254780872

254780872

3-demethylubiquinone-9 3-methyltransferase

GeneID in NCBI database:8209887Locus tag:CLIBASIA_03845
Protein GI in NCBI database:254780872Protein Accession:YP_003065285.1
Gene range:-(843052, 843816)Protein Length:254aa
Gene description:3-demethylubiquinone-9 3-methyltransferase
COG prediction:[H] 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase
KEGG prediction:ubiG; 3-demethylubiquinone-9 3-methyltransferase (EC:2.1.1.64); K00568 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.- 2.1.1.64]
SEED prediction:3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)
Pathway involved in KEGG:Ubiquinone and other terpenoid-quinone biosynthesis [PATH:las00130]
Subsystem involved in SEED:Ubiquinone Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250----
MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLPKTEQ
ccccccccccccHHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccEEEEEEccHHHHHHHHHHHHHcccccEEEEccccccccccccccEEEEEHHHHccccHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHcccEEEEEEEEEHHHHHHHHcccccccEEEEEEEEEcccccc
ccccccccccccHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHccccccccccccccEEEEccccccccHHHHHHcccEEEcccccccHHHHHHHHHHHccccEEEEEccHHHHHHccccccEEEEEEEEEccccHHHHHHHHHHHccccccEEEEEccccHHHHHHHHHHHHHHHHHccccccccHHcccHHHHHHHHHHccccEEEEEEEEEccccccEEcccccccHHEEEEEEccHHcc
mkkkypnyttknqDAINQFSNiasewweptgkfkplhqinpVRIKYIQDKIMqhfqcksddthpfkglrildlgcgggllsepmaqmgatvtgidpstknIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEViehvdnipYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLlqwlpkgthqydkfikpteMECFLAANKVKIIDRVGVVYNVFCNKWqlsaknmdvnymvlghlpkteq
mkkkypnyttknqdaiNQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWqlsaknmdvNYMVLGHLPKTEQ
MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLPKTEQ
***************INQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKS**THPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVL*HLP****
MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLPKTEQ
*******YTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLP****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLPKTEQ
MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLPKTEQ
MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSDDTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAIIGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMDVNYMVLGHLPKTEQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target254 3-demethylubiquinone-9 3-methyltransferase [Candidatus
254780959302 putative hydrolase serine protease transmembrane p 0.024
254780875264 protoporphyrinogen oxidase (methyltransferase) pro 0.026
>gi|254780959|ref|YP_003065372.1| putative hydrolase serine protease transmembrane protein [Candidatus Liberibacter asiaticus str. psy62] Length = 302 Back     alignment
 Score = 30.8 bits (68), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 25/45 (55%), Gaps = 1/45 (2%)

Query: 10 TKNQDAINQFSNIASEWWEPTGKFK-PLHQINPVRIKYIQDKIMQ 53
           + Q  + +F  I + + EP   FK P   +N  R+KY+Q +IM+
Sbjct: 29 ARQQAIVTRFGKIHATYREPGIYFKMPFSFMNVDRVKYLQKQIMR 73

>gi|254780875|ref|YP_003065288.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus Liberibacter asiaticus str. psy62] Length = 264 Back     alignment
 Score = 30.8 bits (68), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 23/75 (30%), Positives = 38/75 (50%), Gaps = 8/75 (10%)

Query: 68  LRILDLGCGGG-----LLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVSCA 122
           +RILDLG G G     LL E     G    G+D S K + IAK++A    ++  +    +
Sbjct: 99  VRILDLGTGTGAVCLALLKESPFFKG---VGVDISCKALEIAKSNAVTNGVSERFDTLQS 155

Query: 123 EEIAETDEKFDIILN 137
           +  +  +  FD+I++
Sbjct: 156 DWFSSVEGLFDVIVS 170

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target254 3-demethylubiquinone-9 3-methyltransferase [Candidatus
315122706253 3-demethylubiquinone-9 3-methyltransferase [Candidatus 1 1e-111
319781340249 ubiquinone biosynthesis O-methyltransferase [Mesorhizob 1 7e-78
110635331253 3-demethylubiquinone-9 3-methyltransferase [Mesorhizobi 1 9e-78
15966368248 3-demethylubiquinone-9 3-methyltransferase [Sinorhizobi 1 3e-77
15891430250 3-demethylubiquinone-9 3-methyltransferase [Agrobacteri 1 6e-77
260467155249 ubiquinone biosynthesis O-methyltransferase [Mesorhizob 1 9e-77
163759880250 3-demethylubiquinone-9 3-methyltransferase [Hoeflea pho 1 1e-76
86359343248 3-demethylubiquinone-9 3-methyltransferase [Rhizobium e 1 2e-76
13472976249 3-demethylubiquinone-9 3-methyltransferase [Mesorhizobi 1 2e-76
327193406248 3-demethylubiquinone-9 3-methyltransferase protein [Rhi 1 2e-76
>gi|315122706|ref|YP_004063195.1| 3-demethylubiquinone-9 3-methyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 253 Back     alignment and organism information
 Score =  405 bits (1041), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 197/251 (78%), Positives = 225/251 (89%)

Query: 1   MKKKYPNYTTKNQDAINQFSNIASEWWEPTGKFKPLHQINPVRIKYIQDKIMQHFQCKSD 60
           M+KKYPNYTTKNQ+ INQFSNIASEWW PTGKFKPLHQINPVR++YIQ KIMQHFQC + 
Sbjct: 1   MQKKYPNYTTKNQEEINQFSNIASEWWNPTGKFKPLHQINPVRLQYIQKKIMQHFQCDNH 60

