254780873

254780873

aspartate kinase

GeneID in NCBI database:8209888Locus tag:CLIBASIA_03850
Protein GI in NCBI database:254780873Protein Accession:YP_003065286.1
Gene range:+(843956, 845191)Protein Length:411aa
Gene description:aspartate kinase
COG prediction:[E] Aspartokinases
KEGG prediction:aspartate kinase (EC:2.7.2.4); K00928 aspartate kinase [EC:2.7.2.4]
SEED prediction:Aspartokinase (EC 2.7.2.4)
Pathway involved in KEGG:Glycine, serine and threonine metabolism [PATH:las00260]
Cysteine and methionine metabolism [PATH:las00270]
Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Lysine Biosynthesis DAP Pathway;
Threonine and Homoserine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDVQ
ccEEEEEEcccccccHHHHHHHHHHHHHHHHccccEEEEEccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEcccccEEEEcccccccEEccccHHHHHHHHHcccEEEEcccccccccccEEEEcccccHHHHHHHHHHHcccEEEEEEccccccccccccccccEEccEEcHHHHHHHHHcccccccHHHHHHHHHccccEEEccccccccccccccEEEEcccccccccccccEEEEccEEEEEEEcccccHHHHHHHHHHHHHccccEEEEEccccccccEEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEcccEEEEEccccccccccHHHHHHHHHHHcccEEEEEEccccEEEEEEcHHHHHHHHHHHHHHHccccc
ccHEEEcccccccccHHHHHHHHHHHHHHHHccccEEEEEEccccccHHHHHHHHHccccccHHHHcHHEcccHHHHHHHHHHHHHHccccEEEccccEEEEEccccccccEEccccHHHHHHHHHcccEEEEEccccccccccEEEEcccccccHHHHHHHHHcccccccEEcccccEcccccccHHHcccccccHHHHHHHHHccccEEEEEEHHHcccccccEEEEEccccccccccccEEEEccccHccccEEEEEEccccccEEEEEcccccccHHHHHHHHHHHccccEEEEEEEcccccccccEEEEcccccHHHHHHHHHHHHHHccccEEEccccEEEEEEEEccccccHHHHHHHHHHHHHccccEEEEEccEEEEEEEEcHHHHHHHHHHHHHHHccccc
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSidnarerdvvISTGEQVSSGLMVLALQSLGIQAislqgwqipimtdSLHGMARICRVDEKKIVTHLKKKQVVVITGfqglshdnsvttlgrggsdTSAVAIAAAIKAdrcdiytdvcgiyttdpriepkahlMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVrssfedhgqqeqlgtlicsgediMEKKVITGIAYTKDEAQISLRRlrdhpgisasifsplaeahiNIDMIIQNvsedgqyvditfttpssSLEKALAVLSdnkenigydviqhednLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHscygldvq
marivmkfggtsvanidCIRSAALHVKREVDRGQEVAMVVSamsgetdrLAELCRQVtsidnarerdvVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVItgfqglshdnsvttlgrggsdTSAVAIAAAikadrcdiyTDVCGIYttdpriepkAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGtlicsgediMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIkaittseiKISVLIDSAYTELAVRSLHscygldvq
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSavaiaaaikaDRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDVQ
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLD**
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDVQ
*ARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDV*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDVQ
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDVQ
MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQLGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQNVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAGVASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDVQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target411 aspartate kinase [Candidatus Liberibacter asiaticus str
254780777242 uridylate kinase [Candidatus Liberibacter asiaticu 5e-07
>gi|254780777|ref|YP_003065190.1| uridylate kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 242 Back     alignment
 Score = 47.0 bits (110), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 57/225 (25%), Positives = 104/225 (46%), Gaps = 32/225 (14%)

Query: 3   RIVMKFGGTSVA-------NIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCR 55
           R+++K  G ++A       +ID +      +     +G E+ +VV    G   R +++  
Sbjct: 8   RVLLKVSGEALAGISGFGVDIDSVNRICADIAEVYAKGIEIGIVVGG--GNIFRGSQVVA 65

Query: 56  QVTSIDNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICR 115
           +   +    ER  V S G  +S+ +  LAL       ++L+   +P +  S   M ++C 
Sbjct: 66  ENYLL---CERSTVDSMG-MLSTVINALALD------LALRKINVPTVILSSIFMPQVCE 115

Query: 116 VDE-KKIVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTD 174
           V   +  V++L + +VV+ +G  G    N+  T     +D++A   A+ I AD     T 
Sbjct: 116 VFSCRNAVSYLSQGKVVIFSGGTG----NAFLT-----TDSAAALRASEIGADVILKGTQ 166

Query: 175 VCGIYTTDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELA 219
           V G+Y+ DPR+   +     +++ + +E    G KVM   SV LA
Sbjct: 167 VDGVYSADPRVHASSTRFDSLTYNQFIEK---GLKVMDCASVVLA 208

