254780891

254780891

hypothetical protein CLIBASIA_03940

GeneID in NCBI database:8209911Locus tag:CLIBASIA_03940
Protein GI in NCBI database:254780891Protein Accession:YP_003065304.1
Gene range:+(867295, 867942)Protein Length:215aa
Gene description:hypothetical protein
COG prediction:[T] Signal transduction histidine kinase
KEGG prediction:hypothetical protein; K13588 histidine phosphotransferase ChpT
SEED prediction:hypothetical protein
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
cccccEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEEccccccEEEEEEccccccccHHHHHHHcccccccccHHcccHHHHHHHHHHccccEEEEEEcccEEEEEEEccc
ccccccEEccHHHHHHHHHHHHHHHHHcHHHHHHcHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccccccEEEEEEEcccccccHHHHHHHcccccccccHHHHHHHHHHHHHHHcccEEEEEcccccEEEEEEEEcc
maknicfnlSSMDLVALLCSRIchdiispigaIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAfgytgsvdsliglgDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHaslprggkvtisvqdskneniFSLKingnlarfpekftqivdgnvestidshDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
maknicfnLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIavdkrvqvswtgekidlsRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
***********MDLVALLCSRICHDIISPIGAIHNSLELLD***********IRLSSMSAIIRLKFMRLAF**************IEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLE*
MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
***NICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK
MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
315122692215 hypothetical protein CKC_04720 [Candidatus Liberibacter 1 2e-77
222086835215 hypothetical protein Arad_3506 [Agrobacterium radiobact 1 7e-53
307300490220 Protein of unknown function DUF2328 [Sinorhizobium meli 1 4e-52
15966473221 hypothetical protein SMc00652 [Sinorhizobium meliloti 1 1 5e-52
150397806220 hypothetical protein Smed_2608 [Sinorhizobium medicae W 1 7e-52
227823289215 hypothetical protein NGR_c27600 [Sinorhizobium fredii N 1 8e-52
15889709215 hypothetical protein Atu2438 [Agrobacterium tumefaciens 1 1e-51
222149590216 hypothetical protein Avi_3529 [Agrobacterium vitis S4] 1 2e-51
325293788215 hypothetical protein AGROH133_08299 [Agrobacterium sp. 1 2e-51
190893162215 hypothetical protein RHECIAT_CH0003580 [Rhizobium etli 1 3e-51
>gi|315122692|ref|YP_004063181.1| hypothetical protein CKC_04720 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 215 Back     alignment and organism information
 Score =  292 bits (748), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 143/215 (66%), Positives = 174/215 (80%)

Query: 1   MAKNICFNLSSMDLVALLCSRICHDIISPIGAIHNSLELLDEVGIEDEVMQLIRLSSMSA 60
           M  N+ F+LSSMDL ALLCSRICHDIISPIGAIHNSLELLDE GIEDE +QLIRLSSM+A
Sbjct: 1   MVNNLSFSLSSMDLSALLCSRICHDIISPIGAIHNSLELLDEEGIEDEAIQLIRLSSMNA 60

Query: 61  IIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSWTGEKIDLSRERAKILL 120
           I RLKF+RLAF YTGSV SL+GL +I+Q+I DFIA+D R+ V W  E+ DL R+++K+LL
Sbjct: 61  IARLKFIRLAFCYTGSVHSLVGLDEIKQIIRDFIAIDNRITVFWVSEETDLFRKKSKLLL 120

Query: 121 NLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLARFPEKFTQIVDGNVESTIDSHD 180
           NLFM+A+ASL +GG++ IS++DS  +NIFSLKINGN  R PEKF QI+  +V+  IDSH 
Sbjct: 121 NLFMIAYASLLKGGEIIISIKDSTADNIFSLKINGNRVRLPEKFIQIMAQDVDLEIDSHS 180

Query: 181 IQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK 215
           +Q YY  LLA EN ++L  EIIDD NVVLS L +K
Sbjct: 181 VQLYYTALLADENDVKLSYEIIDDQNVVLSVLTKK 215


