255764506

255764506

GTP cyclohydrolase I

GeneID in NCBI database:8209904Locus tag:CLIBASIA_03905
Protein GI in NCBI database:255764506Protein Accession:YP_003065297.2
Gene range:+(861432, 862049)Protein Length:205aa
Gene description:GTP cyclohydrolase I
COG prediction:[H] GTP cyclohydrolase I
KEGG prediction:folE; GTP cyclohydrolase I (EC:3.5.4.16); K01495 GTP cyclohydrolase I [EC:3.5.4.16]
SEED prediction:GTP cyclohydrolase I (EC 3.5.4.16) type 1
Pathway involved in KEGG:Folate biosynthesis [PATH:las00790]
Subsystem involved in SEED:Queuosine-Archaeosine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-----
MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR
ccHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccHHHHHHccEEEccccccccEEEEccEEEEEEcccEEEEEEEEEEEEEEcccEEEEEHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEEEEEccEEccccEEEEEEEEcHHHccHHHHHHHHHHHHccc
cccccccccccccccccHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHccccccHHHHHHHHHcccccccccccEEEEEEEEEEEEcccccEEEEEEEEEEccccEEEcHHHHHHHHHHHHccEEcHHHHHHHHHHHHHHHHccccEEEEEEEEEHHHHcccccccccEEEEEEEccHHHHcHHHHHHHHHHHHccc
mkclrtgvfnmklkkptvEEAKEAIRVILRWigddpdreglkdtpdRVIKSYKELFAGykqipttqdtsrfhfgeaskyqdmVLIKDISFFSycehhilpiwgkihlayipkkhvIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSmrgikrdglttvttaftgefsrdkgktdfflkmthnqr
mkclrtgvfnmklkkptveeAKEAIRVILrwigddpdreglkdtpdrVIKSYKELFAGykqipttqdtsrfHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHaiesstdskgVAVLIEGQHMCMSMRGIKRDGLTTVTTaftgefsrdkgktdfflkmthnqr
MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR
***********************AIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTH***
MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR
************LKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHN**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR
MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR
MKCLRTGVFNMKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQR

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
315122696195 GTP cyclohydrolase I [Candidatus Liberibacter solanacea 1 1e-87
222086054207 GTP cyclohydrolase I [Agrobacterium radiobacter K84] Le 1 7e-58
83313322231 GTP cyclohydrolase I [Magnetospirillum magneticum AMB-1 1 3e-56
46201231219 COG0302: GTP cyclohydrolase I [Magnetospirillum magneto 1 5e-55
319405746204 GTP cyclohydrolase I [Bartonella sp. AR 15-3] Length = 1 1e-54
240850677206 GTP cyclohydrolase I [Bartonella grahamii as4aup] Lengt 1 4e-54
110633358222 GTP cyclohydrolase I [Mesorhizobium sp. BNC1] Length = 1 7e-54
114706243245 GTP cyclohydrolase I protein [Fulvimarina pelagi HTCC25 1 8e-54
254719147213 GTP cyclohydrolase I [Brucella sp. 83/13] Length = 213 1 8e-54
163868453206 GTP cyclohydrolase I [Bartonella tribocorum CIP 105476] 1 1e-53
>gi|315122696|ref|YP_004063185.1| GTP cyclohydrolase I [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 195 Back     alignment and organism information
 Score =  326 bits (836), Expect = 1e-87,   Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 173/195 (88%)

Query: 11  MKLKKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSR 70
           MK K PT EEAKEAIRVILRWIGDDP+REGLKDTP+RVIKSYKELF+GY+Q    QDTSR
Sbjct: 1   MKSKNPTSEEAKEAIRVILRWIGDDPEREGLKDTPERVIKSYKELFSGYEQDFIVQDTSR 60

Query: 71  FHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSR 130
           F+FGE S Y DMVLIKDISF SYCEHHILPI+GKIHLAYIPKK VIGLSKL+RILE+YSR
Sbjct: 61  FYFGEVSNYGDMVLIKDISFSSYCEHHILPIFGKIHLAYIPKKRVIGLSKLIRILEIYSR 120

Query: 131 RLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRD 190
           RLQIQERLTMQIA+ I +  DSKGVAVLIEGQHMCMSMRGIKR+GLTTVTT+FTGEF+ +
Sbjct: 121 RLQIQERLTMQIANEIGNVADSKGVAVLIEGQHMCMSMRGIKREGLTTVTTSFTGEFNSN 180