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target411 aspartate kinase [Candidatus Liberibacter asiaticus str
315122705411 aspartate kinase [Candidatus Liberibacter solanacearum 1 0.0
227823190424 aspartate kinase [Sinorhizobium fredii NGR234] Length = 1 1e-152
209551102424 aspartate kinase [Rhizobium leguminosarum bv. trifolii 1 1e-151
15966366424 aspartate kinase [Sinorhizobium meliloti 1021] Length = 1 1e-151
116254021424 aspartate kinase [Rhizobium leguminosarum bv. viciae 38 1 1e-151
121602341417 aspartate kinase [Bartonella bacilliformis KC583] Lengt 1 1e-151
150397702424 aspartate kinase [Sinorhizobium medicae WSM419] Length 1 1e-151
222087305424 aspartate kinase protein [Agrobacterium radiobacter K84 1 1e-150
86359342424 aspartate kinase [Rhizobium etli CFN 42] Length = 424 1 1e-150
190893593424 aspartate kinase [Rhizobium etli CIAT 652] Length = 424 1 1e-150
>gi|315122705|ref|YP_004063194.1| aspartate kinase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 411 Back     alignment and organism information
 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/410 (82%), Positives = 377/410 (91%)

Query: 1   MARIVMKFGGTSVANIDCIRSAALHVKREVDRGQEVAMVVSAMSGETDRLAELCRQVTSI 60
           MARIVMKFGGTSVANIDCIR+AALHVKREV+ GQE+A+VVSAMSGETDRL+ LC+ + S+
Sbjct: 1   MARIVMKFGGTSVANIDCIRNAALHVKREVNMGQEIAIVVSAMSGETDRLSSLCQCMGSL 60

Query: 61  DNARERDVVISTGEQVSSGLMVLALQSLGIQAISLQGWQIPIMTDSLHGMARICRVDEKK 120
           +N RERDVVIS+GEQVSSGLM LALQSLGI+AISLQGWQIP++TD++HG+ARI R+D  K
Sbjct: 61  NNTRERDVVISSGEQVSSGLMALALQSLGIEAISLQGWQIPVLTDNIHGIARISRIDGTK 120

Query: 121 IVTHLKKKQVVVITGFQGLSHDNSVTTLGRGGSDTSAVAIAAAIKADRCDIYTDVCGIYT 180
           I++H+K K+VVVITGFQG+S    +TTLGRGGSDTSAVAIAAAI ADRCDIYTDV GIYT
Sbjct: 121 IISHMKTKKVVVITGFQGISPAGYITTLGRGGSDTSAVAIAAAINADRCDIYTDVDGIYT 180

Query: 181 TDPRIEPKAHLMKKISFEEMLEMSSLGAKVMQVRSVELAMLYKMCLFVRSSFEDHGQQEQ 240
           TDPRIEPKA LMK ISFEEMLEM+SLGAKVMQVRSVELAML+K+CLFVRSSF D  QQEQ
Sbjct: 181 TDPRIEPKARLMKNISFEEMLEMASLGAKVMQVRSVELAMLHKVCLFVRSSFADSNQQEQ 240

Query: 241 LGTLICSGEDIMEKKVITGIAYTKDEAQISLRRLRDHPGISASIFSPLAEAHINIDMIIQ 300
            GT IC  E+IME++VITGIAYTKDEAQISLRRL+DHPGISASIFSPLA+A+IN+DMIIQ
Sbjct: 241 SGTFICDEENIMEQEVITGIAYTKDEAQISLRRLQDHPGISASIFSPLAKANINVDMIIQ 300

Query: 301 NVSEDGQYVDITFTTPSSSLEKALAVLSDNKENIGYDVIQHEDNLVKISAIGIGMQSYAG 360
           N+SEDGQY DITFTTPS SLEKALAVL+DNK+ IGYDVIQHED LVKISAIGIGMQS+ G
Sbjct: 301 NISEDGQYADITFTTPSLSLEKALAVLTDNKDKIGYDVIQHEDKLVKISAIGIGMQSHTG 360

Query: 361 VASAFFLCLAEKGINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDV 410
           VASAFF C AEK INIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLD+
Sbjct: 361 VASAFFSCFAEKNINIKAITTSEIKISVLIDSAYTELAVRSLHSCYGLDI 410