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086835|ref|YP_002545369.1| hypothetical protein Arad_3506 [Agrobacterium radiobacter K84] Length = 215 Back     alignment and organism information
>gi|307300490|ref|ZP_07580270.1| Protein of unknown function DUF2328 [Sinorhizobium meliloti BL225C] Length = 220 Back     alignment and organism information
>gi|15966473|ref|NP_386826.1| hypothetical protein SMc00652 [Sinorhizobium meliloti 1021] Length = 221 Back     alignment and organism information
>gi|150397806|ref|YP_001328273.1| hypothetical protein Smed_2608 [Sinorhizobium medicae WSM419] Length = 220 Back     alignment and organism information
>gi|227823289|ref|YP_002827261.1| hypothetical protein NGR_c27600 [Sinorhizobium fredii NGR234] Length = 215 Back     alignment and organism information
>gi|15889709|ref|NP_355390.1| hypothetical protein Atu2438 [Agrobacterium tumefaciens str. C58] Length = 215 Back     alignment and organism information
>gi|222149590|ref|YP_002550547.1| hypothetical protein Avi_3529 [Agrobacterium vitis S4] Length = 216 Back     alignment and organism information
>gi|325293788|ref|YP_004279652.1| hypothetical protein AGROH133_08299 [Agrobacterium sp. H13-3] Length = 215 Back     alignment and organism information
>gi|190893162|ref|YP_001979704.1| hypothetical protein RHECIAT_CH0003580 [Rhizobium etli CIAT 652] Length = 215 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
pfam10090181 pfam10090, DUF2328, Uncharacterized protein conserved i 9e-32
COG5385214 COG5385, COG5385, Uncharacterized protein conserved in 2e-48
>gnl|CDD|150730 pfam10090, DUF2328, Uncharacterized protein conserved in bacteria (DUF2328) Back     alignment and domain information
>gnl|CDD|34947 COG5385, COG5385, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
PRK10364455 sensor protein ZraS; Provisional 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
PRK13837 831 two-component VirA-like sensor kinase; Provisional 100.0
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 100.0
PRK09303378 adaptive-response sensory kinase; Validated 100.0
PRK11006431 phoR phosphate regulon sensor protein; Provisional 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
PRK11100475 sensory histidine kinase CreC; Provisional 100.0
PRK13557 538 histidine kinase; Provisional 100.0
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 100.0
PRK10841 947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK09835482 sensor kinase CusS; Provisional 100.0
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
PRK10755355 sensor protein BasS/PmrB; Provisional 100.0
PRK09470461 cpxA two-component sensor protein; Provisional 100.0
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK09467437 envZ osmolarity sensor protein; Provisional 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 100.0
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
PRK10337446 sensor protein QseC; Provisional 100.0
PRK10815484 sensor protein PhoQ; Provisional 100.0
COG4191603 Signal transduction histidine kinase regulating C4-dica 100.0
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 100.0
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 100.0
PRK11086541 sensory histidine kinase DcuS; Provisional 100.0
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 99.97
COG5000712 NtrY Signal transduction histidine kinase involved in n 99.97
COG4251750 Bacteriophytochrome (light-regulated signal transductio 99.96
COG5385214 Uncharacterized protein conserved in bacteria [Function 99.93
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 99.93
COG3290537 CitA Signal transduction histidine kinase regulating ci 99.91
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 99.88
pfam10090181 DUF2328 Uncharacterized protein conserved in bacteria ( 99.83
COG4192673 Signal transduction histidine kinase regulating phospho 99.81
PRK13560807 hypothetical protein; Provisional 99.73
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 99.67
PRK10618 881 phosphotransfer intermediate protein in two-component r 99.52
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.51
COG2972456 Predicted signal transduction protein with a C-terminal 99.49
PRK11644497 sensory histidine kinase UhpB; Provisional 99.31
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 99.29
COG3920221 Signal transduction histidine kinase [Signal transducti 99.14
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 98.91
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 98.85
PRK13559363 hypothetical protein; Provisional 98.82
KOG0519 786 consensus 97.64
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 99.87
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 99.87
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 99.84
PRK10547 662 chemotaxis protein CheA; Provisional 99.73
COG4585365 Signal transduction histidine kinase [Signal transducti 99.37
PRK03660146 anti-sigma F factor; Provisional 99.12
COG4564459 Signal transduction histidine kinase [Signal transducti 98.87
KOG0787414 consensus 98.59
PRK04069158 serine-protein kinase RsbW; Provisional 98.32
COG1389 538 DNA topoisomerase VI, subunit B [DNA replication, recom 98.18
TIGR01052 662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 98.15
PRK04184 533 DNA topoisomerase VI subunit B; Validated 98.06
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 97.98
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 97.3
COG0326 623 HtpG Molecular chaperone, HSP90 family [Posttranslation 97.12
PTZ00272 701 heat shock protein 83 kDa (Hsp83); Provisional 97.03
PTZ00130 824 heat shock protein 90; Provisional 96.83
PRK05218 612 heat shock protein 90; Provisional 96.71
TIGR01924161 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 Th 96.53
TIGR01058 655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 94.58
PRK05644 725 gyrB DNA gyrase subunit B; Validated 92.29
COG5381184 Uncharacterized protein conserved in bacteria [Function 91.69
COG0643 716 CheA Chemotaxis protein histidine kinase and related ki 99.7
pfam0051266 HisKA His Kinase A (phosphoacceptor) domain. dimerizati 98.21
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacceptor) 98.12
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimerisati 98.02
TIGR00585 367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 97.29
PRK00095 612 mutL DNA mismatch repair protein; Reviewed 97.07
COG0323 638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 96.52
KOG1978 672 consensus 91.73
PTZ00108 1506 DNA topoisomerase II; Provisional 91.4
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>COG5385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>pfam10090 DUF2328 Uncharacterized protein conserved in bacteria (DUF2328) Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor; InterPro: IPR010194 This entry describes the SpoIIAB anti-sigma F factor Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>TIGR01924 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 This entry describes the anti-sigma B factor also known as serine-protein kinase RsbW Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IPR005740 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05644 gyrB DNA gyrase subunit B; Validated Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>pfam00512 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG1978 consensus Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
2c2a_A258 Structure Of The Entire Cytoplasmic Portion Of A Se 3e-25
3dge_A258 Structure Of A Histidine Kinase-Response Regulator 3e-25
3d36_A244 How To Switch Off A Histidine Kinase: Crystal Struc 8e-24
3a0r_A349 Crystal Structure Of Histidine Kinase Thka (Tm1359) 7e-23
>gi|83754490|pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 Back     alignment and structure
 Score =  119 bits (298), Expect = 3e-25,   Method: Composition-based stats.
 Identities = 24/240 (10%), Positives = 53/240 (22%), Gaps = 31/240 (12%)

