254780875

254780875

protoporphyrinogen oxidase (methyltransferase) protein

GeneID in NCBI database:8209890Locus tag:CLIBASIA_03860
Protein GI in NCBI database:254780875Protein Accession:YP_003065288.1
Gene range:+(847355, 848149)Protein Length:264aa
Gene description:protoporphyrinogen oxidase (methyltransferase) protein
COG prediction:[J] Methylase of polypeptide chain release factors
KEGG prediction:hemK; protoporphyrinogen oxidase (methyltransferase) protein; K02493 methyltransferase [EC:2.1.1.-]
SEED prediction:Methylase of polypeptide chain release factors
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
ccHHHHHHHHHHHHHcccHHHHHHcccccccHHHHHHHHHHHHHHHccccHHHHHcccccccEEEEcccccccccccHHHHHHHHHHHHHHHcccccccEEEEEcccHHHHHHHHHHHccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEccccccccccEEEEEEccccccccHHHHccHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccEEEEEEcHHHHHHHHHHHHHccccEEEEEEcccccccEEEEEc
ccHHHHHHHHHHHHHcccccEEEEcccccccHHHHHHHHHHHHHHHccccEEEEEEEEEEccccEEEccccccccccHHHHHHHHHHHHHHHccccccccEEcccccHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHccccccEEEEEcccccHcHccccEEEccccccccccHcHccccccccccHHHcccccccHHHHHHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHccccEEEEEEccccccEEEEEcc
MQALRDSHSFLCRvtglsshqvivdpdsvlddrqRFFLTNAIVRSLKHESIHRILGWRDFYNVRltlssdtfeprpeteLLVDSALafslpriekrdVVRILDLGTGTGAVCLALLkespffkgvgvdISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDvivsnppyieSVIVDclglevrdfdprisldggidglsHYRTIADGVSrhlnkdglcsveigynqKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
MQALRDSHSFLCrvtglsshqvivdpdsvlDDRQRFFLTNAIvrslkhesihrilgwRDFYNVRLTLSSDTFEPRPETELLVDSALafslpriekrdvVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLvnafkdyggndrvllfcr
MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
*QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
*QALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR
MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDFYNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESPFFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIVDCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFESRKLFLVNAFKDYGGNDRVLLFCR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target264 protoporphyrinogen oxidase (methyltransferase) protein
315122703293 protoporphyrinogen oxidase (methyltransferase) protein 1 1e-109
332716893289 protoporphyrinogen oxidase protein [Agrobacterium sp. H 1 2e-64
222087302291 protoporphyrinogen oxidase (methyltransferase) protein 1 9e-63
15890802289 protoporphyrinogen oxidase [Agrobacterium tumefaciens s 1 2e-62
209551099286 protein-(glutamine-N5) methyltransferase, release facto 1 6e-62
116254018286 protein methyltransferase [Rhizobium leguminosarum bv. 1 1e-60
260467161292 modification methylase, HemK family [Mesorhizobium oppo 1 3e-60
86359339286 protoporphyrinogen oxidase (methyltransferase) protein 1 1e-59
241206501286 modification methylase, HemK family [Rhizobium legumino 1 2e-59
327193409279 protoporphyrinogen oxidase (methyltransferase) protein 1 2e-59
>gi|315122703|ref|YP_004063192.1| protoporphyrinogen oxidase (methyltransferase) protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 293 Back     alignment and organism information
 Score =  397 bits (1020), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 189/264 (71%), Positives = 222/264 (84%)

Query: 1   MQALRDSHSFLCRVTGLSSHQVIVDPDSVLDDRQRFFLTNAIVRSLKHESIHRILGWRDF 60
           +Q LR+  SFLC VTGLSS QVI  PD++LDD QR  L  A++RSL +ESIHRI GWRDF
Sbjct: 30  LQGLRNPRSFLCGVTGLSSCQVIACPDTILDDEQRLLLKKAVIRSLNYESIHRICGWRDF 89

Query: 61  YNVRLTLSSDTFEPRPETELLVDSALAFSLPRIEKRDVVRILDLGTGTGAVCLALLKESP 120
           YNVRL LSSDTFEPRPETELLVDS L+F L +  K+   RILDLG G+GA+CLALLKE+ 
Sbjct: 90  YNVRLALSSDTFEPRPETELLVDSILSFFLSQRGKKKDARILDLGMGSGAICLALLKENS 149

Query: 121 FFKGVGVDISCKALEIAKSNAVTNGVSERFDTLQSDWFSSVEGLFDVIVSNPPYIESVIV 180
           FF+G+GVDIS KALEIA+ NAV NG+S+RF  LQS+WFSS+EG FD+IVSNPPYIES +V
Sbjct: 150 FFEGLGVDISSKALEIARKNAVANGLSKRFSALQSNWFSSIEGFFDIIVSNPPYIESAVV 209

Query: 181 DCLGLEVRDFDPRISLDGGIDGLSHYRTIADGVSRHLNKDGLCSVEIGYNQKVDVVRIFE 240
           D LG EV++FDP I+LDGG DGLSHYR IADGVSRHL+K+G C +EIGYNQK+DV+RIFE
Sbjct: 210 DKLGPEVKNFDPVIALDGGPDGLSHYRVIADGVSRHLSKNGFCGLEIGYNQKIDVIRIFE 269

Query: 241 SRKLFLVNAFKDYGGNDRVLLFCR 264
            +KLFLVN+FKDY  NDR+LLFCR
Sbjct: 270 DKKLFLVNSFKDYEKNDRILLFCR 293


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|332716893|ref|YP_004444359.1| protoporphyrinogen oxidase protein [Agrobacterium sp. H13-3] Length = 289 Back     alignment and organism information
>gi|222087302|ref|YP_002545839.1| protoporphyrinogen oxidase (methyltransferase) protein [Agrobacterium radiobacter K84] Length = 291 Back     alignment and organism information
>gi|15890802|ref|NP_356474.1| protoporphyrinogen oxidase [Agrobacterium tumefaciens str. C58] Length = 289 Back     alignment and organism information
