254780877

254780877

ATP-dependent Clp protease, ATP-binding subunit protein

GeneID in NCBI database:8209892Locus tag:CLIBASIA_03870
Protein GI in NCBI database:254780877Protein Accession:YP_003065290.1
Gene range:+(848964, 851525)Protein Length:853aa
Gene description:ATP-dependent Clp protease, ATP-binding subunit protein
COG prediction:[O] ATPases with chaperone activity, ATP-binding subunit
KEGG prediction:clpB; ATP-dependent Clp protease, ATP-binding subunit protein; K03695 ATP-dependent Clp protease ATP-binding subunit ClpB
SEED prediction:ClpB protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Proteolysis in bacteria, ATP-dependent;
Protein chaperones
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850---
MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
cccHHccHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHccccHHHHHHHHccccHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHccccccEEEEcccccHHHHHHHHHHHHHcccccccccccEEEEEEHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEcHHHHcccccccccHHHHHHHHHHHccccEEEEEEcccHHHHHHHHccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHccHHHHHHHHHHHHHHcccHHHHHccccHHHHHHHHHHHHcccHHHHcHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHccccccccEEEEEccccccHHHHHHHHHHHcccccccEEEEEcccccccHHHHHHccccccccccccccHHHHHHHHccccEEEEEEHHHccHHHHHHHHHHHHccEEcccccEEEccccEEEEEcccccHHHHHcccHHHHHHHHHHHHccccHHHHHHHHHEEEcccccHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccEEEEEEEccEEEEEEc
ccHcEEcHHHHHHHHHHHHHHHcccccEEcHHHHHHHHHccccccHHHHHHHccccHHHHHHHHHHHHcccccccccccccEEcHHHHHHHHHHHHHHHHHcccEEcHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHcHHcccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccEEEccccccHHHHHHHHHHHHHcccccccccccEEEEEcHHHHHHHHHHccHHHHHHHHHHHHHHHccccEEEEEEcHHHEEcccccccccccHHccHHHHHccccEEEccccHHHHHHHHHHHHHHHHHHcHHccccccHHHHHHHHHHHHHHHHHHcccEEccHHHHHHHHHccccHHcccccHHHHHHHHHHHHHccEEEccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHccccHHHHHHHHHHHHHcccccccHHccccHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHcccccccccccEEEEcccccccHHHHHHHHHHHHccccccEEEEcHHHHHHHHHHHHHccccccccccccccHHHHHHcccccEEEEHHHHHHHcHHHHHHHHHHccccccccccccEEEcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccEEEccHHHHHHHHHccccccccccHHHHHHHHHHHcHHHHHHHccccccccEEEEEEcccEEEEEEc
MNSDKYSDLMRNVLQSAQTYALAQghqnlvpeHVLHIFLEDEQGAVYSLIQcsggdiaqlKDYNQTVlskipkvtgggaqvylsQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKgrvadsvnAEQGFDALKKYCRDLTEearngkldpvigrdDEMRRAIQVLSRrtknnpvligdpgvgKTAIIEGLASriingdipeslkgkrLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVgagktdgamdasnllkpslargelhcigATTLDEYRKYIEKDPALARRFQSLlvgeptvtDTISILRGLKERYEQHHKVRISDSALVSAAVLSnryitdrflpdkaIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAgelayglipkteKELDEAEKADSTAEDMVQEVVTSDNIANIvsrwtgipvdkmleSDREKFLRIETEISKSVIGQSAAVESVSNALRRFRaglqdpqrpmgsfmflgptgvgkTELVKSLARLLfddensmiriDMSEYMEKHSVsrligsppgyvgyeeggaLTEAVRRHPYQVVLFDEIEKAHSDVHNILLQvlddgrltdsqgrtvdFRNTLIIMTSNLGaeyliedgdsvhDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKErnismdfddQVIDWlscrgydpsygarplKRVIQRYIQNPLAERVlsqtisdgdsievfvdddnlnfrvi
MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKklrkgrvadsvnaeqgfDALKKYCRDLteearngkldpvigrddeMRRAIQVlsrrtknnpvligdpgvgkTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFqsllvgeptvtdTISILRGLKERYEQHHkvrisdsalvsAAVLSNryitdrflpdkAIDLMDEASARvrmqidtkpevldeldRRIICLKIEkealkkekdsfskgrLIELEKElssleekshsltlrwqegqrKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQevvtsdnianivsrwtgipvdkmlESDREKFLRIETEisksvigqsaavESVSNALRRFRAglqdpqrpmgSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLqvlddgrltdsqgrtvdfrntLIIMTSNLGAEYLIEDGDSVHDKVMGIVRsafkpeflnrLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLsqtisdgdsievfvdddnlnfrvi
MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDsalvsaavlsNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRiiclkiekealkkekDSFSKGRLIelekelssleekshslTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
***DKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSK***********YLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLR*************FDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIE*******************************************************SMRNELAIAQRQGHFERAGELAYGLIPKT*********************VTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
********LMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTE**************DMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
*NSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADS*AEDMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVxxxxxxxxxxxxxxxxxxxxxKDSFSKGRxxxxxxxxxxxxxxxxxxxxxWQEGQRKILYxxxxxxxxxxxxxxxxxxxxxGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI
MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQLKDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETGGIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRIICLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLESMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYLIEDGDSVHDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSIEVFVDDDNLNFRVI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target853 ATP-dependent Clp protease, ATP-binding subunit protein
254780163798 ATP-dependent Clp protease ATP-binding subunit [Ca 3e-77
254780163798 ATP-dependent Clp protease ATP-binding subunit [Ca 3e-68
254780829 437 ATP-dependent protease ATP-binding subunit [Candid 9e-06
254780270 820 ATP-dependent protease La [Candidatus Liberibacter 8e-05
254780271424 ATP-dependent protease ATP-binding subunit ClpX [C 0.001
>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score =  281 bits (719), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 133/248 (53%), Positives = 183/248 (73%), Gaps = 2/248 (0%)

Query: 158 FDALKKYCRDLTEEARNGKLDPVIGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIE 217
           F AL  YC DLTE+ + GK+D ++GR +E+ R IQ+L RR+KNNP+ +GDPGVGKTAI E
Sbjct: 184 FPALSAYCVDLTEKVKKGKVDILVGRHEEINRTIQILCRRSKNNPLYVGDPGVGKTAIAE 243

