254780883

254780883

hypothetical protein CLIBASIA_03900

GeneID in NCBI database:8209903Locus tag:CLIBASIA_03900
Protein GI in NCBI database:254780883Protein Accession:YP_003065296.1
Gene range:-(860864, 861283)Protein Length:139aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized conserved protein
KEGG prediction:hypothetical protein; K08998 hypothetical protein
SEED prediction:YidD
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------14
MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK
ccEEcccccccccEEEEEccccEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccccccHHHccc
cEEEEccccccccEHEEcccEEEEEcccccccccHcccccccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccccccccccccccccccccc
myyeckdstssdrylttfsqssyalpiqkkgsplllknntpksrnwngkfpktlGRLIGIGIIRIYQLIFSNvfgnscrylptcseyGYEAIARYGLWIGSWLTLLRLIkcnplgsdgfdpvpddlppkknnpkllskk
myyeckdstssdrylTTFSQSSyalpiqkkgsplllknntpksrnwngkfpKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGfdpvpddlppkknnpkllskk
MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTlgrligigiiriYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFdpvpddlppkknnpkllskk
*********S***YLTT*********************************PKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPV*****************
***********DRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK
*YY*CKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDD**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK
MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK
MYYECKDSTSSDRYLTTFSQSSYALPIQKKGSPLLLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIARYGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPKKNNPKLLSKK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target139 hypothetical protein CLIBASIA_03900 [Candidatus Liberib
315122697104 hypothetical protein CKC_04745 [Candidatus Liberibacter 1 9e-33
150396272109 hypothetical protein Smed_1051 [Sinorhizobium medicae W 1 5e-30
15965175124 hypothetical protein SMc01007 [Sinorhizobium meliloti 1 1 1e-29
15889051119 hypothetical protein Atu1747 [Agrobacterium tumefaciens 1 6e-28
325293130119 hypothetical protein AGROH133_06708 [Agrobacterium sp. 1 6e-28
121602223117 hypothetical protein BARBAKC583_0642 [Bartonella bacill 1 3e-26
110633360108 hypothetical protein Meso_1006 [Mesorhizobium sp. BNC1] 1 9e-26
319898980114 hypothetical protein BARCL_0814 [Bartonella clarridgeia 1 1e-25
222086052142 hypothetical protein Arad_2474 [Agrobacterium radiobact 1 1e-25
327188323134 hypothetical protein RHECNPAF_910016 [Rhizobium etli CN 1 2e-25
>gi|315122697|ref|YP_004063186.1| hypothetical protein CKC_04745 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 104 Back     alignment and organism information
 Score =  143 bits (360), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 85/95 (89%)

Query: 35  LLKNNTPKSRNWNGKFPKTLGRLIGIGIIRIYQLIFSNVFGNSCRYLPTCSEYGYEAIAR 94
           + + N PKSRNW GKFPKT GRLIGIGIIRIYQL+FSN+FG+SCRYLPTCSEY YEAIAR
Sbjct: 1   MSQKNIPKSRNWTGKFPKTPGRLIGIGIIRIYQLVFSNIFGHSCRYLPTCSEYAYEAIAR 60

Query: 95  YGLWIGSWLTLLRLIKCNPLGSDGFDPVPDDLPPK 129
           YGLWIG WLTL R+IKCNPLGS GF+PVPD+LP K
Sbjct: 61  YGLWIGGWLTLFRVIKCNPLGSHGFNPVPDNLPKK 95