Query: 61  DTHPFKGLRILDLGCGGGLLSEPMAQMGATVTGIDPSTKNIAIAKNHANMKNINIDYRVS 120
           D +PFKGLRILDLGCGGGLLSEP+A+MGATV GIDPS KNIA AKNHA+  NINIDYRV+
Sbjct: 61  DAYPFKGLRILDLGCGGGLLSEPIARMGATVIGIDPSPKNIATAKNHADTHNINIDYRVA 120

Query: 121 CAEEIAETDEKFDIILNMEVIEHVDNIPYFIKTCCSLLLSNGLMFISTINRNLKAMLLAI 180
           CAE+IA+TDEKFD+ILNMEVIEHV+NI YF  TCCSLLL +GLMF+STINR  KAMLLAI
Sbjct: 121 CAEDIAKTDEKFDVILNMEVIEHVNNIHYFANTCCSLLLDDGLMFVSTINRTFKAMLLAI 180

Query: 181 IGAEYLLQWLPKGTHQYDKFIKPTEMECFLAANKVKIIDRVGVVYNVFCNKWQLSAKNMD 240
           +GAEY+LQWLPKGTHQY+KF+KP E+E  LA N V++IDR+GVVY++ CNKW+LS K MD
Sbjct: 181 VGAEYVLQWLPKGTHQYEKFVKPIEIEELLAKNNVEVIDRIGVVYSILCNKWKLSEKKMD 240

Query: 241 VNYMVLGHLPK 251
           VNYM+L HLPK
Sbjct: 241 VNYMLLAHLPK 251


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|319781340|ref|YP_004140816.1| ubiquinone biosynthesis O-methyltransferase [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 249 Back     alignment and organism information
>gi|110635331|ref|YP_675539.1| 3-demethylubiquinone-9 3-methyltransferase [Mesorhizobium sp. BNC1] Length = 253 Back     alignment and organism information
>gi|15966368|ref|NP_386721.1| 3-demethylubiquinone-9 3-methyltransferase [Sinorhizobium meliloti 1021] Length = 248 Back     alignment and organism information
>gi|15891430|ref|NP_357102.1| 3-demethylubiquinone-9 3-methyltransferase [Agrobacterium tumefaciens str. C58] Length = 250 Back     alignment and organism information
>gi|260467155|ref|ZP_05813333.1| ubiquinone biosynthesis O-methyltransferase [Mesorhizobium opportunistum WSM2075] Length = 249 Back     alignment and organism information
>gi|163759880|ref|ZP_02166964.1| 3-demethylubiquinone-9 3-methyltransferase [Hoeflea phototrophica DFL-43] Length = 250 Back     alignment and organism information
>gi|86359343|ref|YP_471235.1| 3-demethylubiquinone-9 3-methyltransferase [Rhizobium etli CFN 42] Length = 248 Back     alignment and organism information
>gi|13472976|ref|NP_104543.1| 3-demethylubiquinone-9 3-methyltransferase [Mesorhizobium loti MAFF303099] Length = 249 Back     alignment and organism information
>gi|327193406|gb|EGE60306.1| 3-demethylubiquinone-9 3-methyltransferase protein [Rhizobium etli CNPAF512] Length = 248 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target254 3-demethylubiquinone-9 3-methyltransferase [Candidatus
PRK05134233 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 1e-100
TIGR01983224 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransf 3e-87
PLN02396322 PLN02396, PLN02396, hexaprenyldihydroxybenzoate methylt 7e-66
KOG1270282 KOG1270, KOG1270, KOG1270, Methyltransferases [Coenzyme 2e-57
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy 2e-73
pfam0824195 pfam08241, Methyltransf_11, Methyltransferase domain 5e-17
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisional 6e-12
COG2230283 COG2230, Cfa, Cyclopropane fatty acid synthase and rela 7e-12
PRK07580230 PRK07580, PRK07580, Mg-protoporphyrin IX methyl transfe 2e-11
PRK06202232 PRK06202, PRK06202, hypothetical protein; Provisional 4e-11
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 1e-10
COG4976287 COG4976, COG4976, Predicted methyltransferase (contains 6e-09
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase domain 2e-08
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 2e-07
PRK11705383 PRK11705, PRK11705, cyclopropane fatty acyl phospholipi 3e-07
pfam02353273 pfam02353, CMAS, Cyclopropane-fatty-acyl-phospholipid s 9e-07
COG2263198 COG2263, COG2263, Predicted RNA methylase [Translation, 2e-05
pfam05175170 pfam05175, MTS, Methyltransferase small domain 2e-05
PLN02336475 PLN02336, PLN02336, phosphoethanolamine N-methyltransfe 3e-05
PLN02585315 PLN02585, PLN02585, magnesium protoporphyrin IX methylt 3e-05
COG2890280 COG2890, HemK, Methylase of polypeptide chain release f 6e-05
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltr 1e-04
TIGR00537179 TIGR00537, hemK_rel_arch, HemK-related putative methyla 3e-04
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionin 4e-04
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransferase 6e-04
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Provisi 7e-04
KOG2904328 KOG2904, KOG2904, KOG2904, Predicted methyltransferase 8e-04
pfam05401201 pfam05401, NodS, Nodulation protein S (NodS) 8e-04
KOG1271227 KOG1271, KOG1271, KOG1271, Methyltransferases [General 0.001
KOG3010261 KOG3010, KOG3010, KOG3010, Methyltransferase [General f 0.001
PLN02244340 PLN02244, PLN02244, tocopherol O-methyltransferase 0.001
COG2518209 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltran 0.002
PRK14967223 PRK14967, PRK14967, putative methyltransferase; Provisi 0.002
PRK12335287 PRK12335, PRK12335, tellurite resistance protein TehB; 0.002
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translatio 0.003
pfam08003315 pfam08003, Methyltransf_9, Protein of unknown function 0.003
pfam03848192 pfam03848, TehB, Tellurite resistance protein TehB 0.004
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyl 6e-12
COG0500257 COG0500, SmtA, SAM-dependent methyltransferases [Second 1e-07