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823190|ref|YP_002827162.1| aspartate kinase [Sinorhizobium fredii NGR234] Length = 424 Back     alignment and organism information
>gi|209551102|ref|YP_002283019.1| aspartate kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 424 Back     alignment and organism information
>gi|15966366|ref|NP_386719.1| aspartate kinase [Sinorhizobium meliloti 1021] Length = 424 Back     alignment and organism information
>gi|116254021|ref|YP_769859.1| aspartate kinase [Rhizobium leguminosarum bv. viciae 3841] Length = 424 Back     alignment and organism information
>gi|121602341|ref|YP_988689.1| aspartate kinase [Bartonella bacilliformis KC583] Length = 417 Back     alignment and organism information
>gi|150397702|ref|YP_001328169.1| aspartate kinase [Sinorhizobium medicae WSM419] Length = 424 Back     alignment and organism information
>gi|222087305|ref|YP_002545842.1| aspartate kinase protein [Agrobacterium radiobacter K84] Length = 424 Back     alignment and organism information
>gi|86359342|ref|YP_471234.1| aspartate kinase [Rhizobium etli CFN 42] Length = 424 Back     alignment and organism information
>gi|190893593|ref|YP_001980135.1| aspartate kinase [Rhizobium etli CIAT 652] Length = 424 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target411 aspartate kinase [Candidatus Liberibacter asiaticus str
PRK06635404 PRK06635, PRK06635, aspartate kinase; Reviewed 1e-176
PRK07431 587 PRK07431, PRK07431, aspartate kinase; Provisional 1e-120
TIGR00657441 TIGR00657, asp_kinases, aspartate kinase 1e-112
TIGR00656401 TIGR00656, asp_kin_monofn, aspartate kinase, monofuncti 2e-99
PRK08210403 PRK08210, PRK08210, aspartate kinase I; Reviewed 9e-86
PRK06291465 PRK06291, PRK06291, aspartate kinase; Provisional 8e-76
PRK08841392 PRK08841, PRK08841, aspartate kinase; Validated 4e-71
PRK09436 819 PRK09436, thrA, bifunctional aspartokinase I/homoserine 4e-57
PRK09084448 PRK09084, PRK09084, aspartate kinase III; Validated 6e-54
KOG0456559 KOG0456, KOG0456, KOG0456, Aspartate kinase [Amino acid 3e-33
PLN02551521 PLN02551, PLN02551, aspartokinase 8e-30
PRK09034454 PRK09034, PRK09034, aspartate kinase; Reviewed 2e-27
PRK08961 861 PRK08961, PRK08961, bifunctional aspartate kinase/diami 2e-24
PRK09466 810 PRK09466, metL, bifunctional aspartate kinase II/homose 3e-23
COG0527447 COG0527, LysC, Aspartokinases [Amino acid transport and 1e-106
cd04246239 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid 4e-90
cd04261239 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid 5e-90
cd04234227 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily 2e-66
cd04260244 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid K 3e-56
cd04243293 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid 1e-40
cd04244298 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid 3e-39
cd02115248 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, cat 4e-38
cd04258292 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Ac 1e-37
cd04257294 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Su 8e-35
pfam00696230 pfam00696, AA_kinase, Amino acid kinase family 1e-34
PRK05925440 PRK05925, PRK05925, aspartate kinase; Provisional 5e-26
cd04259295 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase 4e-25
TIGR02078327 TIGR02078, AspKin_pair, Pyrococcus aspartate kinase sub 4e-20
cd04239229 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK 2e-13
cd04254231 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the mi 2e-11
COG0528238 COG0528, PyrH, Uridylate kinase [Nucleotide transport a 1e-09
TIGR02075233 TIGR02075, pyrH_bact, uridylate kinase 1e-09
PRK00358231 PRK00358, pyrH, uridylate kinase; Provisional 3e-08
PRK07431587 PRK07431, PRK07431, aspartate kinase; Provisional 2e-34
PRK08373341 PRK08373, PRK08373, aspartate kinase; Validated 3e-29
cd0491375 cd04913, ACT_AKii-LysC-BS-like_1, ACT domains of the ly 8e-22
cd0489161 cd04891, ACT_AK-LysC-DapG-like_1, ACT domains of the ly 4e-17
cd0486860 cd04868, ACT_AK-like, ACT domains C-terminal to the cat 6e-10
PRK09034454 PRK09034, PRK09034, aspartate kinase; Reviewed 3e-06
cd0489265 cd04892, ACT_AK-like_2, ACT domains C-terminal to the c 6e-06
pfam0184266 pfam01842, ACT, ACT domain 8e-06
cd0211660 cd02116, ACT, ACT domains are commonly involved in spec 2e-05
cd0492180 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the b 1e-04
cd0491666 cd04916, ACT_AKiii-YclM-BS_2, ACT domains located C-ter 2e-04
cd0493663 cd04936, ACT_AKii-LysC-BS-like_2, ACT domains of the ly 7e-04
cd0492363 cd04923, ACT_AK-LysC-DapG-like_2, ACT domains of the ly 0.002
cd0488179 cd04881, ACT_HSDH-Hom, ACT_HSDH_Hom CD includes the C-t 0.003
cd04245288 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Ac 7e-21
cd04247306 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kinase Su 1e-15
cd04253221 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase 3e-05
COG0548265 COG0548, ArgB, Acetylglutamate kinase [Amino acid trans 0.003
cd0493663 cd04936, ACT_AKii-LysC-BS-like_2, ACT domains of the ly 4e-18
cd0492363 cd04923, ACT_AK-LysC-DapG-like_2, ACT domains of the ly 3e-17
cd0489265 cd04892, ACT_AK-like_2, ACT domains C-terminal to the c 2e-11
cd0486860 cd04868, ACT_AK-like, ACT domains C-terminal to the cat 2e-07
cd0492266 cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the bifunc 4e-06
cd0492466 cd04924, ACT_AK-Arch_2, ACT domains of a monofunctional 9e-06
cd0491966 cd04919, ACT_AK-Hom3_2, ACT domains located C-terminal 0.001
cd0492180 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the b 0.002
cd04255262 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includ 2e-07
PRK14558231 PRK14558, pyrH, uridylate kinase; Provisional 7e-06
PRK13402368 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional 2e-04
TIGR02076221 TIGR02076, pyrH_arch, uridylate kinase, putative 3e-04
cd04242251 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase 0.002