>gi|209551099|ref|YP_002283016.1| protein-(glutamine-N5) methyltransferase, release factor-specific [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 286 Back     alignment and organism information
>gi|116254018|ref|YP_769856.1| protein methyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 286 Back     alignment and organism information
>gi|260467161|ref|ZP_05813339.1| modification methylase, HemK family [Mesorhizobium opportunistum WSM2075] Length = 292 Back     alignment and organism information
>gi|86359339|ref|YP_471231.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium etli CFN 42] Length = 286 Back     alignment and organism information
>gi|241206501|ref|YP_002977597.1| modification methylase, HemK family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 286 Back     alignment and organism information
>gi|327193409|gb|EGE60309.1| protoporphyrinogen oxidase (methyltransferase) protein [Rhizobium etli CNPAF512] Length = 279 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target264 protoporphyrinogen oxidase (methyltransferase) protein
PRK09328275 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionin 3e-73
TIGR03534251 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltr 1e-69
TIGR00536284 TIGR00536, hemK_fam, HemK family putative methylases 9e-40
PRK14966423 PRK14966, PRK14966, unknown domain/N5-glutamine S-adeno 5e-29
KOG2904328 KOG2904, KOG2904, KOG2904, Predicted methyltransferase 1e-28
COG2890280 COG2890, HemK, Methylase of polypeptide chain release f 1e-54
PRK01544 506 PRK01544, PRK01544, bifunctional N5-glutamine S-adenosy 3e-35
TIGR03704251 TIGR03704, PrmC_rel_meth, putative protein-(glutamine-N 6e-22
KOG3191209 KOG3191, KOG3191, KOG3191, Predicted N6-DNA-methyltrans 2e-11
TIGR03533284 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyl 1e-24
PRK11805307 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-methionin 3e-23
PRK14968188 PRK14968, PRK14968, putative methyltransferase; Provisi 5e-16
TIGR00537179 TIGR00537, hemK_rel_arch, HemK-related putative methyla 5e-12
PRK14967223 PRK14967, PRK14967, putative methyltransferase; Provisi 1e-11
COG2264300 COG2264, PrmA, Ribosomal protein L11 methylase [Transla 3e-07
COG2813300 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translatio 1e-13
pfam05175170 pfam05175, MTS, Methyltransferase small domain 3e-12
COG4123248 COG4123, COG4123, Predicted O-methyltransferase [Genera 3e-12
PRK09489342 PRK09489, rsmC, 16S ribosomal RNA m2G1207 methyltransfe 3e-08
pfam06325294 pfam06325, PrmA, Ribosomal protein L11 methyltransferas 2e-07
cd02440107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent 4e-07
TIGR00406288 TIGR00406, prmA, ribosomal protein L11 methyltransferas 6e-07
PRK00517250 PRK00517, prmA, ribosomal protein L11 methyltransferase 3e-06
COG2263198 COG2263, COG2263, Predicted RNA methylase [Translation, 7e-06
KOG1271227 KOG1271, KOG1271, KOG1271, Methyltransferases [General 8e-06
COG2227243 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy 2e-05
pfam01170171 pfam01170, UPF0020, Putative RNA methylase family UPF00 3e-05
COG1867 380 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltrans 3e-05
pfam0824298 pfam08242, Methyltransf_12, Methyltransferase domain 3e-05
TIGR02072240 TIGR02072, BioC, biotin biosynthesis protein BioC 4e-05
COG1092393 COG1092, COG1092, Predicted SAM-dependent methyltransfe 2e-04
PRK07580230 PRK07580, PRK07580, Mg-protoporphyrin IX methyl transfe 2e-04
PRK00216239 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis met 3e-04
PRK15001378 PRK15001, PRK15001, SAM-dependent 23S ribosomal RNA mG1 6e-04
pfam09445165 pfam09445, Methyltransf_15, RNA cap guanine-N2 methyltr 7e-04
pfam0824195 pfam08241, Methyltransf_11, Methyltransferase domain 8e-04
COG0286 489 COG0286, HsdM, Type I restriction-modification system m 0.001
TIGR00308 374 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransfera 0.001
pfam02384312 pfam02384, N6_Mtase, N-6 DNA Methylase 0.002
COG2230283 COG2230, Cfa, Cyclopropane fatty acid synthase and rela 0.002
PRK04338 382 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tRNA me 0.002
TIGR02021219 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyl 0.004
COG0116381 COG0116, COG0116, Predicted N6-adenine-specific DNA met 2e-08
COG2265432 COG2265, TrmA, SAM-dependent methyltransferases related 6e-05
TIGR00479431 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase 8e-04
smart00138264 smart00138, MeTrc, Methyltransferase, chemotaxis protei 0.002
COG2226238 COG2226, UbiE, Methylase involved in ubiquinone/menaqui 4e-04
TIGR01934223 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosy 0.003
>gnl|CDD|181780 PRK09328, PRK09328, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|163311 TIGR03534, RF_mod_PrmC, protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>gnl|CDD|129627 TIGR00536, hemK_fam, HemK family putative methylases Back     alignment and domain information