Query: 218 GLASRIINGDIPESLKGKRLMALDMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFI 277
           G A +I++G +P+ L G R+ +LDMG LIAG ++RG+FEER+K ++ EI S     IL+I
Sbjct: 244 GFAKQIVDGMVPDILLGARIFSLDMGNLIAGTRYRGDFEERIKKIVKEIESY-ANAILYI 302

Query: 278 DELHVLVGAGKTDG-AMDASNLLKPSLARGELHCIGATTLDEYRKYIEKDPALARRFQSL 336
           DE+H LVGAG   G ++DASNLLKP+L+ G + CIG+TT  EYR++ EKD AL RRFQ +
Sbjct: 303 DEIHTLVGAGSASGISVDASNLLKPALSSGAVRCIGSTTYSEYRQFFEKDKALVRRFQKI 362

Query: 337 LVGEPTVTDTISILRGLKERYEQHHKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDE 396
            V EP++ D I I++G+K  +E+HH++R S  A+ +A  LS R+ T R LPDKAID++DE
Sbjct: 363 DVSEPSIEDAIEIVKGIKPYFEEHHQLRYSKEAIRAAVQLSVRHFTSRKLPDKAIDVIDE 422

Query: 397 ASARVRMQ 404
           A A   +Q
Sbjct: 423 AGASQILQ 430

>gi|254780163|ref|YP_003064576.1| ATP-dependent Clp protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 798 Back     alignment
 Score =  251 bits (641), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 127/283 (44%), Positives = 187/283 (66%), Gaps = 8/283 (2%)

Query: 562 IETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGSFMFLGPTGVGKTELVKSLARL 621
           +E  +   V GQ  A++ +S++++  RAGL DP +P+G ++F GPTGVGKTE+ K LA  
Sbjct: 471 LEKNLGTVVYGQEEAIKKLSSSIKIARAGLSDPNKPIGCYVFSGPTGVGKTEISKQLA-- 528

Query: 622 LFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGGALTEAVRRHPYQVVLFDEIEK 681
            F     ++R DMSEYME+H+VSRLIG+PPGYVG+ +GG L ++V ++PY VVL DEIEK
Sbjct: 529 -FALGVQLLRFDMSEYMERHAVSRLIGAPPGYVGFGQGGILADSVDQNPYSVVLLDEIEK 587

Query: 682 AHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNLGAEYL----IEDGDSVHDKV- 736
           +H DV NILLQ++D G LTD  G+ + FRN ++IMT+N GA  +    I  G S +D   
Sbjct: 588 SHPDVLNILLQIMDYGILTDQSGKKISFRNVILIMTTNAGALEMSKARIGFGSSRNDDAD 647

Query: 737 MGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVLSLIKERNISMDFDDQVID 796
              +R+   PEFLNRLD II F  L  + + ++V   + ++   ++E+ IS  F ++VI+
Sbjct: 648 KEALRNFLSPEFLNRLDSIIPFFPLSSDIIRQVVHKFIMKLELQLQEKGISFHFSEEVIN 707

Query: 797 WLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDSI 839
           WL   GYD   GARPL+R+I+ +++ PLA+ +L   +  G  +
Sbjct: 708 WLVSHGYDVKMGARPLERIIKEHVKVPLADEILFGKLKKGGGV 750

>gi|254780829|ref|YP_003065242.1| ATP-dependent protease ATP-binding subunit [Candidatus Liberibacter asiaticus str. psy62] Length = 437 Back     alignment
 Score = 44.3 bits (103), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 32/90 (35%), Positives = 52/90 (57%), Gaps = 10/90 (11%)

Query: 562 IETEISKSVIGQSAAVESVSNALR-RFR-----AGLQDPQRPMGSFMFLGPTGVGKTELV 615
           I +E+ + +IGQ  A  +V+ ALR R+R     A L+D   P  + + +GPTGVGKT + 
Sbjct: 12  IVSELDRYIIGQQDAKRAVAIALRNRWRRQQLPADLRDELMP-KNILLVGPTGVGKTAIS 70

Query: 616 KSLARLLFDDENSMIRIDMSEYMEKHSVSR 645
           + LARL        I+++++++ E   V R
Sbjct: 71  RRLARLA---GAPFIKVEVTKFTEIGYVGR 97

>gi|254780270|ref|YP_003064683.1| ATP-dependent protease La [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score = 40.8 bits (94), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 21/131 (16%)

Query: 601 FMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSV----SRLIGSPPGYVGY 656
             F+GP GVGKT L +S+A+         +R+ +    ++  +       IGS PG +  
Sbjct: 369 LCFVGPPGVGKTSLAQSIAK---ATGRQYVRMSLGGVYDEADIRGHRRTYIGSMPGRIIQ 425

Query: 657 EEGGALTEAVRRHPYQVVLFDEIEKAHSDVHN----ILLQVLDDGRLTDSQGRTV----D 708
               +L  A R +P  ++L DEI+K  SD+       LL+VLD  + +      +    D
Sbjct: 426 ----SLKRAKRSNP--LLLLDEIDKMGSDLRGDPSAALLEVLDPAQNSSFVDHYLEVEYD 479

Query: 709 FRNTLIIMTSN 719
             + + IMT+N
Sbjct: 480 LSDVMFIMTAN 490

>gi|254780271|ref|YP_003064684.1| ATP-dependent protease ATP-binding subunit ClpX [Candidatus Liberibacter asiaticus str. psy62] Length = 424 Back     alignment
 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/104 (25%), Positives = 52/104 (50%), Gaps = 16/104 (15%)

Query: 525 DMVQEVVTSDNIANIVSRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVE----SV 580
           ++  +++  +N ++I     GIP       + ++ LR+   + + VIGQ  A +    +V
Sbjct: 44  ELCMDIIREENKSSITKSHEGIP-------NPQEILRV---LDEYVIGQGQAKKVLAVAV 93

Query: 581 SNALRRFRAGLQDPQRPMG--SFMFLGPTGVGKTELVKSLARLL 622
            N  +R     +     +   + + +GPTG GKT L ++LAR++
Sbjct: 94  HNHYKRLAHSSKSSNVELAKSNILLVGPTGCGKTYLAQTLARII 137