>gnl|CDD|180641 PRK06635, PRK06635, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|180976 PRK07431, PRK07431, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|161982 TIGR00657, asp_kinases, aspartate kinase Back     alignment and domain information
>gnl|CDD|161981 TIGR00656, asp_kin_monofn, aspartate kinase, monofunctional class Back     alignment and domain information
>gnl|CDD|181293 PRK08210, PRK08210, aspartate kinase I; Reviewed Back     alignment and domain information
>gnl|CDD|180515 PRK06291, PRK06291, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|181563 PRK08841, PRK08841, aspartate kinase; Validated Back     alignment and domain information
>gnl|CDD|181856 PRK09436, thrA, bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|181643 PRK09084, PRK09084, aspartate kinase III; Validated Back     alignment and domain information
>gnl|CDD|35677 KOG0456, KOG0456, KOG0456, Aspartate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178166 PLN02551, PLN02551, aspartokinase Back     alignment and domain information
>gnl|CDD|181617 PRK09034, PRK09034, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|181596 PRK08961, PRK08961, bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>gnl|CDD|181881 PRK09466, metL, bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>gnl|CDD|30873 COG0527, LysC, Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|58612 cd04246, AAK_AK-DapG-like, AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>gnl|CDD|58627 cd04261, AAK_AKii-LysC-BS, AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>gnl|CDD|58600 cd04234, AAK_AK, AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>gnl|CDD|58626 cd04260, AAK_AKi-DapG-BS, AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>gnl|CDD|58609 cd04243, AAK_AK-HSDH-like, AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|58610 cd04244, AAK_AK-LysC-like, AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>gnl|CDD|58599 cd02115, AAK, Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>gnl|CDD|58624 cd04258, AAK_AKiii-LysC-EC, AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>gnl|CDD|58623 cd04257, AAK_AK-HSDH, AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|144336 pfam00696, AA_kinase, Amino acid kinase family Back     alignment and domain information
>gnl|CDD|135659 PRK05925, PRK05925, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|58625 cd04259, AAK_AK-DapDC, AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>gnl|CDD|131133 TIGR02078, AspKin_pair, Pyrococcus aspartate kinase subunit, putative Back     alignment and domain information
>gnl|CDD|58605 cd04239, AAK_UMPK-like, AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|58620 cd04254, AAK_UMPK-PyrH-Ec, UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|30874 COG0528, PyrH, Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|131130 TIGR02075, pyrH_bact, uridylate kinase Back     alignment and domain information
>gnl|CDD|178986 PRK00358, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|180976 PRK07431, PRK07431, aspartate kinase; Provisional Back     alignment and domain information
>gnl|CDD|169408 PRK08373, PRK08373, aspartate kinase; Validated Back     alignment and domain information
>gnl|CDD|153185 cd04913, ACT_AKii-LysC-BS-like_1, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>gnl|CDD|153163 cd04891, ACT_AK-LysC-DapG-like_1, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>gnl|CDD|153140 cd04868, ACT_AK-like, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>gnl|CDD|181617 PRK09034, PRK09034, aspartate kinase; Reviewed Back     alignment and domain information
>gnl|CDD|153164 cd04892, ACT_AK-like_2, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>gnl|CDD|145157 pfam01842, ACT, ACT domain Back     alignment and domain information
>gnl|CDD|153139 cd02116, ACT, ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>gnl|CDD|153193 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|153188 cd04916, ACT_AKiii-YclM-BS_2, ACT domains located C-terminal to the catalytic domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>gnl|CDD|153208 cd04936, ACT_AKii-LysC-BS-like_2, ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>gnl|CDD|153195 cd04923, ACT_AK-LysC-DapG-like_2, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>gnl|CDD|153153 cd04881, ACT_HSDH-Hom, ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>gnl|CDD|58611 cd04245, AAK_AKiii-YclM-BS, AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>gnl|CDD|58613 cd04247, AAK_AK-Hom3, AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>gnl|CDD|58619 cd04253, AAK_UMPK-PyrH-Pf, AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>gnl|CDD|30894 COG0548, ArgB, Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153208 cd04936, ACT_AKii-LysC-BS-like_2, ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>gnl|CDD|153195 cd04923, ACT_AK-LysC-DapG-like_2, ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>gnl|CDD|153164 cd04892, ACT_AK-like_2, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>gnl|CDD|153140 cd04868, ACT_AK-like, ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>gnl|CDD|153194 cd04922, ACT_AKi-HSDH-ThrA_2, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|153196 cd04924, ACT_AK-Arch_2, ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) Back     alignment and domain information
>gnl|CDD|153191 cd04919, ACT_AK-Hom3_2, ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>gnl|CDD|153193 cd04921, ACT_AKi-HSDH-ThrA-like_1, ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>gnl|CDD|58621 cd04255, AAK_UMPK-MosAB, AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>gnl|CDD|173023 PRK14558, pyrH, uridylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|184032 PRK13402, PRK13402, gamma-glutamyl kinase; Provisional Back     alignment and domain information
>gnl|CDD|162687 TIGR02076, pyrH_arch, uridylate kinase, putative Back     alignment and domain information