Query: 4   NICFNLSSMDLVALLCSRICHDIISPIGAIHNS-------------------LELLDEVG 44
                +  M       + I H++ +P+ AI                      LE++ +  
Sbjct: 11  ERLKRIDRMK--TEFIANISHELRTPLTAIKAYAETIYNSLGELDLSTLKEFLEVIIDQS 68

Query: 45  IEDEVMQLIRLSSMSAIIRLKFMRLAFGYTGSVDSLIGLGDIEQVIEDFIAVDKRVQVSW 104
              E +    L       +   +         +         E      + V     V  
Sbjct: 69  NHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNVPC 128

Query: 105 TGEKIDLSRERAKILLNLFMVAHASLPRGGKVTISV---QDSKNENIFSLKINGNLARFP 161
             E         ++LLNL         +            +     +  ++ NG      
Sbjct: 129 PVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGI-PD 187

Query: 162 EKFTQIVDGNV------ESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK 215
               +I +            +    +       +   +  R+  E            + K
Sbjct: 188 HAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK 247


>gi|251836869|pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 258 Back     alignment and structure
>gi|220702379|pdb|3D36|A Chain A, How To Switch Off A Histidine Kinase: Crystal Structure Of Geobacillus Stearothermophilus Kinb With The Inhibitor Sda Length = 244 Back     alignment and structure
>gi|261824752|pdb|3A0R|A Chain A, Crystal Structure Of Histidine Kinase Thka (Tm1359) In Complex With Response Regulator Protein Trra (Tm1360) Length = 349 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 6e-06
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 7e-04
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Length = 244 Back     alignment and structure
 Score = 46.0 bits (109), Expect = 6e-06
 Identities = 41/174 (23%), Positives = 70/174 (40%), Gaps = 22/174 (12%)