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|150396272|ref|YP_001326739.1| hypothetical protein Smed_1051 [Sinorhizobium medicae WSM419] Length = 109 Back     alignment and organism information
>gi|15965175|ref|NP_385528.1| hypothetical protein SMc01007 [Sinorhizobium meliloti 1021] Length = 124 Back     alignment and organism information
>gi|15889051|ref|NP_354732.1| hypothetical protein Atu1747 [Agrobacterium tumefaciens str. C58] Length = 119 Back     alignment and organism information
>gi|325293130|ref|YP_004278994.1| hypothetical protein AGROH133_06708 [Agrobacterium sp. H13-3] Length = 119 Back     alignment and organism information
>gi|121602223|ref|YP_988946.1| hypothetical protein BARBAKC583_0642 [Bartonella bacilliformis KC583] Length = 117 Back     alignment and organism information
>gi|110633360|ref|YP_673568.1| hypothetical protein Meso_1006 [Mesorhizobium sp. BNC1] Length = 108 Back     alignment and organism information
>gi|319898980|ref|YP_004159073.1| hypothetical protein BARCL_0814 [Bartonella clarridgeiae 73] Length = 114 Back     alignment and organism information
>gi|222086052|ref|YP_002544584.1| hypothetical protein Arad_2474 [Agrobacterium radiobacter K84] Length = 142 Back     alignment and organism information
>gi|327188323|gb|EGE55541.1| hypothetical protein RHECNPAF_910016 [Rhizobium etli CNPAF512] Length = 134 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target139 hypothetical protein CLIBASIA_03900 [Candidatus Liberib
PRK0004193 PRK00041, PRK00041, hypothetical protein; Validated 2e-30
COG075992 COG0759, COG0759, Uncharacterized conserved protein [Fu 3e-22
TIGR0027875 TIGR00278, TIGR00278, conserved hypothetical protein Yi 2e-18
PRK1439063 PRK14390, PRK14390, hypothetical protein; Provisional 5e-16
PRK14386106 PRK14386, PRK14386, hypothetical protein; Provisional 6e-15
PRK1438998 PRK14389, PRK14389, hypothetical protein; Provisional 2e-14
PRK1438882 PRK14388, PRK14388, hypothetical protein; Provisional 3e-14
PRK1437181 PRK14371, PRK14371, hypothetical protein; Provisional 3e-14
PRK14370120 PRK14370, PRK14370, hypothetical protein; Provisional 4e-14
PRK1438784 PRK14387, PRK14387, hypothetical protein; Provisional 4e-14
PRK1438384 PRK14383, PRK14383, hypothetical protein; Provisional 1e-13
PRK14378103 PRK14378, PRK14378, hypothetical protein; Provisional 3e-13
PRK1437995 PRK14379, PRK14379, hypothetical protein; Provisional 3e-13
PRK1437373 PRK14373, PRK14373, hypothetical protein; Provisional 7e-13
PRK14376176 PRK14376, PRK14376, hypothetical protein; Provisional 1e-11
PRK14369119 PRK14369, PRK14369, hypothetical protein; Provisional 2e-11
PRK14381103 PRK14381, PRK14381, hypothetical protein; Provisional 3e-11
PRK1438081 PRK14380, PRK14380, hypothetical protein; Provisional 5e-11
PRK1437297 PRK14372, PRK14372, hypothetical protein; Provisional 6e-11
PRK1438268 PRK14382, PRK14382, hypothetical protein; Provisional 6e-10
PRK1439184 PRK14391, PRK14391, hypothetical protein; Provisional 2e-09
PRK1438596 PRK14385, PRK14385, hypothetical protein; Provisional 3e-09
PRK1437570 PRK14375, PRK14375, hypothetical protein; Provisional 6e-09
PRK1438456 PRK14384, PRK14384, hypothetical protein; Provisional 1e-07
PRK14377104 PRK14377, PRK14377, hypothetical protein; Provisional 3e-07
PRK14374118 PRK14374, PRK14374, hypothetical protein; Provisional 0.002
pfam0180968 pfam01809, DUF37, Domain of unknown function DUF37 3e-25
>gnl|CDD|178815 PRK00041, PRK00041, hypothetical protein; Validated Back     alignment and domain information
>gnl|CDD|31102 COG0759, COG0759, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|161800 TIGR00278, TIGR00278, conserved hypothetical protein YidD Back     alignment and domain information
>gnl|CDD|172866 PRK14390, PRK14390, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172862 PRK14386, PRK14386, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184656 PRK14389, PRK14389, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172864 PRK14388, PRK14388, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172847 PRK14371, PRK14371, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184651 PRK14370, PRK14370, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184655 PRK14387, PRK14387, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172859 PRK14383, PRK14383, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172854 PRK14378, PRK14378, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184653 PRK14379, PRK14379, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172849 PRK14373, PRK14373, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172852 PRK14376, PRK14376, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184650 PRK14369, PRK14369, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172857 PRK14381, PRK14381, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184654 PRK14380, PRK14380, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172848 PRK14372, PRK14372, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172858 PRK14382, PRK14382, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172867 PRK14391, PRK14391, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172861 PRK14385, PRK14385, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172851 PRK14375, PRK14375, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172860 PRK14384, PRK14384, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|172853 PRK14377, PRK14377, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|184652 PRK14374, PRK14374, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|145133 pfam01809, DUF37, Domain of unknown function DUF37 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 139 hypothetical protein CLIBASIA_03900 [Candidatus Liberib
PRK0004195 hypothetical protein; Validated 100.0
COG075992 Uncharacterized conserved protein [Function unknown] 100.0
pfam0180968 DUF37 Domain of unknown function DUF37. This domain is 99.97
TIGR0027875 TIGR00278 conserved hypothetical protein TIGR00278; Int 99.96
>PRK00041 hypothetical protein; Validated Back     alignment and domain information
>COG0759 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>pfam01809 DUF37 Domain of unknown function DUF37 Back     alignment and domain information
>TIGR00278 TIGR00278 conserved hypothetical protein TIGR00278; InterPro: IPR002696 This is a family of short (70 amino acid) hypothetical proteins from various bacteria Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00