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target853 ATP-dependent Clp protease, ATP-binding subunit protein
315122701855 ATP-dependent Clp protease, ATP-binding subunit protein 1 0.0
15966361868 ATP-dependent protease [Sinorhizobium meliloti 1021] Le 1 0.0
222149908868 ATP-dependent Clp protease ATP-binding subunit [Agrobac 1 0.0
241206499866 ATP-dependent chaperone ClpB [Rhizobium leguminosarum b 1 0.0
307313053868 ATP-dependent chaperone ClpB [Sinorhizobium meliloti BL 1 0.0
159186054874 ATP-dependent Clp protease, ATP-binding subunit [Agroba 1 0.0
209551097866 ATP-dependent chaperone ClpB [Rhizobium leguminosarum b 1 0.0
150397697868 ATPase [Sinorhizobium medicae WSM419] Length = 868 1 0.0
116254016866 chaperone ClpB (heat-shock protein) [Rhizobium legumino 1 0.0
332716895874 ATP-dependent Clp protease, ATP-binding subunit [Agroba 1 0.0
>gi|315122701|ref|YP_004063190.1| ATP-dependent Clp protease, ATP-binding subunit protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 855 Back     alignment and organism information
 Score = 1509 bits (3907), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/855 (85%), Positives = 797/855 (93%), Gaps = 2/855 (0%)

Query: 1   MNSDKYSDLMRNVLQSAQTYALAQGHQNLVPEHVLHIFLEDEQGAVYSLIQCSGGDIAQL 60
           MNSDKYS+LMR  L S+Q YALAQGHQNLVPEH+LH FLED +G +  LIQ SGGD+ +L
Sbjct: 1   MNSDKYSELMRKFLHSSQAYALAQGHQNLVPEHLLHTFLEDAEGFICLLIQSSGGDLGKL 60

Query: 61  KDYNQTVLSKIPKVTGGGAQVYLSQPLAVILSKSEEIAKKSGDSFVTAEKFLLAMVMETG 120
           ++ N++ LSKIPKVTGGG QVYLSQPLA ILSK+EEIAKKSGDSFVTAEK LLAM++   
Sbjct: 61  RNANRSALSKIPKVTGGGGQVYLSQPLAAILSKAEEIAKKSGDSFVTAEKVLLAMILAKE 120

Query: 121 GIGESLKKCGLKFSRLEESIKKLRKGRVADSVNAEQGFDALKKYCRDLTEEARNGKLDPV 180
            +G+SLKKCG+  +RLEESIKKLRKGRVADS NAEQGFDALKKYCRDLT EAR+GKLDPV
Sbjct: 121 SVGDSLKKCGISINRLEESIKKLRKGRVADSANAEQGFDALKKYCRDLTAEARDGKLDPV 180

Query: 181 IGRDDEMRRAIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIINGDIPESLKGKRLMAL 240
           IGRDDEMRR+IQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRI+NGD+PESLK KRLMAL
Sbjct: 181 IGRDDEMRRSIQVLSRRTKNNPVLIGDPGVGKTAIIEGLASRIVNGDVPESLKDKRLMAL 240

Query: 241 DMGALIAGAKFRGEFEERLKSLLCEIRSEDGEIILFIDELHVLVGAGKTDGAMDASNLLK 300
           D+GALIAGAKFRGEFEERLKSL+ EIRSE+GEI+LFIDELH+LVGAGKTDGAMDASNLLK
Sbjct: 241 DIGALIAGAKFRGEFEERLKSLIGEIRSENGEIVLFIDELHILVGAGKTDGAMDASNLLK 300

Query: 301 PSLARGELHCIGATTLDEYRKYIEKDPALARRFQSLLVGEPTVTDTISILRGLKERYEQH 360
           PSLARGELHCIGATTLDEYRKYIEKDPALARRFQS+LVGEPTV DT+SILRGLKERYEQH
Sbjct: 301 PSLARGELHCIGATTLDEYRKYIEKDPALARRFQSILVGEPTVADTVSILRGLKERYEQH 360

Query: 361 HKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEVLDELDRRII 420
           HKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPE LDE DRRII
Sbjct: 361 HKVRISDSALVSAAVLSNRYITDRFLPDKAIDLMDEASARVRMQIDTKPEALDEFDRRII 420

Query: 421 CLKIEKEALKKEKDSFSKGRLIELEKELSSLEEKSHSLTLRWQEGQRKILYVADLKKRLE 480
           CLKIEKEALKKEKD  SK RL++LEKEL+SLEEK+HSLTLRWQEGQRK+ Y ADLKKRLE
Sbjct: 421 CLKIEKEALKKEKDQSSKDRLLDLEKELASLEEKAHSLTLRWQEGQRKLFYAADLKKRLE 480

Query: 481 SMRNELAIAQRQGHFERAGELAYGLIPKTEKELDEAEKADSTAEDMVQEVVTSDNIANIV 540
           SMRNELAI QRQG FERAGEL   LIPK EKELDEAEKA   AED+VQEVVTSDNIA+IV
Sbjct: 481 SMRNELAIVQRQGQFERAGELVNLLIPKAEKELDEAEKAGGVAEDIVQEVVTSDNIASIV 540

Query: 541 SRWTGIPVDKMLESDREKFLRIETEISKSVIGQSAAVESVSNALRRFRAGLQDPQRPMGS 600
           S WTGIPVDKML SDREKF+RIE EISKSV+GQSAA+ESVS+ALRRFRAGLQDP+RPMGS
Sbjct: 541 SSWTGIPVDKMLASDREKFVRIEEEISKSVVGQSAAIESVSHALRRFRAGLQDPRRPMGS 600

Query: 601 FMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGSPPGYVGYEEGG 660
           FMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIG+PPGYVGYEEGG
Sbjct: 601 FMFLGPTGVGKTELVKSLARLLFDDENSMIRIDMSEYMEKHSVSRLIGAPPGYVGYEEGG 660

Query: 661 ALTEAVRRHPYQVVLFDEIEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNL 720
            LTEAVRRHPYQVVLFDE+EKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNL
Sbjct: 661 ILTEAVRRHPYQVVLFDEMEKAHSDVHNILLQVLDDGRLTDSQGRTVDFRNTLIIMTSNL 720

Query: 721 GAEYLIEDGDSV--HDKVMGIVRSAFKPEFLNRLDEIILFEKLRKEDMAKIVRIQLGRVL 778
           GAEYLI+D D+   HDKVM +VRS FKPEFLNRLDEIILF+KLR+EDMA+IVRIQL  VL
Sbjct: 721 GAEYLIKDCDATDSHDKVMQLVRSTFKPEFLNRLDEIILFQKLREEDMAQIVRIQLDMVL 780