PRK11036255 PRK11036, PRK11036, putative S-adenosyl-L-methionine-de 1e-07
cd08267319 cd08267, MDR1, Medium chain dehydrogenases/reductase (M 2e-05
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/menaqui 9e-08
COG0357215 COG0357, GidB, Predicted S-adenosylmethionine-dependent 7e-04
TIGR01934223 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosy 8e-07
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis met 3e-06
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Transla 8e-05
KOG1499346 KOG1499, KOG1499, KOG1499, Protein arginine N-methyltra 1e-04
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases related 6e-04
COG4106257 COG4106, Tam, Trans-aconitate methyltransferase [Genera 0.002
>gnl|CDD|179944 PRK05134, PRK05134, bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>gnl|CDD|162639 TIGR01983, UbiG, ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>gnl|CDD|178018 PLN02396, PLN02396, hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>gnl|CDD|36484 KOG1270, KOG1270, KOG1270, Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|32409 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|32411 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|181047 PRK07580, PRK07580, Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>gnl|CDD|180466 PRK06202, PRK06202, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|34582 COG4976, COG4976, Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>gnl|CDD|149354 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|162684 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|183282 PRK11705, PRK11705, cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>gnl|CDD|145480 pfam02353, CMAS, Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|177970 PLN02336, PLN02336, phosphoethanolamine N-methyltransferase Back     alignment and domain information
>gnl|CDD|178197 PLN02585, PLN02585, magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>gnl|CDD|32715 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|163311 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|129628 TIGR00537, hemK_rel_arch, HemK-related putative methylase Back     alignment and domain information
>gnl|CDD|181780 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|179053 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184932 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|38115 KOG2904, KOG2904, KOG2904, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|114142 pfam05401, NodS, Nodulation protein S (NodS) Back     alignment and domain information
>gnl|CDD|36485 KOG1271, KOG1271, KOG1271, Methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|38220 KOG3010, KOG3010, KOG3010, Methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|177887 PLN02244, PLN02244, tocopherol O-methyltransferase Back     alignment and domain information
>gnl|CDD|32588 COG2518, Pcm, Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|184931 PRK14967, PRK14967, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|183450 PRK12335, PRK12335, tellurite resistance protein TehB; Provisional Back     alignment and domain information
>gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|149213 pfam08003, Methyltransf_9, Protein of unknown function (DUF1698) Back     alignment and domain information
>gnl|CDD|112651 pfam03848, TehB, Tellurite resistance protein TehB Back     alignment and domain information
>gnl|CDD|162663 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|30846 COG0500, SmtA, SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|182918 PRK11036, PRK11036, putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|176228 cd08267, MDR1, Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|30706 COG0357, GidB, Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|162613 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>gnl|CDD|178932 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|32445 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36712 KOG1499, KOG1499, KOG1499, Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones, Transcription, Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|33863 COG4106, Tam, Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 254 3-demethylubiquinone-9 3-methyltransferase [Candidatus
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 100.0
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 100.0
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 100.0
KOG1270282 consensus 100.0
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.97
PRK11036256 putative metallothionein SmtA; Provisional 99.97
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.97
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 99.96
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.95
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.9
KOG1540296 consensus 99.85
pfam03291327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 99.59
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 99.58
KOG2361264 consensus 99.52
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.5
KOG1975389 consensus 99.34