Query: 191 KGKTDFFLKMTHNQR 205
           K   D F++M +N+R
Sbjct: 181 KENKDIFIRMINNKR 195


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086054|ref|YP_002544586.1| GTP cyclohydrolase I [Agrobacterium radiobacter K84] Length = 207 Back     alignment and organism information
>gi|83313322|ref|YP_423586.1| GTP cyclohydrolase I [Magnetospirillum magneticum AMB-1] Length = 231 Back     alignment and organism information
>gi|46201231|ref|ZP_00208021.1| COG0302: GTP cyclohydrolase I [Magnetospirillum magnetotacticum MS-1] Length = 219 Back     alignment and organism information
>gi|319405746|emb|CBI79369.1| GTP cyclohydrolase I [Bartonella sp. AR 15-3] Length = 204 Back     alignment and organism information
>gi|240850677|ref|YP_002972077.1| GTP cyclohydrolase I [Bartonella grahamii as4aup] Length = 206 Back     alignment and organism information
>gi|110633358|ref|YP_673566.1| GTP cyclohydrolase I [Mesorhizobium sp. BNC1] Length = 222 Back     alignment and organism information
>gi|114706243|ref|ZP_01439145.1| GTP cyclohydrolase I protein [Fulvimarina pelagi HTCC2506] Length = 245 Back     alignment and organism information
>gi|254719147|ref|ZP_05180958.1| GTP cyclohydrolase I [Brucella sp. 83/13] Length = 213 Back     alignment and organism information
>gi|163868453|ref|YP_001609662.1| GTP cyclohydrolase I [Bartonella tribocorum CIP 105476] Length = 206 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
PRK09347188 PRK09347, folE, GTP cyclohydrolase I; Provisional 1e-76
TIGR00063180 TIGR00063, folE, GTP cyclohydrolase I 7e-52
PRK12606201 PRK12606, PRK12606, GTP cyclohydrolase I; Reviewed 8e-52
cd00642185 cd00642, GTP_cyclohydro1, GTP cyclohydrolase I (GTP-CH- 9e-52
PLN03044188 PLN03044, PLN03044, GTP cyclohydrolase I; Provisional 2e-47
PTZ00484259 PTZ00484, PTZ00484, GTP cyclohydrolase I; Provisional 2e-46
KOG2698247 KOG2698, KOG2698, KOG2698, GTP cyclohydrolase I [Coenzy 4e-46
PLN02531469 PLN02531, PLN02531, GTP cyclohydrolase I 6e-34
COG0302195 COG0302, FolE, GTP cyclohydrolase I [Coenzyme metabolis 1e-63
pfam0122786 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I 6e-35
cd00651122 cd00651, TFold, Tunnelling fold (T-fold) 6e-05
PLN02531 469 PLN02531, PLN02531, GTP cyclohydrolase I 2e-27
>gnl|CDD|181789 PRK09347, folE, GTP cyclohydrolase I; Provisional Back     alignment and domain information
>gnl|CDD|129173 TIGR00063, folE, GTP cyclohydrolase I Back     alignment and domain information
>gnl|CDD|183620 PRK12606, PRK12606, GTP cyclohydrolase I; Reviewed Back     alignment and domain information
>gnl|CDD|29763 cd00642, GTP_cyclohydro1, GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate Back     alignment and domain information
>gnl|CDD|178607 PLN03044, PLN03044, GTP cyclohydrolase I; Provisional Back     alignment and domain information
>gnl|CDD|185662 PTZ00484, PTZ00484, GTP cyclohydrolase I; Provisional Back     alignment and domain information
>gnl|CDD|37909 KOG2698, KOG2698, KOG2698, GTP cyclohydrolase I [Coenzyme transport and metabolism] Back     alignment and domain information