Query: 779 SLIKERNISMDFDDQVIDWLSCRGYDPSYGARPLKRVIQRYIQNPLAERVLSQTISDGDS 838
           SLIK++NISM+F+D+VIDWLS +GYDP YGARPLKRVIQ++IQNPLAE++LSQTIS+GDS
Sbjct: 781 SLIKDKNISMNFEDEVIDWLSHKGYDPFYGARPLKRVIQKHIQNPLAEKILSQTISEGDS 840

Query: 839 IEVFVDDDNLNFRVI 853
           IEVFV++D+LNFR +
Sbjct: 841 IEVFVENDSLNFRTV 855


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15966361|ref|NP_386714.1| ATP-dependent protease [Sinorhizobium meliloti 1021] Length = 868 Back     alignment and organism information
>gi|222149908|ref|YP_002550865.1| ATP-dependent Clp protease ATP-binding subunit [Agrobacterium vitis S4] Length = 868 Back     alignment and organism information
>gi|241206499|ref|YP_002977595.1| ATP-dependent chaperone ClpB [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 866 Back     alignment and organism information
>gi|307313053|ref|ZP_07592680.1| ATP-dependent chaperone ClpB [Sinorhizobium meliloti BL225C] Length = 868 Back     alignment and organism information
>gi|159186054|ref|NP_356471.2| ATP-dependent Clp protease, ATP-binding subunit [Agrobacterium tumefaciens str. C58] Length = 874 Back     alignment and organism information
>gi|209551097|ref|YP_002283014.1| ATP-dependent chaperone ClpB [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 866 Back     alignment and organism information
>gi|150397697|ref|YP_001328164.1| ATPase [Sinorhizobium medicae WSM419] Length = 868 Back     alignment and organism information
>gi|116254016|ref|YP_769854.1| chaperone ClpB (heat-shock protein) [Rhizobium leguminosarum bv. viciae 3841] Length = 866 Back     alignment and organism information
>gi|332716895|ref|YP_004444361.1| ATP-dependent Clp protease, ATP-binding subunit [Agrobacterium sp. H13-3] Length = 874 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target853 ATP-dependent Clp protease, ATP-binding subunit protein
CHL00095821 CHL00095, clpC, Clp protease ATP binding subunit 0.0
KOG1051898 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related 0.0
TIGR03346852 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB 0.0
PRK10865857 PRK10865, PRK10865, protein disaggregation chaperone; P 0.0
TIGR03345852 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 fa 0.0
COG0542786 COG0542, ClpA, ATPases with chaperone activity, ATP-bin 0.0
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 1e-110
TIGR02639731 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding 1e-97
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-binding 1e-77
COG2204464 COG2204, AtoC, Response regulator containing CheY-like 0.002
PRK11034758 PRK11034, clpA, ATP-dependent Clp protease ATP-binding 5e-78
COG2256436 COG2256, MGS1, ATPase related to the helicase subunit o 2e-04
pfam07724168 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) 2e-77
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 1e-16
smart00382148 smart00382, AAA, ATPases associated with a variety of c 2e-12
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebrand fac 6e-05
TIGR02640262 TIGR02640, gas_vesic_GvpN, gas vesicle protein GvpN 0.003
pfam1043189 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, 7e-24
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 4e-16
pfam00004131 pfam00004, AAA, ATPase family associated with various c 1e-07
KOG0730693 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttransl 2e-04
smart00382148 smart00382, AAA, ATPases associated with a variety of c 0.001
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 1e-10
KOG2170344 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfami 1e-07
pfam07728139 pfam07728, AAA_5, AAA domain (dynein-related subfamily) 5e-10
KOG1808 1856 KOG1808, KOG1808, KOG1808, AAA ATPase containing von Wi 6e-05
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebrand fac 2e-04
pfam00004131 pfam00004, AAA, ATPase family associated with various c 0.001
TIGR00390 441 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase s 9e-05
COG1220 444 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), AT 2e-04
PRK05201 443 PRK05201, hslU, ATP-dependent protease ATP-binding subu 6e-04
COG1221403 COG1221, PspF, Transcriptional regulators containing an 1e-04
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 4e-04
pfam0286153 pfam02861, Clp_N, Clp amino terminal domain 0.001
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein; Pro 0.003
COG0714329 COG0714, COG0714, MoxR-like ATPases [General function p 0.004
>gnl|CDD|177027 CHL00095, clpC, Clp protease ATP binding subunit Back     alignment and domain information
>gnl|CDD|36269 KOG1051, KOG1051, KOG1051, Chaperone HSP104 and related ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|163223 TIGR03346, chaperone_ClpB, ATP-dependent chaperone ClpB Back     alignment and domain information
>gnl|CDD|182791 PRK10865, PRK10865, protein disaggregation chaperone; Provisional Back     alignment and domain information
>gnl|CDD|163222 TIGR03345, VI_ClpV1, type VI secretion ATPase, ClpV1 family Back     alignment and domain information
>gnl|CDD|30888 COG0542, ClpA, ATPases with chaperone activity, ATP-binding subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|162958 TIGR02639, ClpA, ATP-dependent Clp protease ATP-binding subunit clpA Back     alignment and domain information
>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182917 PRK11034, clpA, ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|32437 COG2256, MGS1, ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|116338 pfam07724, AAA_2, AAA domain (Cdc48 subfamily) Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|131688 TIGR02640, gas_vesic_GvpN, gas vesicle protein GvpN Back     alignment and domain information
>gnl|CDD|151009 pfam10431, ClpB_D2-small, C-terminal, D2-small domain, of ClpB protein Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|35949 KOG0730, KOG0730, KOG0730, AAA+-type ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|128665 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|37381 KOG2170, KOG2170, KOG2170, ATPase of the AAA+ superfamily [General function prediction only] Back     alignment and domain information
>gnl|CDD|149019 pfam07728, AAA_5, AAA domain (dynein-related subfamily) Back     alignment and domain information
>gnl|CDD|37019 KOG1808, KOG1808, KOG1808, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|34868 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|143797 pfam00004, AAA, ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>gnl|CDD|161852 TIGR00390, hslU, ATP-dependent protease HslVU, ATPase subunit Back     alignment and domain information
>gnl|CDD|31413 COG1220, HslU, ATP-dependent protease HslVU (ClpYQ), ATPase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|179962 PRK05201, hslU, ATP-dependent protease ATP-binding subunit HslU; Provisional Back     alignment and domain information
>gnl|CDD|31414 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|145814 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|145814 pfam02861, Clp_N, Clp amino terminal domain Back     alignment and domain information
>gnl|CDD|179675 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|31058 COG0714, COG0714, MoxR-like ATPases [General function prediction only] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 853 ATP-dependent Clp protease, ATP-binding subunit protein
