254780885

254780885

hypothetical protein CLIBASIA_03910

GeneID in NCBI database:8209905Locus tag:CLIBASIA_03910
Protein GI in NCBI database:254780885Protein Accession:YP_003065298.1
Gene range:+(862475, 863098)Protein Length:207aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
ccccccccHHHHHHccEEEEEEEEEEEEEcccccccEEEEEEccccEEEEccccccccccEEEEEEEccccEEEEEEEEEccccEEEEEEccHHHHHHHHHHHHHHHccccccHHHHHcccccccccccccEEEEEccccEEEEEEEEEEEccEEEEEccccccccEEEEccEEEEEEEEEcccEEEEEEccccccHHHHHHHHHcc
ccHHHHHHHHHHHHHHcccEEEEEccccccccccccEEEEEcccccEEEEEEccccccccEEEEEEEcccccccEEEEEEccccEEEEEcccHHHHHHHHHHHHHHHHcccccccHHHccccccccccccEEEEEEccccEEEEEEEEEcccccEEEccccccccccEEEEcEccEEEEEcccccEEEEEccccHHHHHHHHHHHcc
myrgihnlQFIDQRAFQRVKVDLKgrfllfdgteyncivreispgglcivcdvpmflvGERSIVFVEKVGRIegkvvnfdsnrgyAVRIVTSENERRKLADKLIWLAnkddlhlqDCRAYGRKITRDREVDAQlvlndntkhsckvidisesgvsVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
myrgihnlqfidqraFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVgriegkvvnfdsnrgyavrivtsenerrKLADKLIwlankddlhlqdCRAYGRKITRDREVDaqlvlndntkhsckvidisesgvSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIefssvqesniaFKSLINHCY
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
**************AFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDL*********RKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHC*
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY
MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRIFPGGIAIEFSSVQESNIAFKSLINHCY

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
315122695195 hypothetical protein CKC_04735 [Candidatus Liberibacter 1 2e-84
254504045212 Type IV pilus assembly protein PilZ [Labrenzia alexandr 1 4e-31
307945505216 type IV pilus assembly PilZ [Roseibium sp. TrichSKD4] L 1 1e-30
118591266213 type IV pilus assembly PilZ [Stappia aggregata IAM 1261 1 1e-30
222086060209 hypothetical protein Arad_2484 [Agrobacterium radiobact 1 1e-30
222148624203 hypothetical protein Avi_2200 [Agrobacterium vitis S4] 1 1e-30
146339954202 hypothetical protein BRADO2958 [Bradyrhizobium sp. ORS2 1 2e-30
209549449203 type IV pilus assembly PilZ [Rhizobium leguminosarum bv 1 5e-30
218462807203 hypothetical protein RetlK5_26662 [Rhizobium etli Kim 5 1 5e-30
190891887203 hypothetical protein RHECIAT_CH0002296 [Rhizobium etli 1 6e-30
>gi|315122695|ref|YP_004063184.1| hypothetical protein CKC_04735 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 195 Back     alignment and organism information
 Score =  315 bits (807), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 151/193 (78%), Positives = 174/193 (90%), Gaps = 2/193 (1%)

Query: 1   MYRGIHNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGE 60
           MYRGIHNLQFIDQRAFQR+KVDLKGRFLLFDGTEY+C+VRE+SPGGLCI CDVP+ L+GE
Sbjct: 1   MYRGIHNLQFIDQRAFQRIKVDLKGRFLLFDGTEYDCVVREVSPGGLCIACDVPIVLIGE 60

Query: 61  RSIVFVEKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQDCRAY 120
           R IVFVEK+GRIEGKVVNFD  +GYAVRI++SE+ RRKLADKL+WLANKDDL LQD R Y
Sbjct: 61  RFIVFVEKIGRIEGKVVNFDIKKGYAVRIISSEDNRRKLADKLVWLANKDDLSLQDHRKY 120

Query: 121 GRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDLQIEMFSKVLFNDILGRVVRI 180
            RKI++D  V+AQL L + T HSC+VIDISESGVSVSVDL I++FSKV FNDILGRVVR 
Sbjct: 121 SRKISQD--VEAQLTLENKTVHSCQVIDISESGVSVSVDLHIKIFSKVFFNDILGRVVRN 178