>gnl|CDD|178146 PLN02531, PLN02531, GTP cyclohydrolase I Back     alignment and domain information
>gnl|CDD|30650 COG0302, FolE, GTP cyclohydrolase I [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|144718 pfam01227, GTP_cyclohydroI, GTP cyclohydrolase I Back     alignment and domain information
>gnl|CDD|29764 cd00651, TFold, Tunnelling fold (T-fold) Back     alignment and domain information
>gnl|CDD|178146 PLN02531, PLN02531, GTP cyclohydrolase I Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
TIGR00063183 folE GTP cyclohydrolase I; InterPro: IPR001474 GTP cycl 100.0
PRK09347186 folE GTP cyclohydrolase I; Provisional 100.0
COG0302195 FolE GTP cyclohydrolase I [Coenzyme metabolism] 100.0
cd00642185 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyz 100.0
PRK12606185 GTP cyclohydrolase I; Reviewed 100.0
KOG2698247 consensus 100.0
pfam0122786 GTP_cyclohydroI GTP cyclohydrolase I. This family inclu 100.0
cd00651122 TFold Tunnelling fold (T-fold). The five known T-folds 97.41
COG0780149 Enzyme related to GTP cyclohydrolase I [General functio 97.34
PRK13258127 7-cyano-7-deazaguanine reductase; Provisional 98.01
TIGR03139115 QueF-II 7-cyano-7-deazaguanine reductase. The enzymatic 97.85
>TIGR00063 folE GTP cyclohydrolase I; InterPro: IPR001474 GTP cyclohydrolase I (3 Back     alignment and domain information
>PRK09347 folE GTP cyclohydrolase I; Provisional Back     alignment and domain information
>COG0302 FolE GTP cyclohydrolase I [Coenzyme metabolism] Back     alignment and domain information
>cd00642 GTP_cyclohydro1 GTP cyclohydrolase I (GTP-CH-I) catalyzes the conversion of GTP into dihydroneopterin triphosphate Back     alignment and domain information
>PRK12606 GTP cyclohydrolase I; Reviewed Back     alignment and domain information
>KOG2698 consensus Back     alignment and domain information
>pfam01227 GTP_cyclohydroI GTP cyclohydrolase I Back     alignment and domain information
>cd00651 TFold Tunnelling fold (T-fold) Back     alignment and domain information
>COG0780 Enzyme related to GTP cyclohydrolase I [General function prediction only] Back     alignment and domain information
>PRK13258 7-cyano-7-deazaguanine reductase; Provisional Back     alignment and domain information
>TIGR03139 QueF-II 7-cyano-7-deazaguanine reductase Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
1is7_A230 Crystal Structure Of Rat GtpchiGFRP STIMULATORY COM 2e-52
1fb1_A196 Crystal Structure Of Human Gtp Cyclohydrolase I Len 1e-49
1wm9_A220 Structure Of Gtp Cyclohydrolase I From Thermus Ther 1e-43
1gtp_A221 Gtp Cyclohydrolase I Length = 221 4e-33
1n3s_A221 Biosynthesis Of Pteridins. Reaction Mechanism Of Gt 5e-33
1a9c_A221 Gtp Cyclohydrolase I (C110s Mutant) In Complex With 8e-33
1a8r_A221 Gtp Cyclohydrolase I (H112s Mutant) In Complex With 1e-32
1n3t_F221 Biosynthesis Of Pteridins. Reaction Mechanism Of Gt 1e-31
>gi|20150237|pdb|1IS7|A Chain A, Crystal Structure Of Rat GtpchiGFRP STIMULATORY COMPLEX Length = 230 Back     alignment and structure
 Score =  209 bits (532), Expect = 2e-52,   Method: Composition-based stats.
 Identities = 77/182 (42%), Positives = 108/182 (59%), Gaps = 3/182 (1%)