PRK10865857 protein disaggregation chaperone; Provisional 100.0
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 100.0
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 100.0
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 100.0
CHL00095823 clpC Clp protease ATP binding subunit 100.0
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 100.0
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 100.0
KOG1051898 consensus 100.0
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 100.0
CHL00195491 ycf46 Ycf46; Provisional 99.63
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 99.3
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.25
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 99.14
pfam00004131 AAA ATPase family associated with various cellular acti 99.06
KOG0727408 consensus 98.67
KOG0744423 consensus 98.4
PRK06835330 DNA replication protein DnaC; Validated 98.23
PRK09183258 transposase/IS protein; Provisional 98.21
TIGR00678216 holB DNA polymerase III, delta' subunit; InterPro: IPR0 98.08
PRK08769319 DNA polymerase III subunit delta'; Validated 97.99
PRK06921265 hypothetical protein; Provisional 97.85
PRK07132303 DNA polymerase III subunit delta'; Validated 97.3
COG1936180 Predicted nucleotide kinase (related to CMP and AMP kin 96.99
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 96.98
PRK11889436 flhF flagellar biosynthesis regulator FlhF; Provisional 96.64
pfam01057271 Parvo_NS1 Parvovirus non-structural protein NS1. This f 96.63
TIGR00455187 apsK adenylylsulfate kinase; InterPro: IPR002891 Enzyme 96.51
KOG3347176 consensus 96.26
pfam02702211 KdpD Osmosensitive K+ channel His kinase sensor domain. 95.61
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 99.96
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 99.95
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 99.96
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 99.92
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 99.9
KOG2004 906 consensus 99.89
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 99.85
CHL00181287 cbbX CbbX; Provisional 99.38
COG1221403 PspF Transcriptional regulators containing an AAA-type 99.24
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 98.68
KOG0736953 consensus 98.64
KOG2028 554 consensus 98.6
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 98.54
COG1241682 MCM2 Predicted ATPase involved in replication control, 97.98
KOG0478804 consensus 97.24
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 99.86
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.61
KOG1942456 consensus 98.24
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 97.58
pfam10923267 DUF2791 Protein of unknown function (DUF2791). This is 95.79
KOG0730693 consensus 99.84
KOG0733802 consensus 99.81
KOG0745564 consensus 99.79
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.66
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.85
PRK05642234 DNA replication initiation factor; Validated 98.65
PRK08084235 DNA replication initiation factor; Provisional 98.6
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.55
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.53
PRK08903227 hypothetical protein; Validated 98.51
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.47
PRK08727233 hypothetical protein; Validated 98.45
PRK06893229 DNA replication initiation factor; Validated 98.41
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 98.21
KOG0743457 consensus 98.06
PRK09087226 hypothetical protein; Validated 98.0
PRK06620214 hypothetical protein; Validated 97.68
KOG0742630 consensus 97.46
KOG2680454 consensus 97.27
PRK06995404 flhF flagellar biosynthesis regulator FlhF; Validated 97.11
KOG1969 877 consensus 96.69
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 96.53
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 96.15
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 99.78
KOG0736953 consensus 99.7
KOG0735952 consensus 99.59
KOG0741744 consensus 99.42
PRK03992390 proteasome-activating nucleotidase; Provisional 99.35
CHL00176631 ftsH cell division protein; Validated 99.28
PRK04195403 replication factor C large subunit; Provisional 99.23
PRK10733644 hflB ATP-dependent metalloprotease; Reviewed 99.22
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 99.16
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.15
KOG2028554 consensus 99.07
KOG0738491 consensus 98.96
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 98.94
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 98.91
TIGR01241505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.91
KOG0730693 consensus 98.89
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.75
COG0714329 MoxR-like ATPases [General function prediction only] 98.73
KOG0734752 consensus 98.73
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.7
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.66
pfam05621302 TniB Bacterial TniB protein. This family consists of se 98.64
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.61
KOG0731774 consensus 98.61
PRK12422455 chromosomal replication initiation protein; Provisional 98.57
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.55
PRK13407334 bchI magnesium chelatase subunit I; Provisional 98.46
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.4
KOG0739439 consensus 98.37
KOG0737386 consensus 98.36
PRK10787784 DNA-binding ATP-dependent protease La; Provisional 98.35
COG0465596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.28
COG0466782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.28
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 98.26
smart00382148 AAA ATPases associated with a variety of cellular activ 98.23
TIGR00763941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.21
KOG2004906 consensus 98.15
PRK08699325 DNA polymerase III subunit delta'; Validated 97.89
COG1221403 PspF Transcriptional regulators containing an AAA-type 97.85
PRK00131175 aroK shikimate kinase; Reviewed 97.69
KOG0991333 consensus 97.68
KOG0728404 consensus 97.66
KOG0729435 consensus 97.62
KOG0745564 consensus 97.52
KOG0652424 consensus 97.48
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 97.47
KOG0743457 consensus 97.45
pfam00931285 NB-ARC NB-ARC domain. 97.4
KOG1970634 consensus 97.37
PRK05057172 aroK shikimate kinase I; Reviewed 97.27
KOG0651388 consensus 97.15
KOG0726440 consensus 97.1
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 97.1
PRK05917290 DNA polymerase III subunit delta'; Validated 97.04
PRK07940395 DNA polymerase III subunit delta'; Validated 97.02
PTZ00112650 origin recognition complex 1 protein; Provisional 97.01
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 97.01
PRK03731172 aroL shikimate kinase II; Reviewed 96.98
COG1643845 HrpA HrpA-like helicases [DNA replication, recombinatio 96.93
PRK13946195 shikimate kinase; Provisional 96.84
KOG2227529 consensus 96.68
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.37
KOG1514767 consensus 96.19
PRK13851343 type IV secretion system protein VirB11; Provisional 95.88
KOG2543438 consensus 95.51
PRK13342417 recombination factor protein RarA; Reviewed 99.68