Query: 12  MDLVALLCSRICHDIISPIGAIHNSLELL-DEVGIEDEVMQLIR-----LSSMSAIIR-- 63
           M+ V  L + I H+I +P+ A    ++L+ ++    D+  Q  R     L    AII   
Sbjct: 11  MEAVTHLAASISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDY 70

Query: 64  LKFMRLAFGYTGSVDSLIGLGDIEQVIEDF--IAVDKRVQVSWTGEKIDLSRERAKI--- 118
           L F + A      ++  +   +IE+VI+    +A    V +  T     +  ER K    
Sbjct: 71  LTFAKPAPETPEKLNVKL---EIERVIDILRPLANMSCVDIQATLAPFSVIGEREKFRQC 127

Query: 119 LLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKING------NLARFPEKFTQ 166
           LLN+   A  ++P GG + + V       +  +   G       L R  E +  
Sbjct: 128 LLNVMKNAIEAMPNGGTLQVYVSIDNGRVLIRIADTGVGMTKEQLERLGEPYFT 181


>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
3d36_A244 Sporulation kinase B; GHKL ATPase, four helix bundle, c 100.0
2c2a_A258 Sensor histidine kinase; phosphotransfer, PHOQ, selenom 100.0
3a0r_A349 Sensor protein; four helix bundle, PAS fold, kinase, ph 100.0
3jz3_A222 Sensor protein QSEC; helix-turn-helix, kinase domain, A 100.0
1gkz_A388 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kin 99.96
1b3q_A 379 Protein (chemotaxis protein CHEA); histine kinase, sign 99.88
3ehh_A218 Sensor kinase (YOCF protein); four-helix bundle, GHL AT 99.77
2btz_A394 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif r 99.95
2e0a_A394 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-bind 99.95
1y8o_A419 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; 99.93
2q8g_A407 [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; 99.93
1id0_A152 PHOQ histidine kinase; PHOQ/PHOP, signal transduction, 99.92
1ysr_A150 Sensor-type histidine kinase PRRB; ATP-binding domain, 99.92
1bxd_A161 ENVZ(290-450), protein (osmolarity sensor protein (ENVZ 99.91
2zbk_B 530 Type 2 DNA topoisomerase 6 subunit B; DNA binding prote 99.39
1th8_A145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, 99.36
1mu5_A 471 Type II DNA topoisomerase VI subunit B; GHKL ATPase, he 99.33
3ehg_A128 Sensor kinase (YOCF protein); GHL ATPase domain, transf 99.3
1i58_A189 Chemotaxis protein CHEA; beta-alpha sandwich, signaling 99.28
3ke6_A399 Protein RV1364C/MT1410; anti-sigma factor, anti-sigma f 98.33
2q2e_B 621 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO1 97.65
2cg9_A 677 ATP-dependent molecular chaperone HSP82; chaperone comp 97.55
3h4l_A 367 DNA mismatch repair protein PMS1; ATP binding, DNA repa 97.4
1h7s_A 365 PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatc 97.38
2o1u_A 666 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP- 97.25
3peh_A 281 Endoplasmin homolog; structural genomics, structural ge 97.14
1y4s_A 559 Chaperone protein HTPG; HSP90, molecular chaperone, ATP 96.93
2ioq_A 624 Chaperone protein HTPG; heat shock protein, HSP90; 3.50 96.9
1ei1_A 391 DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HE 96.89
2wer_A220 ATP-dependent molecular chaperone HSP82; ATPase, cytopl 96.86
2ior_A235 Chaperone protein HTPG; heat shock protein, HSP90; HET: 96.69
1qy5_A 269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1 96.61
3cwv_A 369 DNA gyrase, B subunit, truncated; structural genomics, 96.56
1zxm_A 400 TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; G 96.56
2gqp_A236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, liga 96.44
3g7e_A203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {E 96.34
1yc1_A264 HSP 86, heat shock protein HSP 90-alpha; cell-cycle, ca 96.22
1kij_A 390 DNA gyrase subunit B; topoisomerase, gyrase B-coumarin 96.13
1pvg_A 418 DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 96.09
1s16_A 390 Topoisomerase IV subunit B; two-domain protein complexe 95.85
3g75_A184 DNA gyrase subunit B; antibiotic resistance, isomerase; 95.16
1uyl_A236 HSP 86, heat shock protein HSP 90-alpha; ATPase, chaper 95.13
3fv5_A201 DNA topoisomerase 4 subunit B; topoisomerase IV B subun 95.1
3a0y_A152 Sensor protein; ATP-LID, kinase, phosphoprotein, transf 99.94
1r62_A160 Nitrogen regulation protein NR(II); PII, histidine kina 99.91
1ixm_A192 SPO0B, protein (sporulation response regulatory protein 99.71
1joy_A67 Protein (ENVZ_ecoli); histidine kinase, sensory transdu 98.21
3na3_A 348 DNA mismatch repair protein MLH1; MUTL protein homolog 97.17
1b63_A 333 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Esc 97.12
3ied_A272 Heat shock protein; HSP90, chaperone, structural genomi 97.15
>3d36_A Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=100.00  E-value=1.3e-40  Score=276.40  Aligned_cols=205  Identities=14%  Similarity=0.165  Sum_probs=154.0