Query: 181 FPGGIAIEFSSVQ 193
           FPGG+AIEF+++Q
Sbjct: 179 FPGGVAIEFATIQ 191


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|254504045|ref|ZP_05116196.1| Type IV pilus assembly protein PilZ [Labrenzia alexandrii DFL-11] Length = 212 Back     alignment and organism information
>gi|307945505|ref|ZP_07660841.1| type IV pilus assembly PilZ [Roseibium sp. TrichSKD4] Length = 216 Back     alignment and organism information
>gi|118591266|ref|ZP_01548665.1| type IV pilus assembly PilZ [Stappia aggregata IAM 12614] Length = 213 Back     alignment and organism information
>gi|222086060|ref|YP_002544592.1| hypothetical protein Arad_2484 [Agrobacterium radiobacter K84] Length = 209 Back     alignment and organism information
>gi|222148624|ref|YP_002549581.1| hypothetical protein Avi_2200 [Agrobacterium vitis S4] Length = 203 Back     alignment and organism information
>gi|146339954|ref|YP_001205002.1| hypothetical protein BRADO2958 [Bradyrhizobium sp. ORS278] Length = 202 Back     alignment and organism information
>gi|209549449|ref|YP_002281366.1| type IV pilus assembly PilZ [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 203 Back     alignment and organism information
>gi|218462807|ref|ZP_03502898.1| hypothetical protein RetlK5_26662 [Rhizobium etli Kim 5] Length = 203 Back     alignment and organism information
>gi|190891887|ref|YP_001978429.1| hypothetical protein RHECIAT_CH0002296 [Rhizobium etli CIAT 652] Length = 203 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
pfam07238102 pfam07238, PilZ, PilZ domain 1e-04
>gnl|CDD|148695 pfam07238, PilZ, PilZ domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
pfam07238102 PilZ PilZ domain. This domain is found in a wide variet 98.28
PRK11498858 bcsA cellulose synthase catalytic subunit; Provisional 98.11
TIGR03030713 CelA cellulose synthase catalytic subunit (UDP-forming) 97.46
COG5581233 c-di-GMP-binding protein [Signal transduction mechanism 95.37
pfam07238102 PilZ PilZ domain. This domain is found in a wide variet 98.27
PRK11498858 bcsA cellulose synthase catalytic subunit; Provisional 97.56
TIGR03030713 CelA cellulose synthase catalytic subunit (UDP-forming) 97.42
COG5581233 c-di-GMP-binding protein [Signal transduction mechanism 95.6
>pfam07238 PilZ PilZ domain Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>COG5581 c-di-GMP-binding protein [Signal transduction mechanisms] Back     alignment and domain information
>pfam07238 PilZ PilZ domain Back     alignment and domain information
>PRK11498 bcsA cellulose synthase catalytic subunit; Provisional Back     alignment and domain information
>TIGR03030 CelA cellulose synthase catalytic subunit (UDP-forming) Back     alignment and domain information
>COG5581 c-di-GMP-binding protein [Signal transduction mechanisms] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
2rde_A251 Uncharacterized protein VCA0042; C-DI-GMP, structural g 1e-05
1ywu_A149 Hypothetical protein PA4608; PAT7, beta barrel, PILZ do 0.004
2rde_A251 Uncharacterized protein VCA0042; C-DI-GMP, structural g 0.001
>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* Length = 251 Back     alignment and structure
 Score = 44.9 bits (106), Expect = 1e-05
 Identities = 21/113 (18%), Positives = 44/113 (38%), Gaps = 14/113 (12%)

Query: 6   HNLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCD--VPMFLVGERSI 63
           + +Q    R   R +++L G+ +LFD    +C +R++S  G   +       + VG+   
Sbjct: 127 NTMQVSQLRKEPRFELNLAGK-VLFDEHRGDCELRDLSRSGCRFITPPLGKTYQVGDLVA 185

Query: 64  VFV-------EKVGRIEGKVVN-FDSNRGYAVRI---VTSENERRKLADKLIW 105
           + +       +    + GK+ N   S       +       N  + L  +L +
Sbjct: 186 LEIFSDLRGTKTFPPLTGKICNLQRSLHHARYGLEFNEEGRNNAKNLLAQLKF 238