Query: 22  KEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQD 81
             A   ILR +G+DP R+GL  TP R   + +    GY++  +              + +
Sbjct: 52  AAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIF---DEDHDE 108

Query: 82  MVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQ 141
           MV++KDI  FS CEHH++P  G++H+ Y+P K V+GLSKL RI+E+YSRRLQ+QERLT Q
Sbjct: 109 MVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQ 168

Query: 142 IAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMT 201
           IA AI  +    GV V+IE  HMCM MRG+++    TVT+   G F  D    + FL + 
Sbjct: 169 IAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKTREEFLTLI 228

Query: 202 HN 203
            +
Sbjct: 229 RS 230


>gi|12084579|pdb|1FB1|A Chain A, Crystal Structure Of Human Gtp Cyclohydrolase I Length = 196 Back     alignment and structure
gi|73535429|pdb|1WM9|A Chain A, Structure Of Gtp Cyclohydrolase I From Thermus Thermophilus Hb8 Length = 220 Back     alignment and structure
>gi|1943377|pdb|1GTP|A Chain A, Gtp Cyclohydrolase I Length = 221 Back     alignment and structure
>gi|46014911|pdb|1N3S|A Chain A, Biosynthesis Of Pteridins. Reaction Mechanism Of Gtp Cyclohydrolase I Length = 221 Back     alignment and structure
>gi|5107437|pdb|1A9C|A Chain A, Gtp Cyclohydrolase I (C110s Mutant) In Complex With Gtp Length = 221 Back     alignment and structure
>gi|5107422|pdb|1A8R|A Chain A, Gtp Cyclohydrolase I (H112s Mutant) In Complex With Gtp Length = 221 Back     alignment and structure
>gi|38492506|pdb|1N3T|F Chain F, Biosynthesis Of Pteridins. Reaction Mechanism Of Gtp Cyclohydrolase I Length = 221 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
1is8_A230 GTP cyclohydrolase I; enzyme-regulatory protein complex 4e-60
1wur_A220 GTP cyclohydrolase I; beta barrel, protein-inhibitor co 6e-50
1a8r_A221 GTP cyclohydrolase I; purine hydrolysis, pterine synthe 8e-41
>1is8_A GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus} SCOP: d.96.1.1 PDB: 1is7_A* 1wpl_A* 1fb1_A Length = 230 Back     alignment and structure
 Score =  225 bits (576), Expect = 4e-60
 Identities = 77/190 (40%), Positives = 110/190 (57%), Gaps = 3/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +  +     A   ILR +G+DP R+GL  TP R   + +    GY++  +         
Sbjct: 44  NELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIF- 102

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
                + +MV++KDI  FS CEHH++P  G++H+ Y+P K V+GLSKL RI+E+YSRRLQ
Sbjct: 103 --DEDHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQ 160

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT QIA AI  +    GV V+IE  HMCM MRG+++    TVT+   G F  D   
Sbjct: 161 VQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT 220

Query: 194 TDFFLKMTHN 203
            + FL +  +
Sbjct: 221 REEFLTLIRS 230


>1wur_A GTP cyclohydrolase I; beta barrel, protein-inhibitor complex, pteridine, tetrahydrobiopterin, structural genomics; HET: 8DG; 1.82A {Thermus thermophilus} SCOP: d.96.1.1 PDB: 1wm9_A* 1wuq_A* Length = 220 Back     alignment and structure
>1a8r_A GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} SCOP: d.96.1.1 PDB: 1n3r_A* 1fbx_A 1gtp_A 1n3s_A* 1n3t_F* 1a9c_A* Length = 221 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
1is8_A230 GTP cyclohydrolase I; enzyme-regulatory protein complex 100.0
1wur_A220 GTP cyclohydrolase I; beta barrel, protein-inhibitor co 100.0
1a8r_A221 GTP cyclohydrolase I; purine hydrolysis, pterine synthe 100.0
3bp1_A290 NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha 94.05
>1is8_A GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus} SCOP: d.96.1.1 PDB: 1is7_A* 1wpl_A* 1fb1_A Back     alignment and structure
Probab=100.00  E-value=0  Score=526.41  Aligned_cols=186  Identities=41%  Similarity=0.717  Sum_probs=176.9

Q ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCEEEECCEEEEEEC
Q ss_conf             22489999999999998147888810011267899999999976086531234432025665566762896180587721
Q gi|255764506|r   15 KPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYC   94 (205)
Q Consensus        15 ~~~~~~i~~av~~lL~~LGeDp~regL~~TP~Rvak~~~e~~~Gy~~~~~~~~~~~~~~~~~~~~~~mVvv~~I~f~S~C   94 (205)
                      +.+.+++++||++||++||+||+|+||.+||+||||||.|+|+||..++...+...|.   .++|++||+++||+|+|+|
T Consensus        45 ~~~~~~~e~Av~~iL~~lGeDp~regL~~TP~Rvaka~~e~~~Gy~~~~~~~l~~~~~---~~~~~emViv~dI~f~S~C  121 (230)
T 1is8_A           45 ELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIF---DEDHDEMVIVKDIDMFSMC  121 (230)
T ss_dssp             HHHHHHHHHHHHHHHHHHTCCTTSTTTTTHHHHHHHHHHHHTGGGGCCTHHHHSSSCC---EEEECSCEEEEEEEEEEEE
T ss_pred             CCCHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCC---CCCCCCEEEEECCEEEEEC
T ss_conf             0278999999999999977999961001469999999999862212481677536556---5678842898422044422