>gnl|CDD|184930 PRK14966, PRK14966, unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>gnl|CDD|38115 KOG2904, KOG2904, KOG2904, Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|32715 COG2890, HemK, Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|167237 PRK01544, PRK01544, bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|163416 TIGR03704, PrmC_rel_meth, putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>gnl|CDD|38401 KOG3191, KOG3191, KOG3191, Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|163310 TIGR03533, L3_gln_methyl, protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>gnl|CDD|183320 PRK11805, PRK11805, N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|184932 PRK14968, PRK14968, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|129628 TIGR00537, hemK_rel_arch, HemK-related putative methylase Back     alignment and domain information
>gnl|CDD|184931 PRK14967, PRK14967, putative methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|32445 COG2264, PrmA, Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|32642 COG2813, RsmC, 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|147386 pfam05175, MTS, Methyltransferase small domain Back     alignment and domain information
>gnl|CDD|33880 COG4123, COG4123, Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>gnl|CDD|181902 PRK09489, rsmC, 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|148126 pfam06325, PrmA, Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>gnl|CDD|100107 cd02440, AdoMet_MTases, S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>gnl|CDD|161861 TIGR00406, prmA, ribosomal protein L11 methyltransferase Back     alignment and domain information
>gnl|CDD|179053 PRK00517, prmA, ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|32444 COG2263, COG2263, Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|36485 KOG1271, KOG1271, KOG1271, Methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|32409 COG2227, UbiG, 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|110191 pfam01170, UPF0020, Putative RNA methylase family UPF0020 Back     alignment and domain information
>gnl|CDD|32052 COG1867, TRM1, N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|149354 pfam08242, Methyltransf_12, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|162684 TIGR02072, BioC, biotin biosynthesis protein BioC Back     alignment and domain information
>gnl|CDD|31289 COG1092, COG1092, Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>gnl|CDD|181047 PRK07580, PRK07580, Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>gnl|CDD|178932 PRK00216, ubiE, ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|184963 PRK15001, PRK15001, SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|150199 pfam09445, Methyltransf_15, RNA cap guanine-N2 methyltransferase Back     alignment and domain information
>gnl|CDD|149353 pfam08241, Methyltransf_11, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|30634 COG0286, HsdM, Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|161812 TIGR00308, TRM1, tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>gnl|CDD|111293 pfam02384, N6_Mtase, N-6 DNA Methylase Back     alignment and domain information
>gnl|CDD|32411 COG2230, Cfa, Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|179832 PRK04338, PRK04338, N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|162663 TIGR02021, BchM-ChlM, magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>gnl|CDD|30465 COG0116, COG0116, Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|32446 COG2265, TrmA, SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|129571 TIGR00479, rumA, 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>gnl|CDD|128443 smart00138, MeTrc, Methyltransferase, chemotaxis proteins Back     alignment and domain information
>gnl|CDD|32408 COG2226, UbiE, Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|162613 TIGR01934, MenG_MenH_UbiE, ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 264 protoporphyrinogen oxidase (methyltransferase) protein
PRK01544 503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 100.0
PRK09328277 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 100.0
PRK09329285 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 100.0
TIGR03534251 RF_mod_HemK protein-(glutamine-N5) methyltransferase, r 100.0
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransferase, 100.0
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent methyltr 100.0
COG2890280 HemK Methylase of polypeptide chain release factors [Tr 100.0
KOG2904328 consensus 100.0
TIGR00536311 hemK_fam methyltransferase, HemK family; InterPro: IPR0 100.0
PRK11783716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 99.06
PRK00107216 gidB glucose-inhibited division protein B; Reviewed 98.99