pfam07942268 N2227 N2227-like protein. This family features sequence 99.06
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 98.99
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 98.67
TIGR03438301 probable methyltransferase. This model represents a dis 98.26
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 98.04
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: 97.1
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.95
PRK05785225 hypothetical protein; Provisional 99.9
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.47
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 99.95
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 99.94
PRK08317241 hypothetical protein; Provisional 99.94
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 99.94
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 99.91
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 99.91
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 99.91
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 99.88
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 99.87
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 99.85
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 99.83
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 99.79
PRK06202233 hypothetical protein; Provisional 99.75
PRK11207198 tellurite resistance protein TehB; Provisional 99.74
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 99.71
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 99.68
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 99.67
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 99.66
pfam03848192 TehB Tellurite resistance protein TehB. 99.62
KOG4300252 consensus 99.61
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 99.61
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 99.58
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 99.58
KOG1271227 consensus 99.52
COG4106257 Tam Trans-aconitate methyltransferase [General function 99.48
PRK12335289 tellurite resistance protein TehB; Provisional 99.42
pfam05219265 DREV DREV methyltransferase. This family contains DREV 99.42
KOG2899288 consensus 99.4
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 99.39
COG4123248 Predicted O-methyltransferase [General function predict 99.37
KOG2940325 consensus 99.37
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 99.32
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 99.29
COG1092393 Predicted SAM-dependent methyltransferases [General fun 99.14
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 99.06
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 99.04
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 98.99
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 98.99
COG2521287 Predicted archaeal methyltransferase [General function 98.97
KOG3045325 consensus 98.95
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 98.92
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 98.78
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 98.78
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 98.68
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 98.63
KOG3191209 consensus 98.57
PRK01581363 speE spermidine synthase; Validated 98.41
PRK13255218 thiopurine S-methyltransferase; Reviewed 98.34
KOG3178342 consensus 98.28
COG2520341 Predicted methyltransferase [General function predictio 98.23
pfam11968220 DUF3321 Protein of unknown function (DUF3321). This fam 98.18
COG4627185 Uncharacterized protein conserved in bacteria [Function 98.14
KOG2798369 consensus 98.12
pfam04816204 DUF633 Family of unknown function (DUF633). This family 98.01
COG4262508 Predicted spermidine synthase with an N-terminal membra 97.94
pfam01269229 Fibrillarin Fibrillarin. 97.93
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 97.89
COG2384226 Predicted SAM-dependent methyltransferase [General func 97.83
PTZ00146296 fibrillarin; Provisional 97.83
pfam03721185 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase fa 97.48
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.48
pfam07091248 FmrO Ribosomal RNA methyltransferase (FmrO). This famil 96.96
TIGR00692341 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L- 96.75
COG4798238 Predicted methyltransferase [General function predictio 96.38
PRK07660283 consensus 96.21
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 96.04
TIGR00478240 tly hemolysin A; InterPro: IPR004538 Hemolysins are exo 96.03
PRK09117282 consensus 96.02
PRK13341726 recombination factor protein RarA/unknown domain fusion 95.81
PHA02056279 putative methyltransferase 95.77
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.64
TIGR01082 491 murC UDP-N-acetylmuramate--alanine ligase; InterPro: IP 95.12
KOG1269364 consensus 95.07
PRK07531 489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 94.02
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 93.34
PRK06019 377 phosphoribosylaminoimidazole carboxylase ATPase subunit 91.85
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.95
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 99.56