Q ss_pred             CCCEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEEECCCCCC
Q ss_conf             10023465578999963885434677999999983154266899999999999732738479999948842522383559
Q gi|255764506|r   95 EHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRD  174 (205)
Q Consensus        95 EHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~a~RlQ~QErlT~qIa~~l~~~l~~~gv~V~i~A~H~Cm~~RGv~~~  174 (205)
                      |||||||+|++||||||+++|+|||||+|||++||||||+|||||+|||++|++.|+|+||+|+++|+|+||.||||+++
T Consensus       122 EHHllPf~G~ahVaYiP~~~ViGLSKlaRiV~~~arRlQvQErLT~qIA~al~~~l~p~GVaV~ieA~H~Cm~~RGv~k~  201 (230)
T 1is8_A          122 EHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKM  201 (230)
T ss_dssp             TTTCCEEEEEEEEEEECSEECCCHHHHHHHHHHHHSSEECHHHHHHHHHHHHHHHHCCSEEEEEEEEEEHHHHTTC--CT
T ss_pred             CCCCCCCEEEEEEEEEECCCCCCHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHCCCCEEEEEEEEEEECCCCCCCCCC
T ss_conf             54435520289999984895256778999999997175788899999999999734878589999988836244688789


Q ss_pred             CCEEEEEEEEEEECCCHHHHHHHHHHHCC
Q ss_conf             98599967774430688999999998326
Q gi|255764506|r  175 GLTTVTTAFTGEFSRDKGKTDFFLKMTHN  203 (205)
Q Consensus       175 ~s~~~T~~~~G~F~~d~~~r~ef~~li~~  203 (205)
                      +|.|+|++++|+|++|+.+|+|||++|++
T Consensus       202 ~s~t~Ts~~~G~F~~d~~~R~EFl~li~~  230 (230)
T 1is8_A          202 NSKTVTSTMLGVFREDPKTREEFLTLIRS  230 (230)
T ss_dssp             TCEEEEEEEEEHHHHCHHHHHHHHHHHCC
T ss_pred             CCCEEEEEEEEEECCCHHHHHHHHHHHCC
T ss_conf             97389988687866798999999998539



>1wur_A GTP cyclohydrolase I; beta barrel, protein-inhibitor complex, pteridine, tetrahydrobiopterin, structural genomics; HET: 8DG; 1.82A {Thermus thermophilus} SCOP: d.96.1.1 PDB: 1wm9_A* 1wuq_A* Back     alignment and structure
>1a8r_A GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} SCOP: d.96.1.1 PDB: 1n3r_A* 1fbx_A 1gtp_A 1n3s_A* 1n3t_F* 1a9c_A* Back     alignment and structure
>3bp1_A NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
d1wpla_194 d.96.1.1 (A:) GTP cyclohydrolase I {Rat (Rattus norvegi 2e-50
d1wura1185 d.96.1.1 (A:32-216) GTP cyclohydrolase I {Thermus therm 1e-47
d1a8ra_221 d.96.1.1 (A:) GTP cyclohydrolase I {Escherichia coli [T 5e-39
>d1wpla_ d.96.1.1 (A:) GTP cyclohydrolase I {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 194 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: T-fold
superfamily: Tetrahydrobiopterin biosynthesis enzymes-like
family: GTP cyclohydrolase I
domain: GTP cyclohydrolase I
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  192 bits (489), Expect = 2e-50
 Identities = 79/190 (41%), Positives = 113/190 (59%), Gaps = 3/190 (1%)

Query: 14  KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHF 73
            +  +     A   ILR +G+DP R+GL  TP R   + +    GY++   +   +   F
Sbjct: 8   NELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQE-TISDVLNDAIF 66

Query: 74  GEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQ 133
            E   + +MV++KDI  FS CEHH++P  G++H+ Y+P K V+GLSKL RI+E+YSRRLQ
Sbjct: 67  DE--DHDEMVIVKDIDMFSMCEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQ 124