>1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.45.2.1 Length = 149 Back     alignment and structure
>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* Length = 251 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
1ywu_A149 Hypothetical protein PA4608; PAT7, beta barrel, PILZ do 98.53
2rde_A251 Uncharacterized protein VCA0042; C-DI-GMP, structural g 98.05
1ywu_A149 Hypothetical protein PA4608; PAT7, beta barrel, PILZ do 98.4
2rde_A251 Uncharacterized protein VCA0042; C-DI-GMP, structural g 97.57
3kyf_A231 PP4397, putative uncharacterized protein; C-DI-GMP, PIL 95.02
3kyf_A231 PP4397, putative uncharacterized protein; C-DI-GMP, PIL 96.62
3cnr_A117 Type IV fimbriae assembly protein; PILZ, xanthomonas ci 93.89
>1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.45.2.1 Back     alignment and structure
Probab=98.53  E-value=7.1e-07  Score=61.06  Aligned_cols=76  Identities=11%  Similarity=0.074  Sum_probs=47.7

Q ss_pred             CCCHHCCCCCCCCCCCCCEEEEEECCCCEEEEEEEEEECCCEEEECCC--CCCCCCEEEE---------CCEEEEEEEEE
Q ss_conf             750210256747777651368995799889899998742420455157--7899855897---------34669999993
Q gi|254780885|r  113 HLQDCRAYGRKITRDREVDAQLVLNDNTKHSCKVIDISESGVSVSVDL--QIEMFSKVLF---------NDILGRVVRIF  181 (207)
Q Consensus       113 ~l~e~R~h~R~vPr~~~~~~~l~l~DG~~~~criiDiS~SGAAi~~~~--rp~iGs~V~v---------G~~~grVVRh~  181 (207)
                      .-.|.|++.|+.-..+   ++|... |..++|+++|+|+.|+.|.++.  .++.|..|.+         -.+.|+|||.-
T Consensus        26 ~~dERRrf~Ri~~~~~---a~L~~~-~~~~~~~v~DISl~G~~i~~~~~~~l~~~~~v~l~l~l~~~~~i~l~a~Vvr~~  101 (149)
T 1ywu_A           26 QHDERRRFHRIAFDAD---SEILQG-ERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWAR  101 (149)
T ss_dssp             CCCSSCCCCSSCCSCE---EEEEET-TEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEEEE
T ss_pred             CCCCCCCCEEEEEEEE---EEEEEC-CEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEEC
T ss_conf             9532478767887105---999989-989999999824897799758876788996499999869986389999999863


Q ss_pred             CCEEEEEECCC
Q ss_conf             89089997167
Q gi|254780885|r  182 PGGIAIEFSSV  192 (207)
Q Consensus       182 ~~GfaVeF~~~  192 (207)
                      ++++|++|..+
T Consensus       102 ~~~lGl~F~~i  112 (149)
T 1ywu_A          102 DGLLGFECQHI  112 (149)
T ss_dssp             TTEEEEEEEEE
T ss_pred             CCEEEEEEEEC
T ss_conf             87642498845



>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* 3kyg_A* Back     alignment and structure
>1ywu_A Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} SCOP: b.45.2.1 Back     alignment and structure
>2rde_A Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} SCOP: b.45.2.1 b.45.2.2 PDB: 1yln_A* 3kyg_A* Back     alignment and structure
>3kyf_A PP4397, putative uncharacterized protein; C-DI-GMP, PILZ domain, VCA0042, unknown function; HET: 5GP; 2.10A {Pseudomonas putida} PDB: 2gjg_A Back     alignment and structure
>3kyf_A PP4397, putative uncharacterized protein; C-DI-GMP, PILZ domain, VCA0042, unknown function; HET: 5GP; 2.10A {Pseudomonas putida} PDB: 2gjg_A Back     alignment and structure
>3cnr_A Type IV fimbriae assembly protein; PILZ, xanthomonas citri, type IV pilus assembly, unknown function; HET: MSE; 1.90A {Xanthomonas axonopodis PV} PDB: 3dsg_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
d1ywua1125 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudom 0.004
>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]} Length = 125 Back     information, alignment and structure

class: All beta proteins
fold: Split barrel-like
superfamily: PilZ domain-like
family: PilZ domain
domain: Hypothetical protein PA4608
species: Pseudomonas aeruginosa [TaxId: 287]
 Score = 35.2 bits (81), Expect = 0.004
 Identities = 14/109 (12%), Positives = 36/109 (33%), Gaps = 10/109 (9%)

Query: 12  DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFLVGERSIVFV----- 66
           ++R F R+  D     +L     +  ++ ++S  G+ +      +    +          
Sbjct: 7   ERRRFHRIAFDADSE-ILQGERRWEVLLHDVSLHGILVGQPQD-WNGDPQRPFEARLYLG 64

Query: 67  -EKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHL 114
            + + R+E  +     +          + +      +L+ L N  D  L
Sbjct: 65  LDVLIRMEISLAWAR-DGLLGFECQHIDLDSISHLRRLVEL-NLGDEEL 111