>gnl|CDD|58608 cd04242, AAK_G5K_ProB, AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 411 aspartate kinase [Candidatus Liberibacter asiaticus str
TIGR00657504 asp_kinases aspartate kinase; InterPro: IPR001341 Bacte 100.0
PRK07431 594 aspartate kinase; Provisional 100.0
PRK06635402 aspartate kinase; Reviewed 100.0
PRK09436 817 thrA bifunctional aspartokinase I/homeserine dehydrogen 100.0
COG0527447 LysC Aspartokinases [Amino acid transport and metabolis 100.0
PRK06291466 aspartate kinase; Provisional 100.0
PRK08210405 aspartate kinase I; Reviewed 100.0
PRK09034450 aspartate kinase; Reviewed 100.0
PRK09466 810 metL bifunctional aspartate kinase II/homoserine dehydr 100.0
PRK08841392 aspartate kinase; Validated 100.0
PRK09084447 aspartate kinase III; Validated 100.0
PRK05925440 aspartate kinase; Provisional 100.0
PRK08961 865 bifunctional aspartate kinase/diaminopimelate decarboxy 100.0
PRK09181476 aspartate kinase; Validated 100.0
KOG0456559 consensus 100.0
TIGR00656480 asp_kin_monofn asparate kinase, monofunctional class; I 100.0
PRK08373359 aspartate kinase; Validated 100.0
TIGR02078341 AspKin_pair Pyrococcus aspartate kinase subunit, putati 100.0
cd04260244 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Supe 100.0
cd04244298 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Su 100.0
cd04246239 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Su 100.0
cd04261239 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Su 100.0
cd04257294 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily 100.0
cd04243293 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Su 100.0
cd04258292 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase 100.0
cd04245288 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase 100.0
cd04259295 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamil 100.0
cd04234227 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Asp 100.0
cd04247306 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily 100.0
cd04248304 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superf 100.0
cd02115248 AAK Amino Acid Kinases (AAK) superfamily, catalytic dom 100.0
pfam00696230 AA_kinase Amino acid kinase family. This family include 100.0
cd04254231 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/ch 100.0
PRK00358231 pyrH uridylate kinase; Provisional 100.0
cd04239229 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, th 100.0
TIGR02075236 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridyla 99.96
PRK12314265 gamma-glutamyl kinase; Provisional 99.96
COG0528238 PyrH Uridylate kinase [Nucleotide transport and metabol 99.95
cd04253221 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf 99.94
PRK12443247 uridylate kinase; Reviewed 99.94
cd04242251 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) cat 99.94
TIGR02076232 pyrH_arch uridylate kinase, putative; InterPro: IPR0118 99.92
cd04256284 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) 99.88
PRK13402363 gamma-glutamyl kinase; Provisional 99.88
PRK05429372 gamma-glutamyl kinase; Provisional 99.87
TIGR01027379 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamat 99.86
COG0263369 ProB Glutamate 5-kinase [Amino acid transport and metab 99.84
cd04241252 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomy 99.83
cd04255262 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alp 99.77
PRK00942262 acetylglutamate kinase; Provisional 99.7
cd04238256 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinas 99.7
cd04250279 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cy 99.64
COG0548265 ArgB Acetylglutamate kinase [Amino acid transport and m 99.62
CHL00202284 argB acetylglutamate kinase; Provisional 99.61
cd04249252 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - 99.54
cd04251257 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - 99.53
cd04237280 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kina 99.51
TIGR00761254 argB acetylglutamate kinase; InterPro: IPR004662 N -Ace 99.5
KOG1154285 consensus 99.44
PRK12353312 carbamate kinase; Reviewed 99.43
cd04240203 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-l 99.28
COG1608252 Predicted archaeal kinase [General function prediction 99.28
PRK04531421 acetylglutamate kinase; Provisional 99.21
PRK12686313 carbamate kinase; Reviewed 99.12
TIGR01092 738 P5CS delta l-pyrroline-5-carboxylate synthetase; InterP 99.12
PRK12454313 carbamate kinase-like carbamoyl phosphate synthetase; R 99.05
cd04235308 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the 98.87
PRK09411297 carbamate kinase; Reviewed 98.84
PRK12354302 carbamate kinase; Reviewed 98.69
PRK12352316 putative carbamate kinase; Reviewed 98.68
COG0549312 ArcC Carbamate kinase [Amino acid transport and metabol 98.46
TIGR00746321 arcC carbamate kinase; InterPro: IPR003964 The arginine 98.02
PRK07431594 aspartate kinase; Provisional 100.0
cd0493764 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-se 99.77
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enz 99.72
cd0493663 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensi 99.72
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to the cat 99.72
cd0492363 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensi 99.72
cd0492466 ACT_AK-Arch_2 ACT domains of a monofunctional aspartoki 99.7
cd0492180 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctiona 99.67
cd0491666 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to t 99.67
cd0491865 ACT_AK1-AT_2 ACT domains located C-terminal to the cata 99.59
cd0489265 ACT_AK-like_2 ACT domains C-terminal to the catalytic d 99.59
cd0491764 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to t 99.54
cd0491566 ACT_AK-Ectoine_2 ACT domains located C-terminal to the 99.44
PRK09436 817 thrA bifunctional aspartokinase I/homeserine dehydrogen 99.07
cd0486860 ACT_AK-like ACT domains C-terminal to the catalytic dom 98.89
cd0492063 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AKIII ( 98.71
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensi 98.41