Query: 134 IQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGK 193
           +QERLT QIA AI  +    GV V+IE  HMCM MRG+++    TVT+   G F  D   
Sbjct: 125 VQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQKMNSKTVTSTMLGVFREDPKT 184

Query: 194 TDFFLKMTHN 203
            + FL +  +
Sbjct: 185 REEFLTLIRS 194


>d1wura1 d.96.1.1 (A:32-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]} Length = 185 Back     information, alignment and structure
>d1a8ra_ d.96.1.1 (A:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]} Length = 221 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
d1wpla_194 GTP cyclohydrolase I {Rat (Rattus norvegicus) [TaxId: 1 100.0
d1wura1185 GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274] 100.0
d1a8ra_221 GTP cyclohydrolase I {Escherichia coli [TaxId: 562]} 100.0
>d1wpla_ d.96.1.1 (A:) GTP cyclohydrolase I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: T-fold
superfamily: Tetrahydrobiopterin biosynthesis enzymes-like
family: GTP cyclohydrolase I
domain: GTP cyclohydrolase I
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=0  Score=516.31  Aligned_cols=187  Identities=41%  Similarity=0.714  Sum_probs=177.6

Q ss_pred             CCCCHHHHHHHHHHHHHHHCCCCCCHHHCCCHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCCCCCCCEEEECCEEEEEE
Q ss_conf             52248999999999999814788881001126789999999997608653123443202566556676289618058772
Q gi|255764506|r   14 KKPTVEEAKEAIRVILRWIGDDPDREGLKDTPDRVIKSYKELFAGYKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSY   93 (205)
Q Consensus        14 ~~~~~~~i~~av~~lL~~LGeDp~regL~~TP~Rvak~~~e~~~Gy~~~~~~~~~~~~~~~~~~~~~~mVvv~~I~f~S~   93 (205)
                      .+.+++++++||++||++||+||+|+||.+||+||||||.|+|+||..+|+..+...|.   .++|++||+++||+|+|+
T Consensus         8 ~~~~~~~ie~Av~~iL~aLGeDp~regL~~TP~RVaka~~el~~Gy~~~~~~~l~~~~~---~~~~~~~Vv~~~I~f~S~   84 (194)
T d1wpla_           8 NELNLPNLAAAYSSILRSLGEDPQRQGLLKTPWRAATAMQFFTKGYQETISDVLNDAIF---DEDHDEMVIVKDIDMFSM   84 (194)
T ss_dssp             HHHHHHHHHHHHHHHHHHHTCCTTSGGGTTHHHHHHHHHHHHTGGGGCCHHHHTTCCEE---CCSCCSEEEEEEEEEEEE
T ss_pred             CHHHHHHHHHHHHHHHHHHCCCCCCCCCHHCHHHHHHHHHHHHHHCCCCCCCCCCCCCC---CCCCCCEEEEECCEEEEE
T ss_conf             32228999999999999968999951000168999999999840124554222245567---778870699817668742


Q ss_pred             CCCCEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCEEEEEEEEEEEEEECCCCC
Q ss_conf             11002346557899996388543467799999998315426689999999999973273847999994884252238355
Q gi|255764506|r   94 CEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKR  173 (205)
Q Consensus        94 CEHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~a~RlQ~QErlT~qIa~~l~~~l~~~gv~V~i~A~H~Cm~~RGv~~  173 (205)
                      ||||||||+|+|||||+|+++|+|||||+|||++||||||+|||||+|||++|++.|+|+||+|+++|+|+||.||||++
T Consensus        85 CEHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~arRlQ~QErlt~qIa~~l~~~l~~~gv~V~i~A~H~Cm~~RGv~~  164 (194)
T d1wpla_          85 CEHHLVPFVGRVHIGYLPNKQVLGLSKLARIVEIYSRRLQVQERLTKQIAVAITEALQPAGVGVVIEATHMCMVMRGVQK  164 (194)
T ss_dssp             ETTTCCEEEEEEEEEEECSSEECCHHHHHHHHHHHHSSEECHHHHHHHHHHHHHHHHCCSEEEEEEEEEEHHHHSSTTCC
T ss_pred             CCCCEEEEEEEEEEEEEECCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEEECCCCCCCCC
T ss_conf             37650256137999998489624566799999999873130779999999999986787866999999980667778888