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 99.47
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 99.39
PRK07402196 precorrin-6B methylase; Provisional 99.36
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 99.03
KOG3987288 consensus 98.67
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 98.36
PRK04266226 fibrillarin; Provisional 98.04
pfam04672268 DUF574 Protein of unknown function (DUF574). Family of 98.03
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 97.72
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, ribo 97.29
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 99.85
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.81
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 99.81
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.59
pfam05401201 NodS Nodulation protein S (NodS). This family consists 99.53
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 99.48
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 99.41
KOG3010261 consensus 99.41
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 99.38
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 99.38
KOG1541270 consensus 99.36
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 99.36
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 99.33
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 99.32
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 99.29
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 99.27
PRK06922679 hypothetical protein; Provisional 99.25
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 99.23
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 99.23
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 99.18
KOG1499346 consensus 99.17
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 99.14
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 99.13
pfam10294171 Methyltransf_16 Putative methyltransferase. 99.12
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 99.08
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 99.06
KOG1269364 consensus 99.03
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 99.02
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 98.99
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 98.98
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 98.97
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 98.95
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 98.92
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 98.91
PRK10901428 16S rRNA methyltransferase B; Provisional 98.91
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 98.86
KOG2904328 consensus 98.83
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 98.82
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.8
KOG1500 517 consensus 98.79
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.79
COG1041347 Predicted DNA modification methylase [DNA replication, 98.74
COG0500257 SmtA SAM-dependent methyltransferases [Secondary metabo 98.72
pfam03141 506 DUF248 Putative methyltransferase. Members of this fami 98.72
COG4122219 Predicted O-methyltransferase [General function predict 98.71
KOG1661237 consensus 98.61
PRK03612516 spermidine synthase; Provisional 98.57
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 98.56
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 98.52
COG3897218 Predicted methyltransferase [General function predictio 98.52
KOG1331293 consensus 98.5
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 98.49
pfam09243275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 98.49
PRK00811283 spermidine synthase; Provisional 98.46
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 98.42
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 98.41
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 98.31
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 98.3
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 98.29
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 98.27
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 98.23
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 98.15
KOG2352 482 consensus 98.15
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 98.15
KOG2187534 consensus 98.12
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 98.02
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 97.98
KOG1663237 consensus 97.94
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 97.93
KOG2793248 consensus 97.88
PRK09880343 L-idonate 5-dehydrogenase; Provisional 97.78
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 97.74
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 97.64
KOG1709271 consensus 97.56
KOG2730263 consensus 97.54
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 97.54
pfam03269177 DUF268 Caenorhabditis protein of unknown function, DUF2 97.4
TIGR03366280 HpnZ_proposed putative phosphonate catabolism associate 97.34
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrog 97.3
KOG2920282 consensus 97.24
KOG2915314 consensus 97.23
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA deh 97.19
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 97.16