pfam08003315 Methyltransf_9 Protein of unknown function (DUF1698). T 98.31
TIGR00452316 TIGR00452 methyltransferase, putative; InterPro: IPR010 96.94
TIGR00537183 hemK_rel_arch methylase, putative; InterPro: IPR004557 99.92
pfam05175170 MTS Methyltransferase small domain. This domain is foun 99.91
COG4123248 Predicted O-methyltransferase [General function predict 99.89
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provi 99.84
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosom 99.84
KOG3191209 consensus 99.83
PRK00517298 prmA ribosomal protein L11 methyltransferase; Reviewed 99.72
TIGR00406330 prmA ribosomal protein L11 methyltransferase; InterPro: 99.72
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, ribo 99.71
pfam06325294 PrmA Ribosomal protein L11 methyltransferase (PrmA). Th 99.69
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltransfer 99.64
TIGR01983275 UbiG ubiquinone biosynthesis O-methyltransferase; Inter 99.63
pfam05971254 Methyltransf_10 Protein of unknown function (DUF890). T 99.59
pfam01170171 UPF0020 Putative RNA methylase family UPF0020. This dom 99.59
pfam01209233 Ubie_methyltran ubiE/COQ5 methyltransferase family. 99.59
PRK11727326 putative SAM-dependent methyltransferase; Provisional 99.59
PRK05134233 3-demethylubiquinone-9 3-methyltransferase; Provisional 99.57
PRK11873258 arsM arsenite S-adenosylmethyltransferase; Reviewed 99.57
PRK01683252 trans-aconitate 2-methyltransferase; Provisional 99.55
PRK08287186 cobalt-precorrin-6Y C(15)-methyltransferase; Validated 99.5
TIGR01934242 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis meth 99.5
PRK08317241 hypothetical protein; Provisional 99.45
PRK07402196 precorrin-6B methylase; Provisional 99.44
pfam02475199 Met_10 Met-10+ like-protein. The methionine-10 mutant a 99.41
PRK11036256 putative metallothionein SmtA; Provisional 99.41
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provi 99.39
PTZ00098263 phosphoethanolamine N-methyltransferase; Provisional 99.38
TIGR02072272 BioC biotin biosynthesis protein BioC; InterPro: IPR011 99.35
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone biosy 99.34
pfam02353273 CMAS Cyclopropane-fatty-acyl-phospholipid synthase. Thi 99.34
PRK03522375 rumB 23S rRNA methyluridine methyltransferase; Reviewed 99.33
PRK10909198 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional 99.33
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzo 99.33
pfam02384312 N6_Mtase N-6 DNA Methylase. Restriction-modification (R 99.31
PRK13168440 rumA 23S rRNA 5-methyluridine methyltransferase; Review 99.3
COG2230283 Cfa Cyclopropane fatty acid synthase and related methyl 99.29
pfam08704309 GCD14 tRNA methyltransferase complex GCD14 subunit. GCD 99.24
COG1092393 Predicted SAM-dependent methyltransferases [General fun 99.24
pfam03602181 Cons_hypoth95 Conserved hypothetical protein 95. 99.24
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase and rel 99.24
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] 99.23
COG2263198 Predicted RNA methylase [Translation, ribosomal structu 99.22
PRK10258251 biotin biosynthesis protein BioC; Provisional 99.21
KOG1271227 consensus 99.16
TIGR02469135 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylat 99.14
COG0742187 N6-adenine-specific methylase [DNA replication, recombi 99.14
PRK11207198 tellurite resistance protein TehB; Provisional 99.12
KOG2187534 consensus 99.11
COG2265432 TrmA SAM-dependent methyltransferases related to tRNA ( 99.11
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA replic 99.1
COG1041347 Predicted DNA modification methylase [DNA replication, 99.09
pfam10294171 Methyltransf_16 Putative methyltransferase. 99.09
PRK05031363 tRNA (uracil-5-)-methyltransferase; Validated 99.07
KOG2912 419 consensus 99.06
pfam05958353 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase. Thi 99.02
COG0286 489 HsdM Type I restriction-modification system methyltrans 98.96
KOG1540296 consensus 98.96
KOG2899288 consensus 98.94
COG4106257 Tam Trans-aconitate methyltransferase [General function 98.93
pfam03848192 TehB Tellurite resistance protein TehB. 98.92
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Provisio 98.91
pfam01135205 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransf 98.88
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provisional 98.85
pfam01596204 Methyltransf_3 O-methyltransferase. Members of this fam 98.83
COG2520341 Predicted methyltransferase [General function predictio 98.83
TIGR00091216 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; Inter 98.83
COG4122219 Predicted O-methyltransferase [General function predict 98.82
PRK10901428 16S rRNA methyltransferase B; Provisional 98.69
KOG1499 346 consensus 98.68
PRK00312213 pcm protein-L-isoaspartate O-methyltransferase; Reviewe 98.67
PRK13942214 protein-L-isoaspartate O-methyltransferase; Provisional 98.67
COG2521287 Predicted archaeal methyltransferase [General function 98.66