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensi 98.25
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal 97.83
cd0493378 ACT_AK1-AT_1 ACT domains located C-terminal to the cata 97.41
cd0493473 ACT_AK-Hom3_1 CT domains located C-terminal to the cata 97.41
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII ( 97.32
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to t 97.25
cd0489062 ACT_AK-like_1 ACT domains found C-terminal to the catal 96.72
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet unchara 96.53
COG3603128 Uncharacterized conserved protein [Function unknown] 96.33
pfam0184266 ACT ACT domain. This family of domains generally have a 96.19
LOAD_ACT76 consensus 95.73
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel protein c 95.1
cd0211660 ACT ACT domains are commonly involved in specifically b 94.76
COG383090 ACT domain-containing protein [Signal transduction mech 94.69
cd0491467 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimelate-se 94.42
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monofuncti 94.15
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel protein c 93.92
cd0491176 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to t 93.1
PRK06349432 homoserine dehydrogenase; Provisional 90.39
PRK05279441 N-acetylglutamate synthase; Validated 99.49
TIGR01890439 N-Ac-Glu-synth amino-acid N-acetyltransferase; InterPro 97.59
cd04252248 AAK_NAGK-fArgBP AAK_NAGK-fArgBP: N-Acetyl-L-glutamate k 99.35
cd04236271 AAK_NAGS-Urea AAK_NAGS-Urea: N-acetylglutamate (NAG) ki 99.2
KOG2436520 consensus 93.16
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensi 99.31
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensi 98.95
cd0492180 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctiona 98.83
cd0492466 ACT_AK-Arch_2 ACT domains of a monofunctional aspartoki 98.61
cd0491666 ACT_AKiii-YclM-BS_2 ACT domains located C-terminal to t 98.6
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to the cat 98.57
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enz 98.56
cd0489265 ACT_AK-like_2 ACT domains C-terminal to the catalytic d 98.31
PRK09466 810 metL bifunctional aspartate kinase II/homoserine dehydr 98.31
cd0493575 ACT_AKiii-DAPDC_1 ACT domains of a bifunctional AKIII ( 98.25
cd0491865 ACT_AK1-AT_2 ACT domains located C-terminal to the cata 98.2
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal 98.16
cd0493275 ACT_AKiii-LysC-EC_1 ACT domains located C-terminal to t 98.13
cd0486860 ACT_AK-like ACT domains C-terminal to the catalytic dom 98.06
cd0493663 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensi 98.06
cd0492363 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensi 98.05
cd0493764 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-se 98.04
cd0493378 ACT_AK1-AT_1 ACT domains located C-terminal to the cata 97.99
cd0493473 ACT_AK-Hom3_1 CT domains located C-terminal to the cata 97.92
cd0491764 ACT_AKiii-LysC-EC_2 ACT domains located C-terminal to t 97.8
cd0491566 ACT_AK-Ectoine_2 ACT domains located C-terminal to the 97.78
PRK08841392 aspartate kinase; Validated 97.69
KOG0456559 consensus 97.61
cd0491176 ACT_AKiii-YclM-BS_1 ACT domains located C-terminal to t 97.33
cd0489062 ACT_AK-like_1 ACT domains found C-terminal to the catal 97.05
LOAD_ACT76 consensus 97.0
cd0491467 ACT_AKi-DapG-BS_1 ACT domains of the diaminopimelate-se 96.72
pfam0184266 ACT ACT domain. This family of domains generally have a 96.08
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet unchara 95.71
PRK0019490 hypothetical protein; Validated 95.64
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal AC 95.26
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphoserine 95.19
cd0492063 ACT_AKiii-DAPDC_2 ACT domains of a bifunctional AKIII ( 95.09
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 a.a. 93.97
cd0211660 ACT ACT domains are commonly involved in specifically b 93.57
cd0491071 ACT_AK-Ectoine_1 ACT domains located C-terminal to the 93.42
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia coli 92.96
PRK04435146 hypothetical protein; Provisional 92.44
PRK1356284 acetolactate synthase 1 regulatory subunit; Provisional 91.9
COG4492150 PheB ACT domain-containing protein [General function pr 91.83
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/S 91.77
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine Cleava 91.37
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel protein c 90.53
PRK0673776 acetolactate synthase 1 regulatory subunit; Validated 90.2
PRK06291466 aspartate kinase; Provisional 98.75
COG0527447 LysC Aspartokinases [Amino acid transport and metabolis 98.57
PRK09084447 aspartate kinase III; Validated 98.48
PRK09034450 aspartate kinase; Reviewed 98.46
PRK09181476 aspartate kinase; Validated 98.39
PRK08210405 aspartate kinase I; Reviewed 98.29
PRK06635402 aspartate kinase; Reviewed 98.16
PRK08961 865 bifunctional aspartate kinase/diaminopimelate decarboxy 98.05
TIGR00656480 asp_kin_monofn asparate kinase, monofunctional class; I 97.98
COG4747142 ACT domain-containing protein [General function predict 97.34
PRK05925440 aspartate kinase; Provisional 97.19
PRK11589183 gcvR glycine cleavage system transcriptional repressor; 96.73
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; Review 96.0
CHL00100172 ilvH acetohydroxyacid synthase small subunit 95.23
PRK00275894 glnD PII uridylyl-transferase; Provisional 93.84
PRK01759862 glnD PII uridylyl-transferase; Provisional 91.46
COG0440163 IlvH Acetolactate synthase, small (regulatory) subunit 91.15
PRK05007881 PII uridylyl-transferase; Provisional 91.14
PRK05092934 PII uridylyl-transferase; Provisional 90.1
PRK03059857 PII uridylyl-transferase; Provisional 90.09
TIGR00657504 asp_kinases aspartate kinase; InterPro: IPR001341 Bacte 98.57
COG2054212 Uncharacterized archaeal kinase related to aspartokinas 98.38
COG383090 ACT domain-containing protein [Signal transduction mech 96.63
PRK0019490 hypothetical protein; Validated 96.42