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 97.13
KOG1122460 consensus 97.12
COG0677 436 WecC UDP-N-acetyl-D-mannosaminuronate dehydrogenase [Ce 97.07
KOG3201201 consensus 97.06
PRK09422338 alcohol dehydrogenase; Provisional 97.04
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 97.0
PRK10083339 putative dehydrogenase; Provisional 97.0
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 96.98
TIGR03026 411 NDP-sugDHase nucleotide sugar dehydrogenase. All of the 96.98
COG1063350 Tdh Threonine dehydrogenase and related Zn-dependent de 96.92
KOG1501 636 consensus 96.88
PRK07417 280 arogenate dehydrogenase; Reviewed 96.87
PRK13771332 putative alcohol dehydrogenase; Provisional 96.72
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 96.71
PRK11064 415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisio 96.65
PRK07502 307 cyclohexadienyl dehydrogenase; Validated 96.55
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 96.45
PRK08268 503 3-hydroxybutyryl-CoA dehydrogenase; Validated 96.36
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 96.29
KOG0024354 consensus 96.24
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 96.22
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 96.18
COG1568354 Predicted methyltransferases [General function predicti 96.13
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 96.11
PRK06522 307 2-dehydropantoate 2-reductase; Reviewed 95.92
smart00829288 PKS_ER Enoylreductase. Enoylreductase in Polyketide syn 95.9
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 95.85
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 95.83
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.81
PRK09424 510 pntA NAD(P) transhydrogenase subunit alpha; Provisional 95.81
pfam05185447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 95.75
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.61
KOG3115249 consensus 95.5
PRK04148135 hypothetical protein; Provisional 95.48
pfam03141506 DUF248 Putative methyltransferase. Members of this fami 95.47
PRK08507275 prephenate dehydrogenase; Validated 95.45
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 95.42
PRK05708 305 2-dehydropantoate 2-reductase; Provisional 95.38
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.32
pfam01262150 AlaDh_PNT_C Alanine dehydrogenase/PNT, C-terminal domai 95.3
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.29
PRK11730 715 fadB multifunctional fatty acid oxidation complex subun 95.27
pfam00107131 ADH_zinc_N Zinc-binding dehydrogenase. 95.22
PRK04308 445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 95.15
PRK07066 321 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.12
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.85
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 94.61
COG0686371 Ald Alanine dehydrogenase [Amino acid transport and met 94.57
PRK12921 306 2-dehydropantoate 2-reductase; Provisional 94.54
pfam02558150 ApbA Ketopantoate reductase PanE/ApbA. This is a family 94.46
KOG2198375 consensus 94.46
COG0286489 HsdM Type I restriction-modification system methyltrans 94.42
PRK10754327 quinone oxidoreductase, NADPH-dependent; Provisional 94.4
PRK02472 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.35
PRK08229 341 2-dehydropantoate 2-reductase; Provisional 94.31
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 94.04
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.9
KOG4058199 consensus 93.61
KOG1253 525 consensus 93.59
PRK06249 313 2-dehydropantoate 2-reductase; Provisional 93.54
pfam11312288 DUF3115 Protein of unknown function (DUF3115). This euk 92.98
PRK08306296 dipicolinate synthase subunit A; Reviewed 92.88
PRK01710 458 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.58
PRK06500249 short chain dehydrogenase; Provisional 92.02
KOG2352482 consensus 91.91
PRK06545 357 prephenate dehydrogenase; Validated 91.73
COG1250 307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] 91.52
pfam04445235 DUF548 Protein of unknown function (DUF548). Protein of 91.38
PRK06701289 short chain dehydrogenase; Provisional 91.31
KOG1562337 consensus 91.21
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 91.17
COG0604326 Qor NADPH:quinone reductase and related Zn-dependent ox 91.07
KOG1198347 consensus 91.03
PRK00421 459 murC UDP-N-acetylmuramate--L-alanine ligase; Provisiona 90.91
COG0287279 TyrA Prephenate dehydrogenase [Amino acid transport and 90.58
PRK13984604 putative oxidoreductase; Provisional 90.26
PRK12744257 short chain dehydrogenase; Provisional 90.1
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 99.63
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 97.62
KOG1099294 consensus 92.17
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 99.01
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 98.96
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 98.94
PRK04457262 spermidine synthase; Provisional 98.68
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 98.66
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 98.37
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 98.36