COG4976287 Predicted methyltransferase (contains TPR repeat) [Gene 98.66
pfam02527184 GidB rRNA small subunit methyltransferase G. This is a 98.61
TIGR02987 603 met_A_Alw26 type II restriction m6 adenine DNA methyltr 98.6
PRK12335289 tellurite resistance protein TehB; Provisional 98.58
PRK04457262 spermidine synthase; Provisional 98.58
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Methylate 98.57
pfam05401201 NodS Nodulation protein S (NodS). This family consists 98.54
KOG1541270 consensus 98.51
COG1352268 CheR Methylase of chemotaxis methyl-accepting proteins 98.49
PRK05785225 hypothetical protein; Provisional 98.47
pfam02390199 Methyltransf_4 Putative methyltransferase. This is a fa 98.46
PRK10611287 chemotaxis methyltransferase CheR; Provisional 98.45
KOG2361264 consensus 98.44
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.44
KOG1500 517 consensus 98.36
pfam01739194 CheR CheR methyltransferase, SAM binding domain. CheR p 98.35
COG0220227 Predicted S-adenosylmethionine-dependent methyltransfer 98.31
TIGR00095210 TIGR00095 putative methyltransferase; InterPro: IPR0043 98.24
pfam01189277 Nol1_Nop2_Fmu NOL1/NOP2/sun family. 98.23
PRK11933 471 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Revi 98.16
TIGR00477239 tehB tellurite resistance protein TehB; InterPro: IPR00 98.15
PRK00811283 spermidine synthase; Provisional 98.1
PRK03612516 spermidine synthase; Provisional 98.09
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 98.06
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methylt 98.03
pfam01564240 Spermine_synth Spermine/spermidine synthase. Spermine a 98.02
pfam01728176 FtsJ FtsJ-like methyltransferase. This family consists 97.98
KOG2671421 consensus 97.97
PRK06922 679 hypothetical protein; Provisional 97.97
pfam05219265 DREV DREV methyltransferase. This family contains DREV 97.93
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translation, 97.92
) (PCMT) (which is also known as L-isoaspartyl protein carboxyl methyltransferase) is an enzyme that catalyzes the transfer of a methyl group from S- adenosylmethionine to the free carboxyl groups of D-aspartyl or L-isoaspartyl residues in a variety of peptides and proteins. The enzyme does not act on normal L-aspartyl residues L-isoaspartyl and D-aspartyl are the products of the spontaneous deamidation and/or isomerization of normal L-aspartyl and L- asparaginyl residues in proteins. PCMT plays a role in the repair and/or degradation of these damaged proteins; the enzymatic methyl esterification of the abnormal residues can lead to their conversion to normal L-aspartyl residues. The SAM domain is present in most of these proteins.; GO: 0004719 protein-L-isoaspartate (D-aspartate) O-methyltransferase activity, 0006464 protein modification process." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00080">TIGR00080228 pimt protein-L-isoaspartate O-methyltransferase; InterP 97.9
TIGR00740247 TIGR00740 methyltransferase, putative; InterPro: IPR005 97.81
pfam03291 327 Pox_MCEL mRNA capping enzyme. This family of enzymes ar 97.79
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: 97.77
pfam01861243 DUF43 Protein of unknown function DUF43. This family in 97.76
pfam05724203 TPMT Thiopurine S-methyltransferase (TPMT). This family 97.75
), spermine synthase () and putrescine N-methyltransferase () . The Thermotoga maritima spermidine synthase monomer consists of two domains: an N-terminal domain composed of six beta-strands, and a Rossmann-like C- terminal domain . The larger C-terminal catalytic core domain consists of a seven-stranded beta-sheet flanked by nine alpha helices. This domain resembles a topology observed in a number of nucleotide and dinucleotide-binding enzymes, and in S-adenosyl-L-methionine (AdoMet)- dependent methyltransferase (MTases) . ; GO: 0003824 catalytic activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR00417">TIGR00417284 speE spermidine synthase; InterPro: IPR001045 Synonym(s 97.75
KOG1663237 consensus 97.7
TIGR00438192 rrmJ ribosomal RNA large subunit methyltransferase J; I 97.68
pfam05148214 Methyltransf_8 Hypothetical methyltransferase. This fam 97.68
COG3897218 Predicted methyltransferase [General function predictio 97.67
COG0421282 SpeE Spermidine synthase [Amino acid transport and meta 97.63
PRK01544503 bifunctional N5-glutamine S-adenosyl-L-methionine-depen 97.59
pfam09243275 Rsm22 Mitochondrial small ribosomal subunit Rsm22. Rsm2 97.47
TIGR03438301 probable methyltransferase. This model represents a dis 97.33
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.31
pfam05891217 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransfer 97.22
KOG2940325 consensus 97.09
KOG1661237 consensus 97.06
KOG1975 389 consensus 96.93
PRK04266226 fibrillarin; Provisional 96.87
TIGR00563487 rsmB ribosomal RNA small subunit methyltransferase B; I 96.79