Q ss_pred             CCCEEEEEEEEEEECCCHHHHHHHHHHHCC
Q ss_conf             998599967774430688999999998326
Q gi|255764506|r  174 DGLTTVTTAFTGEFSRDKGKTDFFLKMTHN  203 (205)
Q Consensus       174 ~~s~~~T~~~~G~F~~d~~~r~ef~~li~~  203 (205)
                      ++|.|+|++++|+|++|+.+|+|||++|++
T Consensus       165 ~~s~~~T~~~~G~F~~d~~~R~efl~~i~s  194 (194)
T d1wpla_         165 MNSKTVTSTMLGVFREDPKTREEFLTLIRS  194 (194)
T ss_dssp             TTCEEEEEEEEEHHHHCHHHHHHHHHHTCC
T ss_pred             CCCCEEEEEEEEEECCCHHHHHHHHHHHCC
T ss_conf             997289987787664898999999998549



>d1wura1 d.96.1.1 (A:32-216) GTP cyclohydrolase I {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1a8ra_ d.96.1.1 (A:) GTP cyclohydrolase I {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 205 GTP cyclohydrolase I [Candidatus Liberibacter asia
1a8r_A_80-221142 (A:80-221) GTP cyclohydrolase I; purine hydrolysis 3e-44
1wur_A_81-220140 (A:81-220) GTP cyclohydrolase I; beta barrel, prot 6e-44
1is8_A_94-230137 (A:94-230) GTP cyclohydrolase I; enzyme-regulatory 3e-37
1is8_A_1-9393 (A:1-93) GTP cyclohydrolase I; enzyme-regulatory p 2e-15
1a8r_A_1-7979 (A:1-79) GTP cyclohydrolase I; purine hydrolysis, 1e-12
>1a8r_A (A:80-221) GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli}Length = 142 Back     alignment and structure
 Score =  172 bits (438), Expect = 3e-44
 Identities = 51/139 (36%), Positives = 75/139 (53%)

Query: 66  QDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRIL 125
                       K  +MV ++DI+  S CE H + I GK  +AYIPK  VIGLSK+ RI+
Sbjct: 3   NFPKITLIENKMKVDEMVTVRDITLTSTCESHFVTIDGKATVAYIPKDSVIGLSKINRIV 62

Query: 126 EVYSRRLQIQERLTMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTG 185
           + +++R Q+QERLT QI  A+++   +  VAV I+  H C+  RGI+     T TT+  G
Sbjct: 63  QFFAQRPQVQERLTQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGG 122

Query: 186 EFSRDKGKTDFFLKMTHNQ 204
            F   +     FL+   + 
Sbjct: 123 LFKSSQNTRHEFLRAVRHH 141


>1wur_A (A:81-220) GTP cyclohydrolase I; beta barrel, protein-inhibitor complex, pteridine, tetrahydrobiopterin, structural genomics; HET: 8DG; 1.82A {Thermus thermophilus}Length = 140 Back     alignment and structure
>1is8_A (A:94-230) GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus}Length = 137 Back     alignment and structure
>1is8_A (A:1-93) GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus}Length = 93 Back     alignment and structure
>1a8r_A (A:1-79) GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli}Length = 79 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target205 GTP cyclohydrolase I [Candidatus Liberibacter asiaticus
1a8r_A_80-221142 GTP cyclohydrolase I; purine hydrolysis, pterine s 100.0
1wur_A_81-220140 GTP cyclohydrolase I; beta barrel, protein-inhibit 100.0
1is8_A_94-230137 GTP cyclohydrolase I; enzyme-regulatory protein co 100.0
1is8_A_1-9393 GTP cyclohydrolase I; enzyme-regulatory protein co 99.5
1a8r_A_1-7979 GTP cyclohydrolase I; purine hydrolysis, pterine s 99.44
3bp1_A_290 NADPH-dependent 7-cyano-7-deazaguanine reductase; 95.0
>1a8r_A (A:80-221) GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=0  Score=401.17  Aligned_cols=141  Identities=38%  Similarity=0.612  Sum_probs=134.3