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.29
PRK00536262 speE spermidine synthase; Provisional 98.16
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 98.14
COG4076252 Predicted RNA methylase [General function prediction on 97.57
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 96.9
PRK11760356 putative RNA 2'-O-ribose methyltransferase; Provisional 96.58
PRK11154 706 fadJ multifunctional fatty acid oxidation complex subun 95.5
COG4301321 Uncharacterized conserved protein [Function unknown] 92.95
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 98.95
KOG3420185 consensus 98.83
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 98.64
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 98.44
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.2
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 98.16
PTZ00338296 dimethyladenosine transferase; Provisional 98.01
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 97.9
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 97.82
KOG0820315 consensus 97.47
PRK07201663 short chain dehydrogenase; Provisional 96.82
PRK05866290 short chain dehydrogenase; Provisional 95.8
PRK07666238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.69
PRK07109 338 short chain dehydrogenase; Provisional 95.65
PRK12826253 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed 95.54
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 95.52
PRK06139 324 short chain dehydrogenase; Provisional 95.5
PRK08277278 D-mannonate oxidoreductase; Provisional 95.49
PRK08213259 gluconate 5-dehydrogenase; Provisional 95.47
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 95.39
PRK08862227 short chain dehydrogenase; Provisional 95.35
PRK06194 301 hypothetical protein; Provisional 95.3
PRK00050309 mraW S-adenosyl-methyltransferase MraW; Provisional 95.23
PRK06124259 gluconate 5-dehydrogenase; Provisional 95.12
PRK07677254 short chain dehydrogenase; Provisional 95.07
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 94.99
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 94.92
PRK05876275 short chain dehydrogenase; Provisional 94.9
PRK06949258 short chain dehydrogenase; Provisional 94.87
PRK07479252 consensus 94.81
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 94.81
PRK07576260 short chain dehydrogenase; Provisional 94.77
PRK08085254 gluconate 5-dehydrogenase; Provisional 94.7
PRK06227256 consensus 94.67
PRK06198268 short chain dehydrogenase; Provisional 94.65
PRK12939250 short chain dehydrogenase; Provisional 94.65
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogena 94.64
PRK05867253 short chain dehydrogenase; Provisional 94.63
PRK07097265 gluconate 5-dehydrogenase; Provisional 94.62
PRK08226263 short chain dehydrogenase; Provisional 94.57
PRK08589272 short chain dehydrogenase; Validated 94.54
PRK06172253 short chain dehydrogenase; Provisional 94.49
PRK06720169 hypothetical protein; Provisional 94.49
PRK07478254 short chain dehydrogenase; Provisional 94.48
PRK07814263 short chain dehydrogenase; Provisional 94.48
PRK12825250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 94.4
PRK09186255 flagellin modification protein A; Provisional 94.39
PRK07890258 short chain dehydrogenase; Provisional 94.17
PRK06181263 short chain dehydrogenase; Provisional 94.12
PRK09242258 tropinone reductase; Provisional 94.1
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 93.82
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 93.68
PRK07035252 short chain dehydrogenase; Provisional 93.57
PRK05855582 short chain dehydrogenase; Validated 93.56
PRK07774250 short chain dehydrogenase; Provisional 93.53
PRK07063259 short chain dehydrogenase; Provisional 93.42
pfam01795310 Methyltransf_5 MraW methylase family. Members of this f 93.38
PRK09291257 short chain dehydrogenase; Provisional 93.28
PRK08339263 short chain dehydrogenase; Provisional 93.27
PRK07060245 short chain dehydrogenase; Provisional 93.25
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 93.17
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 93.12
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate deh 93.11
KOG4169261 consensus 93.01
PRK05650270 short chain dehydrogenase; Provisional 92.98
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.96
COG0275314 Predicted S-adenosylmethionine-dependent methyltransfer 92.95
PRK06114262 short chain dehydrogenase; Provisional 92.91
PRK03369 487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.84
PRK06841255 short chain dehydrogenase; Provisional 92.8
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 92.79
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 92.49
PRK06346251 consensus 92.47
PRK06138252 short chain dehydrogenase; Provisional 92.44
PRK01438 481 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.4
PRK09072262 short chain dehydrogenase; Provisional 92.38
PRK08628258 short chain dehydrogenase; Provisional 92.26
PRK07231250 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 92.24
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Valid 91.6
PRK12827251 short chain dehydrogenase; Provisional 91.42