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
d1ywua1125 Hypothetical protein PA4608 {Pseudomonas aeruginosa [Ta 98.6
d1ywua1125 Hypothetical protein PA4608 {Pseudomonas aeruginosa [Ta 98.53
>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
class: All beta proteins
fold: Split barrel-like
superfamily: PilZ domain-like
family: PilZ domain
domain: Hypothetical protein PA4608
species: Pseudomonas aeruginosa [TaxId: 287]
Probab=98.60  E-value=2.2e-07  Score=62.72  Aligned_cols=93  Identities=13%  Similarity=0.106  Sum_probs=53.6

Q ss_pred             HHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCC-CCCCCEEEEEE----CCCCCEEEEEEEECCCCCEE
Q ss_conf             01062147999705799468983026999875685499942788-76797499999----55443769999930898389
Q gi|254780885|r   12 DQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPM-FLVGERSIVFV----EKVGRIEGKVVNFDSNRGYA   86 (207)
Q Consensus        12 drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~-~~~Gervv~Yl----d~iGrlEG~V~r~~~~~GFa   86 (207)
                      |||+|.|+++.+++..... +..|.|.+.|+|.+|+.+.++.+. +..|+.+.++|    +..-.++|+|++...+ |..
T Consensus         7 erR~~~Rv~~~~~~~l~~~-~~~~~~~~~DiS~~G~~i~~~~~~~~~~~~~v~l~l~l~~~~~i~~~~~Vv~~~~~-~~G   84 (125)
T d1ywua1           7 ERRRFHRIAFDADSEILQG-ERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWARDG-LLG   84 (125)
T ss_dssp             SSCCCCSSCCSCEEEEEET-TEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEEEETT-EEE
T ss_pred             CCCCCEEEEEEEEEEEEEC-CEEEEEEEEEECCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEECCC-EEE
T ss_conf             2479867875207999999-99999999982178489974887788999879999986999599999999997499-999


Q ss_pred             EEEEC-CHHHHHHHHHHHHHHH
Q ss_conf             99976-9878999999999876
Q gi|254780885|r   87 VRIVT-SENERRKLADKLIWLA  107 (207)
Q Consensus        87 v~l~~-t~~kR~kLA~qLtWla  107 (207)
                      +.|.. ......+| ..|.|+-
T Consensus        85 l~f~~id~ds~~~L-r~li~~~  105 (125)
T d1ywua1          85 FECQHIDLDSISHL-RRLVELN  105 (125)
T ss_dssp             EEEEEECHHHHHHH-HHHHHHH
T ss_pred             EEEEECCHHHHHHH-HHHHHHH
T ss_conf             99986698999999-9999846



>d1ywua1 b.45.2.1 (A:1-125) Hypothetical protein PA4608 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 207 hypothetical protein CLIBASIA_03910 [Candidatus Li
1ywu_A_149 (A:) Hypothetical protein PA4608; PAT7, beta barre 2e-08
>1ywu_A (A:) Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1}Length = 149 Back     alignment and structure
 Score = 53.8 bits (129), Expect = 2e-08
 Identities = 15/114 (13%), Positives = 37/114 (32%), Gaps = 8/114 (7%)

Query: 8   LQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPMFL-VGERSIVFV 66
            Q  ++R F R+  D     +L     +  ++ ++S  G+ +                 +
Sbjct: 25  DQHDERRRFHRIAFDADSE-ILQGERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARL 83

Query: 67  ----EKVGRIEGKVVNFDSNRGYAVRIVTSENERRKLADKLIWLANKDDLHLQD 116
               + + R+E  +     +          + +      +L+ L N  D  L +
Sbjct: 84  YLGLDVLIRMEISLAWAR-DGLLGFECQHIDLDSISHLRRLVEL-NLGDEELLE 135


Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 hypothetical protein CLIBASIA_03910 [Candidatus Liberib
1ywu_A_149 Hypothetical protein PA4608; PAT7, beta barrel, PI 98.77
2rde_A_138-251114 Uncharacterized protein VCA0042; C-DI-GMP, structu 97.52
1ywu_A_149 Hypothetical protein PA4608; PAT7, beta barrel, PI 98.51
2rde_A_138-251114 Uncharacterized protein VCA0042; C-DI-GMP, structu 96.39
2gjg_A_124-248125 Hypothetical protein PP4397; structural genomics, 96.32
3cnr_A_117 Type IV fimbriae assembly protein; PILZ, xanthomon 96.25
3cnr_A_117 Type IV fimbriae assembly protein; PILZ, xanthomon 96.9
2gjg_A_124-248125 Hypothetical protein PP4397; structural genomics, 96.74
>1ywu_A (A:) Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} Back     alignment and structure
Probab=98.77  E-value=7e-08  Score=68.17  Aligned_cols=102  Identities=13%  Similarity=0.040  Sum_probs=79.7