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphoserine 95.56
COG4747142 ACT domain-containing protein [General function predict 91.52
>TIGR00657 asp_kinases aspartate kinase; InterPro: IPR001341 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>PRK06635 aspartate kinase; Reviewed Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homeserine dehydrogenase I; Provisional Back     alignment and domain information
>COG0527 LysC Aspartokinases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06291 aspartate kinase; Provisional Back     alignment and domain information
>PRK08210 aspartate kinase I; Reviewed Back     alignment and domain information
>PRK09034 aspartate kinase; Reviewed Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK08841 aspartate kinase; Validated Back     alignment and domain information
>PRK09084 aspartate kinase III; Validated Back     alignment and domain information
>PRK05925 aspartate kinase; Provisional Back     alignment and domain information
>PRK08961 bifunctional aspartate kinase/diaminopimelate decarboxylase protein; Provisional Back     alignment and domain information
>PRK09181 aspartate kinase; Validated Back     alignment and domain information
>KOG0456 consensus Back     alignment and domain information
>TIGR00656 asp_kin_monofn asparate kinase, monofunctional class; InterPro: IPR005260 Aspartate kinase catalyzes the first step in the biosynthesis of Lys (via its precursor diaminopimelate), Met, and Thr Back     alignment and domain information
>PRK08373 aspartate kinase; Validated Back     alignment and domain information
>TIGR02078 AspKin_pair Pyrococcus aspartate kinase subunit, putative; InterPro: IPR011819 This family consists of proteins restricted to and found as paralogous pairs (typically close together) in species of Pyrococcus, a hyperthermophilic archaeal genus Back     alignment and domain information
>cd04260 AAK_AKi-DapG-BS AAK_AKi-DapG-BS: Amino Acid Kinase Superfamily (AAK), AKi-DapG; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional class enzyme found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species Back     alignment and domain information
>cd04244 AAK_AK-LysC-like AAK_AK-LysC-like: Amino Acid Kinase Superfamily (AAK), AK-LysC-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive AK isoenzyme found in higher plants Back     alignment and domain information
>cd04246 AAK_AK-DapG-like AAK_AK-DapG-like: Amino Acid Kinase Superfamily (AAK), AK-DapG-like; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the diaminopimelate-sensitive aspartokinase isoenzyme AKI (DapG), a monofunctional enzymes found in Bacilli (Bacillus subtilis 168), Clostridia, and Actinobacteria bacterial species, as well as, the catalytic AK domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related isoenzymes Back     alignment and domain information
>cd04261 AAK_AKii-LysC-BS AAK_AKii-LysC-BS: Amino Acid Kinase Superfamily (AAK), AKii; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis 168, and the lysine plus threonine-sensitive aspartokinase of Corynebacterium glutamicum, and related sequences Back     alignment and domain information
>cd04257 AAK_AK-HSDH AAK_AK-HSDH: Amino Acid Kinase Superfamily (AAK), AK-HSDH; this CD includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04243 AAK_AK-HSDH-like AAK_AK-HSDH-like: Amino Acid Kinase Superfamily (AAK), AK-HSDH-like; this family includes the N-terminal catalytic domain of aspartokinase (AK) of the bifunctional enzyme AK- homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04258 AAK_AKiii-LysC-EC AAK_AKiii-LysC-EC: Amino Acid Kinase Superfamily (AAK), AKiii-LysC-EC: this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>cd04245 AAK_AKiii-YclM-BS AAK_AKiii-YclM-BS: Amino Acid Kinase Superfamily (AAK), AKiii-YclM-BS; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the lysine plus threonine-sensitive aspartokinase isoenzyme AKIII, a monofunctional class enzyme found in Bacilli (Bacillus subtilis YclM) and Clostridia species Back     alignment and domain information
>cd04259 AAK_AK-DapDC AAK_AK-DapDC: Amino Acid Kinase Superfamily (AAK), AK-DapDC; this CD includes the N-terminal catalytic aspartokinase (AK) domain of the bifunctional enzyme AK - DAP decarboxylase (DapDC) found in some bacteria Back     alignment and domain information
>cd04234 AAK_AK AAK_AK: Amino Acid Kinase Superfamily (AAK), Aspartokinase (AK); this CD includes the N-terminal catalytic domain of aspartokinase (4-L-aspartate-4-phosphotransferase;) Back     alignment and domain information
>cd04247 AAK_AK-Hom3 AAK_AK-Hom3: Amino Acid Kinase Superfamily (AAK), AK-Hom3; this CD includes the N-terminal catalytic domain of the aspartokinase HOM3, a monofunctional class enzyme found in Saccharomyces cerevisiae and other related AK domains Back     alignment and domain information
>cd04248 AAK_AK-Ectoine AAK_AK-Ectoine: Amino Acid Kinase Superfamily (AAK), AK-Ectoine; this CD includes the N-terminal catalytic domain of the aspartokinase of the ectoine (1,4,5,6-tetrahydro-2-methyl pyrimidine-4-carboxylate) biosynthetic pathway found in Methylomicrobium alcaliphilum, Vibrio cholerae, and other various halotolerant or halophilic bacteria Back     alignment and domain information
>cd02115 AAK Amino Acid Kinases (AAK) superfamily, catalytic domain; present in such enzymes like N-acetylglutamate kinase (NAGK), carbamate kinase (CK), aspartokinase (AK), glutamate-5-kinase (G5K) and UMP kinase (UMPK) Back     alignment and domain information
>pfam00696 AA_kinase Amino acid kinase family Back     alignment and domain information
>cd04254 AAK_UMPK-PyrH-Ec UMP kinase (UMPK)-Ec, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>PRK00358 pyrH uridylate kinase; Provisional Back     alignment and domain information