Q ss_pred             HHHHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCCH----HHHHHHHHHHHHHHHHHH----HHHCCCCCCCCCC
Q ss_conf             967687999--997745454227999999999996144301----478988899999999863----1100112232000
Q gi|254780891|r    9 LSSMDLVAL--LCSRICHDIISPIGAIHNSLELLDEVGIED----EVMQLIRLSSMSAIIRLK----FMRLAFGYTGSVD   78 (215)
Q Consensus         9 ~~~~~laal--las~IaHdlrtPL~~I~~~~elL~~~~~~~----~~~~~i~~~~~~~~~l~~----~~r~~~~~~~~~~   78 (215)
                      +++.||+++  |+|+|||||||||++|.+++++|.+.....    ++.+.+.+.+.++..+++    +.+.........+
T Consensus         6 ~qaekl~alg~l~a~isHElrtPLt~I~~~~~ll~~~~~~~~~~~~~~~~i~~~~~rl~~li~~ll~~~~~~~~~~~~~~   85 (244)
T 3d36_A            6 IRAEKMEAVTHLAASISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPEKLN   85 (244)
T ss_dssp             EC---------CCCCHHHHHHHHHHHHHHHHHHGGGCTTCHHHHHHHHHHHHHHHHHHHHHHHHHHSSCCSSCCCCEEEE
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEEC
T ss_conf             99999999999999999998679999999999997789986999999999999999999999999987276878971664


Q ss_pred             CCCCCCHHHHHHHHHHHCCCCCCCCCCCC---CCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECC
Q ss_conf             00000013444443220122332110000---001000123444567664687653200111112355772047999878
Q gi|254780891|r   79 SLIGLGDIEQVIEDFIAVDKRVQVSWTGE---KIDLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKING  155 (215)
Q Consensus        79 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~~~qvl~NLi~NA~~a~~~gg~I~i~~~~~~~~~~i~V~D~G  155 (215)
                      ....+.++...+..... ...+.+..+.+   ...++..+.|++.||+.||++|+|.+|.|+|.+..+++++.|.|+|+|
T Consensus        86 l~~~i~~~~~~~~~~~~-~~~i~~~~~~~~~~v~~d~~~l~qvl~NLl~NAik~~~~~~~i~i~~~~~~~~v~i~V~D~G  164 (244)
T 3d36_A           86 VKLEIERVIDILRPLAN-MSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIEAMPNGGTLQVYVSIDNGRVLIRIADTG  164 (244)
T ss_dssp             HHHHHHHHHHHHHHHHT-TTTEEEEEECCCCEEEECHHHHHHHHHHHHHHHHHTCTTCEEEEEEEEEETTEEEEEEEECS
T ss_pred             HHHHHHHHHHHHHHHHH-HCCEEEEEECCCCEEEECHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCEEEEEEEECC
T ss_conf             99999999999999975-16859995079846997799999999999999998676897689999960888999999868


