254780886

254780886

hypothetical protein CLIBASIA_03915

GeneID in NCBI database:8209906Locus tag:CLIBASIA_03915
Protein GI in NCBI database:254780886Protein Accession:YP_003065299.1
Gene range:-(863556, 863681)Protein Length:41aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:not defined as a protein in SEED
Pathway involved in KEGG:not defined
Subsystem involved in KEGG:not defined
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40-
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
cccccEEEEEHHHHHHHHHcccccEEHHHHEEEEEEEEEcc
ccccHEEEEEHHcHHHHHccccccHHHHHHHHHHHHHHHcc
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
MNAKGLivasiisstaimsscsysWNLKHAIRKIEIAIKEQ
****GLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIK**
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
***KGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
ooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiii
xxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxx
oooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
ooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiii
ooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ
MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target41 hypothetical protein CLIBASIA_03915 [Candidatus Liberib
25478100585 hypothetical protein CLIBASIA_04530 [Candidatus Li 3e-07
>gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Back     alignment
 Score = 44.7 bits (104), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target41 hypothetical protein CLIBASIA_03915 [Candidatus Liberib
25478100585 hypothetical protein CLIBASIA_04530 [Candidatus Liberib 1 0.004
>gi|254781005|ref|YP_003065418.1| hypothetical protein CLIBASIA_04530 [Candidatus Liberibacter asiaticus str. psy62] Length = 85 Back     alignment and organism information
 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 20/41 (48%), Positives = 31/41 (75%)

Query: 1  MNAKGLIVASIISSTAIMSSCSYSWNLKHAIRKIEIAIKEQ 41
          M+ KGLIVAS+ISST IMS CS + + ++ IR++   +K++
Sbjct: 1  MDIKGLIVASLISSTVIMSGCSETLDPENGIRELGARMKQE 41


Species: Candidatus Liberibacter asiaticus
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00