254780876

254780876

hypothetical protein CLIBASIA_03865

GeneID in NCBI database:8209891Locus tag:CLIBASIA_03865
Protein GI in NCBI database:254780876Protein Accession:YP_003065289.1
Gene range:+(848288, 848920)Protein Length:210aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:Eukaryotic translation initiation factor 3 subunit 10
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210
MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV
cccHHHHHHHccccccccccccccccccccEEEEcccccccEEcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEccccccHHHHHcccccccHHHccHHHHHHHHcccccccccccccccccccHHHHcccHHHccccccHHHHHccc
ccccccccccccccccccccccccccccccEEEEcccccccEEcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccHHHcccccccccccccccccccccccccccccccccccccEEEcEEccccccccccccccccccc
mrsvqqykrsrgrgsnggngsfnrknlnplvrnydsngydvkvRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALsefeaspcplieegkepifensiqpkvedvafktpdisrekdvsykkvrrrrplrprvfpnaksgnqpveatetivpqelnsdnassvdqdckv
mrsvqqykrsrgrgsnggngsfnrknlnpLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQnalsefeaspcplIEEGKEPifensiqpkvedvafktpdisrekdvsykkvrrrrplrprvfpnaksgnqpveatetivpqelnsdnassvdqdckv
MRSVQQYKrsrgrgsnggngsfnrKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVrrrrplrprVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV
********************************************GTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNR*****************************************************************************************************************************CK*
*****************GNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNS************
************************KNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEK***********************************************KVEDVAFKT*********************P**********QPVEATETIVPQE***************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV
MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV
MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARDAMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFEASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKSGNQPVEATETIVPQELNSDNASSVDQDCKV

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target210 hypothetical protein CLIBASIA_03865 [Candidatus Liberib
315122702208 hypothetical protein CKC_04770 [Candidatus Liberibacter 1 3e-57
261220923155 conserved hypothetical protein [Brucella ceti B1/94] Le 1 2e-28
195970144214 hypothetical protein SMc02434 [Sinorhizobium meliloti 1 1 8e-26
256253791144 hypothetical protein BcetB_05767 [Brucella ceti B1/94] 1 1e-25
332716894268 hypothetical protein AGROH133_13062 [Agrobacterium sp. 1 2e-25
222087301234 hypothetical protein Arad_4126 [Agrobacterium radiobact 1 2e-25
227823186212 hypothetical protein NGR_c26550 [Sinorhizobium fredii N 1 3e-25
150397698219 hypothetical protein Smed_2500 [Sinorhizobium medicae W 1 5e-25
90420191 366 conserved hypothetical protein [Aurantimonas manganoxyd 1 9e-25
86359338242 hypothetical protein RHE_CH03754 [Rhizobium etli CFN 42 1 1e-24
>gi|315122702|ref|YP_004063191.1| hypothetical protein CKC_04770 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 208 Back     alignment and organism information
 Score =  225 bits (573), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 141/210 (67%), Positives = 160/210 (76%), Gaps = 2/210 (0%)

Query: 1   MRSVQQYKRSRGRGSNGGNGSFNRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSVLARD 60
           MRS QQYKRSRGRGS+G NG+F RKNLNPLVRNYDSNGYDVKVRGTAQHIAERYS LARD
Sbjct: 1   MRSGQQYKRSRGRGSSGSNGNFGRKNLNPLVRNYDSNGYDVKVRGTAQHIAERYSALARD 60

Query: 61  AMSAGDYVVAENHLQHAEHYNRIVSMAQAQIQEKLQRDEQDDLLVKEQKERAQNALSEFE 120
           A+SAGDYVVAENH QHAEHYNRIVS+AQAQIQEKLQRDEQ++LL KE +   QNA S FE
Sbjct: 61  AISAGDYVVAENHFQHAEHYNRIVSIAQAQIQEKLQRDEQENLLSKESRGHVQNAPSGFE 120

Query: 121 ASPCPLIEEGKEPIFENSIQPKVEDVAFKTPDISREKDVSYKKVRRRRPLRPRVFPNAKS 180
            +    I+E KEP+F + IQP V D  FK P+ S EK    KKV RRR +RPRVF N K 
Sbjct: 121 DNST--IKEQKEPLFSSDIQPAVGDEVFKAPEPSLEKKAPNKKVYRRRVVRPRVFHNNKI 178

Query: 181 GNQPVEATETIVPQELNSDNASSVDQDCKV 210
            N+P E T T V  +    N+ +VD+D  +
Sbjct: 179 NNKPAEETTTSVLLQSQEVNSETVDKDFTL 208


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|261220923|ref|ZP_05935204.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 155 Back     alignment and organism information
>gi|195970144|ref|NP_386715.2| hypothetical protein SMc02434 [Sinorhizobium meliloti 1021] Length = 214 Back     alignment and organism information
>gi|256253791|ref|ZP_05459327.1| hypothetical protein BcetB_05767 [Brucella ceti B1/94] Length = 144 Back     alignment and organism information
>gi|332716894|ref|YP_004444360.1| hypothetical protein AGROH133_13062 [Agrobacterium sp. H13-3] Length = 268 Back     alignment and organism information
>gi|222087301|ref|YP_002545838.1| hypothetical protein Arad_4126 [Agrobacterium radiobacter K84] Length = 234 Back     alignment and organism information
>gi|227823186|ref|YP_002827158.1| hypothetical protein NGR_c26550 [Sinorhizobium fredii NGR234] Length = 212 Back     alignment and organism information
>gi|150397698|ref|YP_001328165.1| hypothetical protein Smed_2500 [Sinorhizobium medicae WSM419] Length = 219 Back     alignment and organism information
>gi|90420191|ref|ZP_01228099.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1] Length = 366 Back     alignment and organism information
>gi|86359338|ref|YP_471230.1| hypothetical protein RHE_CH03754 [Rhizobium etli CFN 42] Length = 242 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00