Q ss_pred             HHHHHHHCCCEEEEEEEEEEEEECCCCCEEEEEEEECCCCEEEEECCCC-CCCCCEEEEEEC----CCCCEEEEEEEECC
Q ss_conf             4322201062147999705799468983026999875685499942788-767974999995----54437699999308
Q gi|254780885|r    7 NLQFIDQRAFQRVKVDLKGRFLLFDGTEYNCIVREISPGGLCIVCDVPM-FLVGERSIVFVE----KVGRIEGKVVNFDS   81 (207)
Q Consensus         7 ~~~~~drR~f~RV~v~l~GR~ll~d~~E~~C~t~diSpgg~~l~~~~~~-~~~Gervv~Yld----~iGrlEG~V~r~~~   81 (207)
                      +.+..++|+|.|+++.+++.+..+ ...++|.+.|||.+|+++.++.+. ...|+.+.++|.    ....++|+|++...
T Consensus        24 ~~~~~~rR~~~Rv~~~~~~~i~~~-~~~~~~~~~DiS~~G~~i~~~~~~~~~~~~~~~l~l~~~~~~~~~~~~~Vv~~~~  102 (149)
T 1ywu_A           24 SDQHDERRRFHRIAFDADSEILQG-ERRWEVLLHDVSLHGILVGQPQDWNGDPQRPFEARLYLGLDVLIRMEISLAWARD  102 (149)
T ss_dssp             CSCCCSSCCCCSSCCSCEEEEEET-TEEEEEEEEEECSSEEEEECSSCCCCCTTSEEEEEEESSSSCEEEEEEEEEEEET
T ss_pred             CCCCCCCCCCEEEEECCEEEEEEC-CEEEEEEEEECCCCCEEEECCCCCCCCCCCEEEEEEECCCCCEEEEEEEEEEECC
T ss_conf             889542578766874033999989-9999999998147867997578767889956999998699856999999999649


Q ss_pred             CCCEEEEEECCHHHHHHHHHHHHHHHCCC
Q ss_conf             98389999769878999999999876424
Q gi|254780885|r   82 NRGYAVRIVTSENERRKLADKLIWLANKD  110 (207)
Q Consensus        82 ~~GFav~l~~t~~kR~kLA~qLtWlanr~  110 (207)
                       .+..+.|...+..-.....++.|.-..+
T Consensus       103 -~~~G~~F~~~~~~~~~~l~~~i~~~~~~  130 (149)
T 1ywu_A          103 -GLLGFECQHIDLDSISHLRRLVELNLGD  130 (149)
T ss_dssp             -TEEEEEEEEECHHHHHHHHHHHHHHTCC
T ss_pred             -CEEEEEEEEECHHHHHHHHHHHHHHCCC
T ss_conf             -9899999752888999999999876799



>2rde_A (A:138-251) Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} Back     alignment and structure
>1ywu_A (A:) Hypothetical protein PA4608; PAT7, beta barrel, PILZ domain, structural genomics, PSI, protein structure initiative; NMR {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>2rde_A (A:138-251) Uncharacterized protein VCA0042; C-DI-GMP, structural genomics, PSI-2, protein structure initiative; HET: C2E; 1.92A {Vibrio cholerae O395} Back     alignment and structure
>2gjg_A (A:124-248) Hypothetical protein PP4397; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Pseudomonas putida KT2440} Back     alignment and structure
>3cnr_A (A:) Type IV fimbriae assembly protein; PILZ, xanthomonas citri, type IV pilus assembly, unknown function; HET: MSE; 1.90A {Xanthomonas axonopodis PV} PDB: 3dsg_A Back     alignment and structure
>3cnr_A (A:) Type IV fimbriae assembly protein; PILZ, xanthomonas citri, type IV pilus assembly, unknown function; HET: MSE; 1.90A {Xanthomonas axonopodis PV} PDB: 3dsg_A Back     alignment and structure
>2gjg_A (A:124-248) Hypothetical protein PP4397; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.25A {Pseudomonas putida KT2440} Back     alignment and structure