PRK13341726 recombination factor protein RarA/unknown domain fusion 99.59
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.53
PRK12402337 replication factor C small subunit 2; Reviewed 99.43
COG2256436 MGS1 ATPase related to the helicase subunit of the Holl 99.43
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 99.33
PRK00440318 rfc replication factor C small subunit; Reviewed 99.32
PRK06647560 DNA polymerase III subunits gamma and tau; Validated 99.32
PRK06305462 DNA polymerase III subunits gamma and tau; Validated 99.32
PRK05896613 DNA polymerase III subunits gamma and tau; Validated 99.31
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 99.29
PRK08451523 DNA polymerase III subunits gamma and tau; Validated 99.29
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 99.26
PRK00411394 cdc6 cell division control protein 6; Reviewed 99.22
PRK05564313 DNA polymerase III subunit delta'; Validated 99.22
PRK07133718 DNA polymerase III subunits gamma and tau; Validated 99.22
PRK07764775 DNA polymerase III subunits gamma and tau; Validated 99.21
PRK08853717 DNA polymerase III subunits gamma and tau; Validated 99.17
PRK06645507 DNA polymerase III subunits gamma and tau; Validated 99.14
PRK08691704 DNA polymerase III subunits gamma and tau; Validated 99.12
PRK07994643 DNA polymerase III subunits gamma and tau; Validated 99.09
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 99.07
PRK09111600 DNA polymerase III subunits gamma and tau; Validated 99.07
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 99.06
TIGR02902532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.04
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.99
PRK12323721 DNA polymerase III subunits gamma and tau; Provisional 98.97
PRK05648705 DNA polymerase III subunits gamma and tau; Reviewed 98.94
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 98.92
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 98.91
PRK06872696 DNA polymerase III subunits gamma and tau; Provisional 98.89
PRK08058329 DNA polymerase III subunit delta'; Validated 98.88
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.76
TIGR02903616 spore_lon_C ATP-dependent protease, Lon family; InterPr 98.72
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 98.65
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.59
PRK08769319 DNA polymerase III subunit delta'; Validated 98.57
PRK05642234 DNA replication initiation factor; Validated 98.53
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.5
PRK08084235 DNA replication initiation factor; Provisional 98.48
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.47
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 98.46
PRK11608325 pspF phage shock protein operon transcriptional activat 98.43
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 98.42
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 98.4
PRK08727233 hypothetical protein; Validated 98.36
PRK06893229 DNA replication initiation factor; Validated 98.3
KOG0989346 consensus 98.26
PRK08903227 hypothetical protein; Validated 98.22
PRK09112352 DNA polymerase III subunit delta'; Validated 98.16
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 98.13
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 98.11
PRK05022510 anaerobic nitric oxide reductase transcription regulato 98.09
PRK07471363 DNA polymerase III subunit delta'; Validated 98.05
PRK06964342 DNA polymerase III subunit delta'; Validated 97.98
PRK07399314 DNA polymerase III subunit delta'; Validated 97.96
PRK10365441 transcriptional regulatory protein ZraR; Provisional 97.93
PRK06871324 DNA polymerase III subunit delta'; Validated 97.84
TIGR02442688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 97.65
smart00350509 MCM minichromosome maintenance proteins. 97.62
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.5
KOG2035351 consensus 97.44
PRK09087226 hypothetical protein; Validated 97.17
cd01121372 Sms Sms (bacterial radA) DNA repair protein. This prote 96.75
PRK11823454 DNA repair protein RadA; Provisional 96.66
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 96.6
COG1066456 Sms Predicted ATP-dependent serine protease [Posttransl 96.26
KOG2170344 consensus 99.6
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 99.59
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 99.57
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.55
PRK10365441 transcriptional regulatory protein ZraR; Provisional 99.52
PRK13342 417 recombination factor protein RarA; Reviewed 99.46
PRK11608325 pspF phage shock protein operon transcriptional activat 99.39
PRK03992390 proteasome-activating nucleotidase; Provisional 99.39
PRK05022510 anaerobic nitric oxide reductase transcription regulato 99.37
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 99.36
COG0714329 MoxR-like ATPases [General function prediction only] 99.35
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 99.31
COG2204464 AtoC Response regulator containing CheY-like receiver, 99.3
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 99.26
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.21
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.18
TIGR02397 363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 99.17
PRK00440318 rfc replication factor C small subunit; Reviewed 99.16
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.14
PRK12402337 replication factor C small subunit 2; Reviewed 99.13
KOG0989346 consensus 99.12
PRK04195 403 replication factor C large subunit; Provisional 99.08
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 99.06
CHL00176 631 ftsH cell division protein; Validated 99.05
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 99.04
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.03
PRK00411 394 cdc6 cell division control protein 6; Reviewed 99.02
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 98.99
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 98.93
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 98.82
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 98.81
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.8
PRK09862506 putative ATP-dependent protease; Provisional 98.78
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.76
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 98.76
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.67
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 98.66
pfam00493327 MCM MCM2/3/5 family. 98.59
KOG0731 774 consensus 98.5
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 98.39
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 98.36
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 98.34
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 98.24
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 98.2
PRK12422 455 chromosomal replication initiation protein; Provisional 98.18
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.11
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 98.07
smart00350509 MCM minichromosome maintenance proteins. 97.96
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 97.96
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 97.9
KOG0740428 consensus 97.77
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.74