PRK08265261 short chain dehydrogenase; Provisional 91.32
PRK05875277 short chain dehydrogenase; Provisional 91.21
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisional 91.08
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 91.05
PRK06125259 short chain dehydrogenase; Provisional 90.42
COG1748 389 LYS9 Saccharopine dehydrogenase and related proteins [A 90.41
PRK07454241 short chain dehydrogenase; Provisional 90.39
PRK07832272 short chain dehydrogenase; Provisional 90.39
PRK08340259 glucose-1-dehydrogenase; Provisional 90.34
PRK11727326 putative SAM-dependent methyltransferase; Provisional 98.24
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 98.13
COG3129292 Predicted SAM-dependent methyltransferase [General func 97.08
PRK10742250 putative methyltransferase; Provisional 94.13
pfam06859110 Bin3 Bicoid-interacting protein 3 (Bin3). This family r 96.02
pfam0710997 Mg-por_mtran_C Magnesium-protoporphyrin IX methyltransf 90.13
pfam07757112 AdoMet_MTase Predicted AdoMet-dependent methyltransfera 94.96
PRK08324676 short chain dehydrogenase; Validated 94.8
PRK02006 501 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.16
PRK12829264 short chain dehydrogenase; Provisional 94.11
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 93.81
PRK12428261 3-alpha-hydroxysteroid dehydrogenase; Provisional 93.77
PRK12810 472 gltD glutamate synthase subunit beta; Reviewed 93.65
PRK05872296 short chain dehydrogenase; Provisional 93.48
PRK01390 457 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 93.28
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 93.09
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 92.69
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase 92.63
KOG2651 476 consensus 92.5
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Reviewed 92.46
PRK07062265 short chain dehydrogenase; Provisional 92.29
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Reviewed 92.19
PRK12814 652 putative NADPH-dependent glutamate synthase small subun 92.18
PRK12778 760 putative bifunctional 2-polyprenylphenol hydroxylase/gl 91.94
PRK11749 460 putative oxidoreductase; Provisional 91.59
PRK08945245 short chain dehydrogenase; Provisional 91.52
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenas 91.2
PRK06914280 short chain dehydrogenase; Provisional 91.16
PRK07067256 sorbitol dehydrogenase; Provisional 91.11
PRK07326235 short chain dehydrogenase; Provisional 91.09
pfam02636240 DUF185 Uncharacterized ACR, COG1565. This family contai 90.93
PRK08703239 short chain dehydrogenase; Provisional 90.91
COG1565370 Uncharacterized conserved protein [Function unknown] 90.68
KOG1201300 consensus 90.11
PRK06057255 short chain dehydrogenase; Provisional 90.07
PRK11524284 putative methyltransferase; Provisional 93.97
PRK13699227 putative methylase; Provisional 93.22
pfam01555221 N6_N4_Mtase DNA methylase. Members of this family are D 92.41
TIGR03253415 oxalate_frc formyl-CoA transferase. This enzyme, formyl 90.42
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>KOG1270 consensus Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase; InterPro: IPR010251 Chlorophyll and bacteriochlorophyll are essential photosynthetic pigments involved in oxygenic and non-oxygenic photosythesis respectively Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>KOG1975 consensus Back     alignment and domain information
>pfam07942 N2227 N2227-like protein Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088 Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>pfam07021 MetW Methionine biosynthesis protein MetW Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>KOG4300 consensus Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>KOG2940 consensus Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>KOG3045 consensus Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>pfam06080 DUF938 Protein of unknown function (DUF938) Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>pfam12147 Hydrolase_5 Putative lysophospholipase Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>KOG3178 consensus Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>pfam11968 DUF3321 Protein of unknown function (DUF3321) Back     alignment and domain information
>COG4627 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2798 consensus Back     alignment and domain information
>pfam04816 DUF633 Family of unknown function (DUF633) Back     alignment and domain information
>COG4262 Predicted spermidine synthase with an N-terminal membrane domain [General function prediction only] Back     alignment and domain information
>pfam01269 Fibrillarin Fibrillarin Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>COG2384 Predicted SAM-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>pfam03721 UDPG_MGDP_dh_N UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>pfam07091 FmrO Ribosomal RNA methyltransferase (FmrO) Back     alignment and domain information
>TIGR00692 tdh L-threonine 3-dehydrogenase; InterPro: IPR004627 L-threonine 3-dehydrogenase (1 Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information