Q ss_pred             CCCCCHHHHHHHHCCCCCCCCCCEEEECCEEEEEECCCCEEEEEEEEEEEEECCCCCCCHHHHHHHHHHHHCCCCCHHHH
Q ss_conf             08653123443202566556676289618058772110023465578999963885434677999999983154266899
Q gi|255764506|r   59 YKQIPTTQDTSRFHFGEASKYQDMVLIKDISFFSYCEHHILPIWGKIHLAYIPKKHVIGLSKLVRILEVYSRRLQIQERL  138 (205)
Q Consensus        59 y~~~~~~~~~~~~~~~~~~~~~~mVvv~~I~f~S~CEHHllPf~G~~~IaYiP~~~viGlSKl~Riv~~~a~RlQ~QErl  138 (205)
                      |+++|+..+     +++.+++++||+++||+|+|+||||||||+|++||||+|+++|+|||||+|||++||||||+||||
T Consensus         1 Y~~~p~~~~-----f~~~~~~~~mViv~~I~f~S~CEHHllPf~G~~hVaYiP~~~viGlSKl~Riv~~~arRlQiQERl   75 (142)
T 1a8r_A            1 YANFPKITL-----IENKMKVDEMVTVRDITLTSTCESHFVTIDGKATVAYIPKDSVIGLSKINRIVQFFAQRPQVQERL   75 (142)
T ss_dssp             GGGCCCCCE-----EECTTCCCSCEEEEEEEEEEEETTTTEEEEEEEEEEECCSSEEECHHHHHHHHHHHHSSEECHHHH
T ss_pred             CCCCHHHHH-----CCCCCCCCCEEEECCCCEEEECCCCCCCEEEEEEEEEEECCCCCCHHHHHHHHHHHHCCCCCHHHH
T ss_conf             554413331-----111357663499727645765243453033468999972684004466999999998374007899


Q ss_pred             HHHHHHHHHHHCCCCCEEEEEEEEEEEEEECCCCCCCCEEEEEEEEEEECCCHHHHHHHHHHHCCC
Q ss_conf             999999999732738479999948842522383559985999677744306889999999983268
Q gi|255764506|r  139 TMQIAHAIESSTDSKGVAVLIEGQHMCMSMRGIKRDGLTTVTTAFTGEFSRDKGKTDFFLKMTHNQ  204 (205)
Q Consensus       139 T~qIa~~l~~~l~~~gv~V~i~A~H~Cm~~RGv~~~~s~~~T~~~~G~F~~d~~~r~ef~~li~~~  204 (205)
                      |+|||++|++.|+|+||+|+++|+|+||.||||+++++.|+|++++|+|++|+++|+|||++++++
T Consensus        76 t~qIa~~l~~~l~p~gV~V~ieA~H~Cm~~RGv~~~~s~t~T~~~~G~F~~d~~~r~efl~~i~~~  141 (142)
T 1a8r_A           76 TQQILIALQTLLGTNNVAVSIDAVHYCVKARGIRDATSATTTTSLGGLFKSSQNTRHEFLRAVRHH  141 (142)
T ss_dssp             HHHHHHHHHHHHTCSCEEEEEEEEEHHHHSSTTCCSSCEEEEEEECTHHHHCHHHHHHHHHHSCCC
T ss_pred             HHHHHHHHHHHHCCCCEEEEEEEEEEEECCCCCCCCCCEEEEEEEEEEECCCHHHHHHHHHHHHHC
T ss_conf             999999999972979679999989830524488889963899888868668989999999986236



>1wur_A (A:81-220) GTP cyclohydrolase I; beta barrel, protein-inhibitor complex, pteridine, tetrahydrobiopterin, structural genomics; HET: 8DG; 1.82A {Thermus thermophilus} Back     alignment and structure
>1is8_A (A:94-230) GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus} Back     alignment and structure
>1is8_A (A:1-93) GTP cyclohydrolase I; enzyme-regulatory protein complex, hydrolase/protein binding complex; HET: PHE; 2.70A {Rattus norvegicus} Back     alignment and structure
>1a8r_A (A:1-79) GTP cyclohydrolase I; purine hydrolysis, pterine synthesis; HET: GTP; 2.10A {Escherichia coli} Back     alignment and structure
>3bp1_A (A:) NADPH-dependent 7-cyano-7-deazaguanine reductase; alpha-beta structure, structural genomics, PSI-2; HET: MSE GUN; 1.53A {Vibrio cholerae o1 biovar eltor str} Back     alignment and structure