pfam01637223 Arch_ATPase Archaeal ATPase. This family contain a cons 97.61
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 97.2
KOG1514 767 consensus 96.83
PTZ00112 650 origin recognition complex 1 protein; Provisional 96.13
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 95.64
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 99.59
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.06
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 99.06
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 98.04
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 97.72
pfam1043189 ClpB_D2-small C-terminal, D2-small domain, of ClpB prot 99.5
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 99.49
PRK10490895 sensor protein KdpD; Provisional 96.17
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.41
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.19
PRK12377248 putative replication protein; Provisional 98.53
smart00382148 AAA ATPases associated with a variety of cellular activ 98.46
PRK07952242 DNA replication protein DnaC; Validated 98.4
PHA02244383 ATPase-like protein 98.22
COG1484254 DnaC DNA replication protein [DNA replication, recombin 98.19
PRK06526254 transposase; Provisional 98.07
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 98.02
PRK08181269 transposase; Validated 97.96
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 97.63
PRK06090319 DNA polymerase III subunit delta'; Validated 97.5
pfam00910105 RNA_helicase RNA helicase. This family includes RNA hel 97.47
PRK06871324 DNA polymerase III subunit delta'; Validated 97.43
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pilus a 97.28
cd01129264 PulE-GspE PulE/GspE The type II secretory pathway is th 97.25
cd01131198 PilT Pilus retraction ATPase PilT. PilT is a nucleotide 97.22
PRK05707328 DNA polymerase III subunit delta'; Validated 97.19
PRK07993334 DNA polymerase III subunit delta'; Validated 97.12
PRK13894320 conjugal transfer ATPase TrbB; Provisional 96.96
PRK13900332 type IV secretion system ATPase VirB11; Provisional 96.95
PRK10436461 hypothetical protein; Provisional 96.93
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 96.92
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 96.5
PRK08699325 DNA polymerase III subunit delta'; Validated 96.24
PRK13833323 conjugal transfer protein TrbB; Provisional 96.24
pfam00448196 SRP54 SRP54-type protein, GTPase domain. This family in 96.24
PRK13851343 type IV secretion system protein VirB11; Provisional 95.98
CHL00181287 cbbX CbbX; Provisional 99.41
CHL00195491 ycf46 Ycf46; Provisional 99.39
KOG0740428 consensus 98.96
PRK07132303 DNA polymerase III subunit delta'; Validated 98.49
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.42
KOG0732 1080 consensus 98.4
pfam00493327 MCM MCM2/3/5 family. 98.3
PRK05707328 DNA polymerase III subunit delta'; Validated 98.11
KOG0744423 consensus 97.86
PRK07993334 DNA polymerase III subunit delta'; Validated 97.81
PRK06090319 DNA polymerase III subunit delta'; Validated 97.75
KOG0742630 consensus 97.29
KOG0727408 consensus 96.55
PRK13947171 shikimate kinase; Provisional 96.49
cd00464154 SK Shikimate kinase (SK) is the fifth enzyme in the shi 96.44
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 96.26
TIGR03498418 FliI_clade3 flagellar protein export ATPase FliI. Membe 95.63
KOG0478804 consensus 95.46
PRK13341726 recombination factor protein RarA/unknown domain fusion 99.31
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.31
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.22
PRK08691704 DNA polymerase III subunits gamma and tau; Validated 98.46
PRK12323721 DNA polymerase III subunits gamma and tau; Provisional 98.41
PRK07994643 DNA polymerase III subunits gamma and tau; Validated 98.35
PRK05648705 DNA polymerase III subunits gamma and tau; Reviewed 98.31
PRK08770663 DNA polymerase III subunits gamma and tau; Validated 98.26
PRK06872696 DNA polymerase III subunits gamma and tau; Provisional 98.2
pfam0286153 Clp_N Clp amino terminal domain. This short domain is f 97.41
PRK10865857 protein disaggregation chaperone; Provisional 99.31
CHL00095823 clpC Clp protease ATP binding subunit 99.26
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.13
PRK07940395 DNA polymerase III subunit delta'; Validated 99.23
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 98.94
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 98.77
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.38
PRK05917290 DNA polymerase III subunit delta'; Validated 98.21
KOG0738491 consensus 98.18
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 98.15
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 98.05
KOG0734 752 consensus 98.04
KOG0739439 consensus 98.03
KOG0651388 consensus 97.84
PRK07276290 DNA polymerase III subunit delta'; Validated 97.81
KOG0741744 consensus 97.25
PRK06731270 flhF flagellar biosynthesis regulator FlhF; Validated 97.03
pfam00931285 NB-ARC NB-ARC domain. 96.99
PRK12723388 flagellar biosynthesis regulator FlhF; Provisional 96.66
pfam02562205 PhoH PhoH-like protein. PhoH is a cytoplasmic protein a 96.15
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 99.22
PRK09112352 DNA polymerase III subunit delta'; Validated 99.19
PRK07471363 DNA polymerase III subunit delta'; Validated 99.14
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 99.04
PRK07399314 DNA polymerase III subunit delta'; Validated 99.02
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.61
PRK05564313 DNA polymerase III subunit delta'; Validated 98.6
KOG0735952 consensus 98.52
KOG0737386 consensus 98.25
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 98.05
KOG0726440 consensus 97.97
KOG0652424 consensus 97.9
PRK08058329 DNA polymerase III subunit delta'; Validated 97.73
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 96.9
pfam00004131 AAA ATPase family associated with various cellular acti 99.15
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 98.45
pfam07726131 AAA_3 ATPase family associated with various cellular ac 98.1
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 97.94
COG3854308 SpoIIIAA ncharacterized protein conserved in bacteria [ 97.84
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 97.73
COG1484254 DnaC DNA replication protein [DNA replication, recombin 97.69
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 97.54
PRK12377248 putative replication protein; Provisional 97.54
pfam03266168 DUF265 Protein of unknown function, DUF265. 97.31
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 96.85
PRK06835330 DNA replication protein DnaC; Validated 96.59
PRK11664 812 ATP-dependent RNA helicase HrpB; Provisional 96.24
PRK12608379 transcription termination factor Rho; Provisional 96.14
PRK08939306 primosomal protein DnaI; Reviewed 96.12
cd01882225 BMS1 Bms1. Bms1 is an essential, evolutionarily conserv 95.69
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.14
pfam0286153 Clp_N Clp amino terminal domain. This short domain is f 98.22
KOG1051898 consensus 97.16
PRK05563541 DNA polymerase III subunits gamma and tau; Validated 99.07
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.85
COG4650531 RtcR Sigma54-dependent transcription regulator containi 97.13
PRK07270557 DNA polymerase III subunits gamma and tau; Validated 98.89