KOG3045325 consensus 96.76
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism] 96.75
KOG3201201 consensus 96.74
pfam05185 447 PRMT5 PRMT5 arginine-N-methyltransferase. The human hom 96.73
KOG3987288 consensus 96.7
pfam01234261 NNMT_PNMT_TEMT NNMT/PNMT/TEMT family. 96.69
TIGR00497 516 hsdM type I restriction-modification system, M subunit; 96.66
KOG1122460 consensus 96.61
pfam01269229 Fibrillarin Fibrillarin. 96.6
TIGR01177358 TIGR01177 conserved hypothetical protein TIGR01177; Int 96.56
pfam11968220 DUF3321 Protein of unknown function (DUF3321). This fam 96.47
pfam11599249 AviRa RRNA methyltransferase AviRa. This family of prot 96.46
PRK00536262 speE spermidine synthase; Provisional 96.4
KOG1269364 consensus 96.3
KOG3115249 consensus 96.26
KOG2793248 consensus 96.19
COG4262508 Predicted spermidine synthase with an N-terminal membra 96.06
PTZ00146296 fibrillarin; Provisional 95.69
pfam03141506 DUF248 Putative methyltransferase. Members of this fami 95.41
KOG2352482 consensus 94.94
COG1189245 Predicted rRNA methylase [Translation, ribosomal struct 94.9
COG0270 328 Dcm Site-specific DNA methylase [DNA replication, recom 94.83
TIGR00446284 nop2p NOL1/NOP2/sun family putative RNA methylase; Inte 94.8
KOG4589232 consensus 93.95
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal structu 93.88
pfam04989202 CmcI Cephalosporin hydroxylase. Members of this family 93.77
KOG1709271 consensus 93.35
KOG2198375 consensus 92.52
KOG1331 293 consensus 92.08
PRK13256226 thiopurine S-methyltransferase; Reviewed 91.56
COG5459 484 Predicted rRNA methylase [Translation, ribosomal struct 91.21
smart00828224 PKS_MT Methyltransferase in polyketide synthase (PKS) e 99.59
pfam09445165 Methyltransf_15 RNA cap guanine-N2 methyltransferase. R 99.4
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methyltran 99.39
KOG1270282 consensus 99.22
pfam0824195 Methyltransf_11 Methyltransferase domain. Members of th 99.02
pfam06080201 DUF938 Protein of unknown function (DUF938). This famil 98.56
PRK00121229 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed 98.53
KOG3010261 consensus 98.46
pfam04816204 DUF633 Family of unknown function (DUF633). This family 98.45
COG2384226 Predicted SAM-dependent methyltransferase [General func 98.32
TIGR00138197 gidB methyltransferase GidB; InterPro: IPR003682 GidB ( 98.18
PHA02056279 putative methyltransferase 98.01
pfam03059277 NAS Nicotianamine synthase protein. Nicotianamine synth 97.77
pfam06962140 rRNA_methylase Putative rRNA methylase. This family con 97.46
pfam00145 319 DNA_methylase C-5 cytosine-specific DNA methylase. 97.2
cd00315 275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylase 97.19
pfam04672268 DUF574 Protein of unknown function (DUF574). Family of 95.63
KOG3178342 consensus 93.9
COG0500257 SmtA SAM-dependent methyltransferases [Secondary metabo 93.67
pfam10354166 DUF2431 Domain of unknown function (DUF2431). This is t 93.52
TIGR00675 425 dcm DNA-cytosine methyltransferase; InterPro: IPR001525 93.21
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 99.46
TIGR00755277 ksgA dimethyladenosine transferase; InterPro: IPR011530 98.67
PTZ00338296 dimethyladenosine transferase; Provisional 98.63
COG3129292 Predicted SAM-dependent methyltransferase [General func 98.62
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylation) [ 98.37
KOG2730263 consensus 98.22
pfam00398258 RrnaAD Ribosomal RNA adenine dimethylase. 98.19
PRK00274267 ksgA dimethyladenosine transferase; Reviewed 98.17
TIGR02143361 trmA_only tRNA (uracil-5-)-methyltransferase; InterPro: 97.93
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associated met 97.54
KOG4058199 consensus 95.18
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General funct 94.13
COG1565 370 Uncharacterized conserved protein [Function unknown] 91.46
TIGR02021224 BchM-ChlM magnesium protoporphyrin O-methyltransferase; 99.27
PRK06202233 hypothetical protein; Provisional 98.96
KOG3420185 consensus 98.68
PRK11783 716 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional 98.59
pfam07021193 MetW Methionine biosynthesis protein MetW. This family 98.56
TIGR02081205 metW methionine biosynthesis protein MetW; InterPro: IP 98.5
PRK13943317 protein-L-isoaspartate O-methyltransferase; Provisional 98.32
KOG0820315 consensus 98.16
TIGR02085386 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase R 98.11
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.01
pfam02005 375 TRM N2,N2-dimethylguanosine tRNA methyltransferase. Thi 98.0
COG4076252 Predicted RNA methylase [General function prediction on 97.9
PRK04338 376 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Pro 97.89
COG1867 380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Tr 97.66
TIGR03439319 methyl_EasF probable methyltransferase domain, EasF fam 97.34
pfam08123205 DOT1 Histone methylation protein DOT1. The DOT1 domain 96.76
