEEEHHHHHHHH
Q ss_conf             -4455516898548899971899871079999569889999999999861-----9985999689988989
Q 537021.9.peg.7  200 -PDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL-----GNGVVVIDWQQRYQIF  264 (270)
Q Consensus       200 -~~~D~~~v~~~l~~~q~l~~~~~~~~~i~i~l~d~~~~~~~~~~i~~~l-----~~~~~v~~w~e~~~~l  264 (270)
                       ..-++..+|+|+.+++..+...+.++.+.|++++..+.+++.+++++.+     .++|.+.++.+.-+.+
T Consensus       148 ~~~~~~~~i~iP~~t~~~~~~~~~~~~~i~v~~~~~~~~~~v~~~i~~~l~~~~~~~d~~i~~~~~~~~~~  218 (226)
T 3ftj_A          148 GFPGNSLNLYSPYSTVLNKITGGSRIGSITVKISDDVNSTVAEKSLTELLKSLHGKKDFFIMNSDTIKQTI  218 (226)
T ss_dssp             -----CCEEEEEHHHHHHHTTCSSBCSEEEEEECTTSCHHHHHHHHHHHHHHHHSSCCEEEESHHHHHHHH
T ss_pred             CCCCCCCEEEEEHHHHHHHHCCCCCEEEEEEEEECCCCHHHHHHHHHHHHHHHCCCCCCEEECHHHHHHHH
T ss_conf             87788856999968999985388740489999908889999999999999986198886897699999999



>3is6_A Putative permease protein, ABC transporter; domain, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.95A {Porphyromonas gingivalis W83} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 270
3ftj_A_226 (A:) MACB, macrolide export ATP-binding/permease p 3e-11
3is6_A_244 (A:) Putative permease protein, ABC transporter; d 2e-06
>3ftj_A (A:) MACB, macrolide export ATP-binding/permease protein MACB; macrolide-specific pump, ABC-type transporter; 2.00A {Actinobacillus actinomycetemcomitans}Length = 226 Back     alignment and structure
 Score = 63.7 bits (154), Expect = 3e-11
 Identities = 23/230 (10%), Positives = 63/230 (27%), Gaps = 22/230 (9%)

Query: 46  VMSVMNGFREDMIKRVLGINGHVVIQQKYYPLVDYQFIANRLDFIPDVIKVLPFVSGQAF 105
           ++  + G   + +    G        +    L      AN L     +  V P  S    
Sbjct: 4   ILENIRGIGTNTMTIFNGNGFGDRRSRHIQNL--KISDANTLSKQSYIQSVTPNTSSSGI 61

Query: 106 VSGLSSGGSGVLVRGISNSDFSYLQNSFSRFYGNVSNDFDRG-KGVIIGKDLARNL---G 161
           +   +   +   + GI    F        +      +D D+  + V++ +   + +    
Sbjct: 62  LVVGNKSFTSANLYGIGEQYFDVEGLKLKQGRLLTEDDVDQSNQVVVLDESAKKAIFANE 121

Query: 162 ISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRMRFPDYDNGMVYMSLQEAQLYFNLE 221
             +G  +                  +   V+   ++     ++  +Y             
Sbjct: 122 NPLGKTVIF-----------NKRPFRVIGVVSDQQLGGFPGNSLNLYSPYSTVLNKITGG 170

Query: 222 NAVSGIEVFVKDPDAIEKTHENIVRIL-----GNGVVVIDWQQRYQIFFS 266
           + +  I V + D        +++  +L          +++     Q   +
Sbjct: 171 SRIGSITVKISDDVNSTVAEKSLTELLKSLHGKKDFFIMNSDTIKQTIEN 220


>3is6_A (A:) Putative permease protein, ABC transporter; domain, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.95A {Porphyromonas gingivalis W83}Length = 244 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target270
3ftj_A_226 MACB, macrolide export ATP-binding/permease protei 99.72
3is6_A_244 Putative permease protein, ABC transporter; domain 99.31
>3ftj_A (A:) MACB, macrolide export ATP-binding/permease protein MACB; macrolide-specific pump, ABC-type transporter; 2.00A {Actinobacillus actinomycetemcomitans} Back     alignment and structure
Probab=99.72  E-value=1.1e-17  Score=119.19  Aligned_cols=196  Identities=11%  Similarity=0.062  Sum_probs=145.7