PRK06674563 DNA polymerase III subunits gamma and tau; Validated 98.83
PRK09111600 DNA polymerase III subunits gamma and tau; Validated 98.56
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.88
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 98.15
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 97.92
PRK05896613 DNA polymerase III subunits gamma and tau; Validated 98.76
PRK07003816 DNA polymerase III subunits gamma and tau; Validated 98.74
PRK08853717 DNA polymerase III subunits gamma and tau; Validated 98.67
COG2812515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 97.42
KOG0733802 consensus 98.72
PRK04132 863 replication factor C small subunit; Provisional 98.71
PRK13765637 ATP-dependent protease Lon; Provisional 98.57
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 98.17
COG3899 849 Predicted ATPase [General function prediction only] 97.75
PRK07004460 replicative DNA helicase; Provisional 96.53
PRK08506473 replicative DNA helicase; Provisional 96.37
PRK04841 903 transcriptional regulator MalT; Provisional 96.23
pfam00025174 Arf ADP-ribosylation factor family. Pfam combines a num 96.16
COG1241682 MCM2 Predicted ATPase involved in replication control, 95.98
COG1061442 SSL2 DNA or RNA helicases of superfamily II [Transcript 95.84
PRK08760476 replicative DNA helicase; Provisional 95.79
PRK06321472 replicative DNA helicase; Provisional 95.54
cd04154173 Arl2 Arl2 subfamily. Arl2 (Arf-like 2) GTPases are memb 95.54
PRK08694468 consensus 95.52
PRK07133718 DNA polymerase III subunits gamma and tau; Validated 98.7
COG2909 894 MalT ATP-dependent transcriptional regulator [Transcrip 95.74
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.61
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 98.19
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 98.14
PRK09862506 putative ATP-dependent protease; Provisional 97.99
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 97.82
KOG1969877 consensus 97.75
PRK08181269 transposase; Validated 97.67
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.63
PRK06526254 transposase; Provisional 97.54
PRK09183258 transposase/IS protein; Provisional 97.51
PRK08116262 hypothetical protein; Validated 97.01
KOG07321080 consensus 96.91
PRK06921265 hypothetical protein; Provisional 96.76
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 96.69
PRK07952242 DNA replication protein DnaC; Validated 96.2
COG1485367 Predicted ATPase [General function prediction only] 96.14
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 96.07
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 95.99
PRK09376416 rho transcription termination factor Rho; Provisional 95.57
COG0703172 AroK Shikimate kinase [Amino acid transport and metabol 95.52
pfam06309127 Torsin Torsin. This family consists of several eukaryot 98.59
PRK05201 442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.24
PRK06696227 uridine kinase; Validated 96.89
PRK09270230 frcK putative fructose transport system kinase; Reviewe 95.49
PRK13531498 regulatory ATPase RavA; Provisional 98.57
PRK08116262 hypothetical protein; Validated 98.55
KOG0728404 consensus 98.38
PRK13531498 regulatory ATPase RavA; Provisional 98.43
PRK13406584 bchD magnesium chelatase subunit D; Provisional 96.47
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 98.24
KOG1808 1856 consensus 97.58
PRK10867453 signal recognition particle protein; Provisional 96.71
PRK13695174 putative NTPase; Provisional 96.66
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 96.53
cd01120165 RecA-like_NTPases RecA-like NTPases. This family includ 96.52
PRK00771433 signal recognition particle protein Srp54; Provisional 96.26
PRK08533230 flagellar accessory protein FlaH; Reviewed 96.23
cd04176163 Rap2 Rap2 subgroup. The Rap2 subgroup is part of the Ra 95.83
PRK00091304 miaA tRNA delta(2)-isopentenylpyrophosphate transferase 95.83
pfam04851103 ResIII Type III restriction enzyme, res subunit. 95.8
cd01124187 KaiC KaiC is a circadian clock protein primarily found 95.62
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 95.56
PRK13948182 shikimate kinase; Provisional 95.51
cd04107201 Rab32_Rab38 Rab38/Rab32 subfamily. Rab32 and Rab38 are 95.51
cd04102202 RabL3 RabL3 (Rab-like3) subfamily. RabL3s are novel pro 95.5
pfam03215490 Rad17 Rad17 cell cycle checkpoint protein. 98.17
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 97.99
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 98.17
PRK08939306 primosomal protein DnaI; Reviewed 98.05
KOG0991333 consensus 97.52
COG2204464 AtoC Response regulator containing CheY-like receiver, 97.97
PRK13406584 bchD magnesium chelatase subunit D; Provisional 97.05
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 96.86
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 96.79
PRK00409780 recombination and DNA strand exchange inhibitor protein 95.49
KOG0729435 consensus 97.95
TIGR03499282 FlhF flagellar biosynthetic protein FlhF. 97.76
PRK05703412 flhF flagellar biosynthesis regulator FlhF; Validated 97.66
PRK12724432 flagellar biosynthesis regulator FlhF; Provisional 97.24
PRK12727557 flagellar biosynthesis regulator FlhF; Provisional 96.7
cd03115173 SRP The signal recognition particle (SRP) mediates the 96.66
COG1419407 FlhF Flagellar GTP-binding protein [Cell motility and s 96.5
TIGR02533495 type_II_gspE general secretory pathway protein E; Inter 96.02
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 97.5
KOG2680454 consensus 97.22
PRK13765637 ATP-dependent protease Lon; Provisional 97.01
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleotide e 96.78
cd03246173 ABCC_Protease_Secretion This family represents the ABC 96.72
pfam01583157 APS_kinase Adenylylsulphate kinase. Enzyme that catalys 96.44
PRK05541176 adenylylsulfate kinase; Provisional 96.41
smart00487201 DEXDc DEAD-like helicases superfamily. 96.32
cd02027149 APSK Adenosine 5'-phosphosulfate kinase (APSK) catalyze 96.09
PRK05480209 uridine kinase; Provisional 95.99
PRK00889175 adenylylsulfate kinase; Provisional 95.97
pfam05272198 VirE Virulence-associated protein E. This family contai 95.95
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-lik 95.9
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 95.81
PRK04220306 2-phosphoglycerate kinase; Provisional 95.72
COG1618179 Predicted nucleotide kinase [Nucleotide transport and m 95.72
cd03229178 ABC_Class3 This class is comprised of all BPD (Binding 95.56
pfam06414191 Zeta_toxin Zeta toxin. This family consists of several 95.5
PRK07667190 uridine kinase; Provisional 95.5
PRK12726407 flagellar biosynthesis regulator FlhF; Provisional 95.49
COG2766649 PrkA Putative Ser protein kinase [Signal transduction m 96.74
PRK03846198 adenylylsulfate kinase; Provisional 96.7
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in cyto 96.12
KOG2227529 consensus 96.63
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 96.54
PRK102461047 exonuclease subunit SbcC; Provisional 95.69
PRK10536262 hypothetical protein; Provisional 95.82
PRK03918882 chromosome segregation protein; Provisional 95.8
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 95.51
>PRK10865 protein disaggregation chaperone; Provisional Back     alignment and domain information