KOG1253 525 consensus 96.69
KOG1501 636 consensus 96.3
TIGR00308 462 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase; In 95.65
pfam07091248 FmrO Ribosomal RNA methyltransferase (FmrO). This famil 95.41
KOG0822 649 consensus 95.03
KOG2078495 consensus 94.69
PRK00050 309 mraW S-adenosyl-methyltransferase MraW; Provisional 94.53
pfam01795 310 Methyltransf_5 MraW methylase family. Members of this f 93.43
KOG2920282 consensus 92.39
TIGR01444142 fkbM_fam methyltransferase, FkbM family; InterPro: IPR0 91.66
KOG1227351 consensus 91.3
pfam10672286 Methyltrans_SAM S-adenosylmethionine-dependent methyltr 99.24
TIGR00479434 rumA 23S rRNA (uracil-5-)-methyltransferase RumA; Inter 99.1
KOG2915314 consensus 98.66
COG0357215 GidB Predicted S-adenosylmethionine-dependent methyltra 98.53
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransferase [P 98.44
KOG4300252 consensus 98.38
pfam00891239 Methyltransf_2 O-methyltransferase. This family include 98.09
pfam12147311 Hydrolase_5 Putative lysophospholipase. This domain is 97.88
PRK01581363 speE spermidine synthase; Validated 97.05
pfam0824298 Methyltransf_12 Methyltransferase domain. Members of th 99.19
PRK13699227 putative methylase; Provisional 96.86
pfam07942268 N2227 N2227-like protein. This family features sequence 96.85
PRK11524284 putative methyltransferase; Provisional 96.27
KOG2798369 consensus 94.34
PRK08507 275 prephenate dehydrogenase; Validated 92.36
pfam10237161 N6-adenineMlase Probable N6-adenine methyltransferase. 96.42
pfam07669106 Eco57I Eco57I restriction endonuclease. Homologues of t 96.24
PRK13699 227 putative methylase; Provisional 94.43
pfam06859110 Bin3 Bicoid-interacting protein 3 (Bin3). This family r 93.34
pfam01555 221 N6_N4_Mtase DNA methylase. Members of this family are D 92.31
COG1568354 Predicted methyltransferases [General function predicti 96.2
PRK11524 284 putative methyltransferase; Provisional 94.2
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK09329 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_HemK protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2904 consensus Back     alignment and domain information
>TIGR00536 hemK_fam methyltransferase, HemK family; InterPro: IPR004556 The gene hemK from Escherichia coli was found to contribute to heme biosynthesis and originally suggested to be protoporphyrinogen oxidase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>PRK00107 gidB glucose-inhibited division protein B; Reviewed Back     alignment and domain information
>pfam08003 Methyltransf_9 Protein of unknown function (DUF1698) Back     alignment and domain information
>TIGR00452 TIGR00452 methyltransferase, putative; InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>TIGR00537 hemK_rel_arch methylase, putative; InterPro: IPR004557 These proteins exhibit homology to the Saccharomyces cerevisiae (yeast) ORF YDR140w (FYV9) Back     alignment and domain information
>pfam05175 MTS Methyltransferase small domain Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3191 consensus Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase; InterPro: IPR004498 Ribosomal protein L11 methyltransferase (2 Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase; InterPro: IPR010233 This entry represents an O-methyltransferase, which is believed to act at two points in the ubiquinone biosynthetic pathway in bacteria (UbiG) and mitochondria (COQ3) , Back     alignment and domain information
>pfam05971 Methyltransf_10 Protein of unknown function (DUF890) Back     alignment and domain information
>pfam01170 UPF0020 Putative RNA methylase family UPF0020 Back     alignment and domain information
>pfam01209 Ubie_methyltran ubiE/COQ5 methyltransferase family Back     alignment and domain information
>PRK11727 putative SAM-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK05134 3-demethylubiquinone-9 3-methyltransferase; Provisional Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>pfam02475 Met_10 Met-10+ like-protein Back     alignment and domain information
>PRK11036 putative metallothionein SmtA; Provisional Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC; InterPro: IPR011814 This enzyme, which is found in biotin biosynthetic gene clusters in proteobacteria, firmicutes, green-sulphur bacteria, fusobacterium and bacteroides, is believed to carry out an enzymatic step prior to the formation of pimeloyl-CoA (although attribution of this annotation is not traceable) Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>pfam02353 CMAS Cyclopropane-fatty-acyl-phospholipid synthase Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>pfam02384 N6_Mtase N-6 DNA Methylase Back     alignment and domain information