Q ss_pred             HHHHHHCCCCCEEECCC---------CCCCCHHHHHHHHHCCCCHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             63111024530000000---------001213666555422641034665420011111222332210111243100000
Q 537021.9.peg.7   58 IKRVLGINGHVVIQQKY---------YPLVDYQFIANRLDFIPDVIKVLPFVSGQAFVSGLSSGGSGVLVRGISNSDFSY  128 (270)
Q Consensus        58 ~~~i~~~~~~i~i~~~~---------~~~~~~~~~~~~l~~~~~V~~~~p~i~~~~~i~~~~~~~~~v~i~Gv~~~~~~~  128 (270)
                      .+.+.++..++......         ......+...+.+++.|+|+.++|.+...+.+...+.....+.+.|++|+++..
T Consensus         5 ~~~~~~~~~~~~~v~~~~~~~~~~~~~~~~~~~~~~~~i~~~pgV~~v~~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~   84 (226)
T 3ftj_A            5 LENIRGIGTNTMTIFNGNGFGDRRSRHIQNLKISDANTLSKQSYIQSVTPNTSSSGILVVGNKSFTSANLYGIGEQYFDV   84 (226)
T ss_dssp             TTTSTTSSSSEEEEEESSCTTCHHHHHSCCCBHHHHHHHHTSTTEEEEEEEEEEEEEEEETTEEEEEEEEEEECTTHHHH
T ss_pred             HHHHHHHCCCEEEEEECCCCCCCCCCCCCCCCHHHHHHHHCCCCCCEEEEEECCCCEEEECCCCCEEEEEEEECHHHHHH
T ss_conf             99999628978999807888987755538899999999856578858815751473687315431068999977678867


Q ss_pred             CCCHHHHCCCCCCCCC---CCCCCCCCHHHHHHHH---HCCCCCEEEECCCCCCCCCCCCCCCCCCCCCCEEEEE---EC
Q ss_conf             1200110027754211---1123421013454554---2133320231134421000122110000122102331---02
Q 537021.9.peg.7  129 LQNSFSRFYGNVSNDF---DRGKGVIIGKDLARNL---GISIGDKINILSPYGDVTPMGMGIRSKSYTVLGMFRM---RF  199 (270)
Q Consensus       129 ~~~~~~~~~~~~~~~~---~~~~~iiiG~~lA~~L---~l~vGD~i~l~~~~~~~~~~~~~~~~~~f~V~GI~~s---g~  199 (270)
                      ....  ...|......   ...+.++||+.+|++|   +..+|++|.+-              ...|+|+||++.   +.
T Consensus        85 ~~~~--l~~Gr~~~~~d~~~~~~~vvI~~~~A~~lf~~~~~iG~~i~~~--------------~~~~~VvGV~~~~~~~~  148 (226)
T 3ftj_A           85 EGLK--LKQGRLLTEDDVDQSNQVVVLDESAKKAIFANENPLGKTVIFN--------------KRPFRVIGVVSDQQLGG  148 (226)
T ss_dssp             HTCC--EEEECCCCHHHHHHTCCEEEEEHHHHHHHHTTSCCTTCEEEET--------------TEEEEEEEEECCC----
T ss_pred             CCCC--EECCCCCCHHHHHCCCCEEEECHHHHHHHCCCCCCCCCEEEEC--------------CCCEEEEEEECCCCCCC
T ss_conf             0831--2004555844662577347717267777448878654246668--------------98509999976566778


Q ss_pred             CCCCCCEEEEEHHHHHHHCCCCCCEEEEEEEECCHHHHHHHHHHHHHHC-----CCCEEEEEHHHHHHHHHHHHC
Q ss_conf             4455516898548899971899871079999569889999999999861-----998599968998898999860
Q 537021.9.peg.7  200 PDYDNGMVYMSLQEAQLYFNLENAVSGIEVFVKDPDAIEKTHENIVRIL-----GNGVVVIDWQQRYQIFFSCYE  269 (270)
Q Consensus       200 ~~~D~~~v~~~l~~~q~l~~~~~~~~~i~i~l~d~~~~~~~~~~i~~~l-----~~~~~v~~w~e~~~~lf~ai~  269 (270)
                      ...+...+|+|+.++++++...+.++.+.|+++++.+.+++.++|++.+     ..++.+.+|.+..+.+++.++
T Consensus       149 ~~~~~~~v~~p~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~~i~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~  223 (226)
T 3ftj_A          149 FPGNSLNLYSPYSTVLNKITGGSRIGSITVKISDDVNSTVAEKSLTELLKSLHGKKDFFIMNSDTIKQTIENTTG  223 (226)
T ss_dssp             ----CCEEEEEHHHHHHHTTCSSBCSEEEEEECTTSCHHHHHHHHHHHHHHHHSSCCEEEESHHHHHHHHHTSCC
T ss_pred             CCCCCCEEEEEHHHHHHHHCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCCCCCEEECHHHHHHHHHHHHH
T ss_conf             788886599982798865247776517999986888999999999999998619888589769999999999998



>3is6_A (A:) Putative permease protein, ABC transporter; domain, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.95A {Porphyromonas gingivalis W83} Back     alignment and structure