>cd04239 AAK_UMPK-like AAK_UMPK-like: UMP kinase (UMPK)-like, the microbial/chloroplast uridine monophosphate kinase (uridylate kinase) enzyme that catalyzes UMP phosphorylation and plays a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>TIGR02075 pyrH_bact uridylate kinase; InterPro: IPR015963 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>PRK12314 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>COG0528 PyrH Uridylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd04253 AAK_UMPK-PyrH-Pf AAK_UMPK-PyrH-Pf: UMP kinase (UMPK)-Pf, the mostly archaeal uridine monophosphate kinase (uridylate kinase) enzymes that catalyze UMP phosphorylation and play a key role in pyrimidine nucleotide biosynthesis; regulation of this process is via feed-back control and via gene repression of carbamoyl phosphate synthetase (the first enzyme of the pyrimidine biosynthesis pathway) Back     alignment and domain information
>PRK12443 uridylate kinase; Reviewed Back     alignment and domain information
>cd04242 AAK_G5K_ProB AAK_G5K_ProB: Glutamate-5-kinase (G5K) catalyzes glutamate-dependent ATP cleavage; G5K transfers the terminal phosphoryl group of ATP to the gamma-carboxyl group of glutamate, in the first and controlling step of proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>TIGR02076 pyrH_arch uridylate kinase, putative; InterPro: IPR011818 Uridylate kinases (also known as UMP kinases) are key enzymes in the synthesis of nucleoside triphosphates Back     alignment and domain information
>cd04256 AAK_P5CS_ProBA AAK_P5CS_ProBA: Glutamate-5-kinase (G5K) domain of the bifunctional delta 1-pyrroline-5-carboxylate synthetase (P5CS), composed of an N-terminal G5K (ProB) and a C-terminal glutamyl 5- phosphate reductase (G5PR, ProA), the first and second enzyme catalyzing proline (and, in mammals, ornithine) biosynthesis Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase; InterPro: IPR005715 L-glutamate 5-phosphotransferase, (gamma-glutamyl kinase, proB, 2 Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04241 AAK_FomA-like AAK_FomA-like: This CD includes a fosfomycin biosynthetic gene product, FomA, and similar proteins found in a wide range of organisms Back     alignment and domain information
>cd04255 AAK_UMPK-MosAB AAK_UMPK-MosAB: This CD includes the alpha and beta subunits of the Mo storage protein (MosA and MosB) which are related to uridine monophosphate kinase (UMPK) enzymes that catalyze the phosphorylation of UMP by ATP, yielding UDP, and playing a key role in pyrimidine nucleotide biosynthesis Back     alignment and domain information
>PRK00942 acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04238 AAK_NAGK-like AAK_NAGK-like: N-Acetyl-L-glutamate kinase (NAGK)-like Back     alignment and domain information
>cd04250 AAK_NAGK-C AAK_NAGK-C: N-Acetyl-L-glutamate kinase - cyclic (NAGK-C) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of arginine biosynthesis found in some bacteria and photosynthetic organisms using the non-acetylated, cyclic route of ornithine biosynthesis Back     alignment and domain information
>COG0548 ArgB Acetylglutamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00202 argB acetylglutamate kinase; Provisional Back     alignment and domain information
>cd04249 AAK_NAGK-NC AAK_NAGK-NC: N-Acetyl-L-glutamate kinase - noncyclic (NAGK-NC) catalyzes the phosphorylation of the gamma-COOH group of N-acetyl-L-glutamate (NAG) by ATP in the second step of microbial arginine biosynthesis using the acetylated, noncyclic route of ornithine biosynthesis Back     alignment and domain information
>cd04251 AAK_NAGK-UC AAK_NAGK-UC: N-Acetyl-L-glutamate kinase - uncharacterized (NAGK-UC) Back     alignment and domain information
>cd04237 AAK_NAGS-ABP AAK_NAGS-ABP: N-acetylglutamate (NAG) kinase-like domain of the NAG Synthase (NAGS) of the arginine-biosynthesis pathway (ABP) found in gamma- and beta-proteobacteria and higher plant chloroplasts Back     alignment and domain information
>TIGR00761 argB acetylglutamate kinase; InterPro: IPR004662 N -Acetylglutamate (NAG) fulfils distinct biological roles in lower and higher organisms Back     alignment and domain information
>KOG1154 consensus Back     alignment and domain information
>PRK12353 carbamate kinase; Reviewed Back     alignment and domain information
>cd04240 AAK_UC AAK_UC: Uncharacterized (UC) amino acid kinase-like proteins found mainly in archaea and a few bacteria Back     alignment and domain information
>COG1608 Predicted archaeal kinase [General function prediction only] Back     alignment and domain information
>PRK04531 acetylglutamate kinase; Provisional Back     alignment and domain information
>PRK12686 carbamate kinase; Reviewed Back     alignment and domain information
>TIGR01092 P5CS delta l-pyrroline-5-carboxylate synthetase; InterPro: IPR005766 delta l-pyrroline-5-carboxylate synthetase contains a glutamate 5-kinase (ProB, 2 Back     alignment and domain information
>PRK12454 carbamate kinase-like carbamoyl phosphate synthetase; Reviewed Back     alignment and domain information
>cd04235 AAK_CK AAK_CK: Carbamate kinase (CK) catalyzes both the ATP-phosphorylation of carbamate and carbamoyl phosphate (CP) utilization with the production of ATP from ADP and CP Back     alignment and domain information
>PRK09411 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12354 carbamate kinase; Reviewed Back     alignment and domain information
>PRK12352 putative carbamate kinase; Reviewed Back     alignment and domain information
>COG0549 ArcC Carbamate kinase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00746 arcC carbamate kinase; InterPro: IPR003964 The arginine dihydrolase (AD) pathway is found in many prokaryotes and some primitive eukaryotes Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04937 ACT_AKi-DapG-BS_2 ACT domains of the diaminopimelate-sensitive aspartokinase (AK) isoenzyme AKI Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04936 ACT_AKii-LysC-BS-like_2 ACT domains of the lysine-sensitive, aspartokinase (AK) isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information