>PRK13168 rumA 23S rRNA 5-methyluridine methyltransferase; Reviewed Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>pfam08704 GCD14 tRNA methyltransferase complex GCD14 subunit Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>pfam03602 Cons_hypoth95 Conserved hypothetical protein 95 Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>KOG1271 consensus Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit; InterPro: IPR014008 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>KOG2187 consensus Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>pfam10294 Methyltransf_16 Putative methyltransferase Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>KOG2912 consensus Back     alignment and domain information
>pfam05958 tRNA_U5-meth_tr tRNA (Uracil-5-)-methyltransferase Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>KOG1540 consensus Back     alignment and domain information
>KOG2899 consensus Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>pfam03848 TehB Tellurite resistance protein TehB Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>pfam01135 PCMT Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT) Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>pfam01596 Methyltransf_3 O-methyltransferase Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00091 TIGR00091 tRNA (guanine-N(7)-)-methyltransferase; InterPro: IPR004395 This predicted S-adenosylmethionine-dependent methyltransferase is found in a single copy in most Bacteria Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG1499 consensus Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>pfam02527 GidB rRNA small subunit methyltransferase G Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family; InterPro: IPR014329 Members of this entry are the m6-adenine DNA methyltransferase protein, or a fusion protein that also carries m5 cytosine methyltransferase activity of type II restriction systems of the Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>pfam05401 NodS Nodulation protein S (NodS) Back     alignment and domain information
>KOG1541 consensus Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>pfam02390 Methyltransf_4 Putative methyltransferase Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>KOG2361 consensus Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>KOG1500 consensus Back     alignment and domain information
>pfam01739 CheR CheR methyltransferase, SAM binding domain Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00095 TIGR00095 putative methyltransferase; InterPro: IPR004398 This is a family of conserved hypothetical proteins, which includes a putative methylase Back     alignment and domain information
>pfam01189 Nol1_Nop2_Fmu NOL1/NOP2/sun family Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB; InterPro: IPR004537 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase; InterPro: IPR014122 MenG is a generic term for a methyltransferase that catalyses the last step in menaquinone biosynthesis; the exact enzymatic activity differs for different MenG because the menaquinone differ in their prenoid side chains in different species Back     alignment and domain information
>pfam01564 Spermine_synth Spermine/spermidine synthase Back     alignment and domain information
>pfam01728 FtsJ FtsJ-like methyltransferase Back     alignment and domain information
>KOG2671 consensus Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>pfam05219 DREV DREV methyltransferase Back     alignment and domain information
>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate O-methyltransferase; InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (Back     alignment and domain information
>TIGR00740 TIGR00740 methyltransferase, putative; InterPro: IPR005271 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>pfam03291 Pox_MCEL mRNA capping enzyme Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU; InterPro: IPR014088 Members of this protein family include S-adenosylmethionine-dependent C-20 methyltransferase (BchU), part of the pathway of bacteriochlorophyll c production in photosynthetic green sulphur bacteria Back     alignment and domain information
>pfam01861 DUF43 Protein of unknown function DUF43 Back     alignment and domain information
>pfam05724 TPMT Thiopurine S-methyltransferase (TPMT) Back     alignment and domain information
>TIGR00417 speE spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (Back     alignment and domain information
>KOG1663 consensus Back     alignment and domain information
>TIGR00438 rrmJ ribosomal RNA large subunit methyltransferase J; InterPro: IPR004512 The ribosomal RNA large subunit methyltransferase J 2 Back     alignment and domain information
>pfam05148 Methyltransf_8 Hypothetical methyltransferase Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>pfam09243 Rsm22 Mitochondrial small ribosomal subunit Rsm22 Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>pfam05891 Hydroxy-O-Methy Putative hydroxyindole-O-methyltransferase Back     alignment and domain information
>KOG2940 consensus Back