Q ss_pred             CCCCCHHHHHHHHCCCCCCCC-CCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEEC
Q ss_conf             984402458874054545789-987204999999999709879999877992699999419
Q gi|254780891|r  156 NLARFPEKFTQIVDGNVESTI-DSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK  215 (215)
Q Consensus       156 ~Gi~~~e~~~~~~~~~~~~~~-~g~GlGl~~~~~i~~~~gG~i~v~~~~~~g~~f~~~l~~  215 (215)
                      +||+ ++..+++|+||++++. +|+|||||+|+.|++.|||+|+++|.+++|++|+++||.
T Consensus       165 ~GI~-~e~~~~iFepF~~tk~~~GtGLGL~i~k~iv~~hgG~I~v~S~~~~Gt~f~i~lP~  224 (244)
T 3d36_A          165 VGMT-KEQLERLGEPYFTTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLPL  224 (244)
T ss_dssp             SCCC-HHHHHHTTSTTCCSSGGGCCSCHHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEEC
T ss_pred             CCCC-HHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCEEEEEEEEC
T ss_conf             8989-89999866998658999964768999999999889979999669996699999878



>2c2a_A Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} SCOP: a.30.2.1 d.122.1.3 PDB: 3dge_A* Back     alignment and structure
>3a0r_A Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transferase, two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>3jz3_A Sensor protein QSEC; helix-turn-helix, kinase domain, ATP-binding, cell inner MEM cell membrane, kinase, membrane, nucleotide-binding; 2.50A {Escherichia coli} Back     alignment and structure
>1gkz_A [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} SCOP: a.29.5.1 d.122.1.4 PDB: 1gjv_A 1gkx_A* Back     alignment and structure
>1b3q_A Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi- domains protein, transferase; 2.60A {Thermotoga maritima} SCOP: a.30.2.1 b.40.7.1 d.122.1.3 PDB: 2ch4_A* Back     alignment and structure
>3ehh_A Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>2btz_A Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2e0a_A Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>1y8o_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 3; pyruvate dehydrogenase kinase 3, lipoyl-bearing domain; HET: LPA ADP; 2.48A {Homo sapiens} SCOP: a.29.5.1 d.122.1.4 PDB: 1y8n_A* 1y8p_A* 2pnr_A* 2q8i_A* Back     alignment and structure
>2q8g_A [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure
>1id0_A PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} SCOP: d.122.1.3 PDB: 3cgz_A 3cgy_A Back     alignment and structure
>1ysr_A Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} SCOP: d.122.1.3 PDB: 1ys3_A Back     alignment and structure
>1bxd_A ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli BL21} SCOP: d.122.1.3 Back     alignment and structure
>2zbk_B Type 2 DNA topoisomerase 6 subunit B; DNA binding protein, decatenation, ATPase, drug design, DNA-binding, magnesium, metal-binding; HET: RDC; 3.56A {Sulfolobus shibatae} Back     alignment and structure
>1th8_A Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-sigma, sporulation, serine kinase, transcription; HET: ADP; 2.40A {Geobacillus stearothermophilus} SCOP: d.122.1.3 PDB: 1thn_A* 1til_A* 1l0o_A* 1tid_A* Back     alignment and structure
>1mu5_A Type II DNA topoisomerase VI subunit B; GHKL ATPase, helix two-turns helix; 2.00A {Sulfolobus shibatae} SCOP: a.156.1.3 d.14.1.3 d.122.1.2 PDB: 1mx0_A* 1z5b_A* 1z5a_A* 1z59_A* 1z5c_A* 2hkj_A* Back     alignment and structure
>3ehg_A Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>1i58_A Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} SCOP: d.122.1.3 PDB: 1i59_A* 1i5a_A* 1i5b_A* 1i5c_A* 1i5d_A* Back     alignment and structure
>3ke6_A Protein RV1364C/MT1410; anti-sigma factor, anti-sigma factor antagonist, phosphatase serine kinase, ATPase, unknown function; 2.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2q2e_B Type 2 DNA topoisomerase 6 subunit B; DNA-binding, SPO11, ATPase; 4.00A {Methanosarcina mazei} Back     alignment and structure
>2cg9_A ATP-dependent molecular chaperone HSP82; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure
>3h4l_A DNA mismatch repair protein PMS1; ATP binding, DNA repair, DNA damage, nucleus, phosphop DNA binding protein, protein binding; HET: DNA ANP; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>1h7s_A PMS1 protein homolog 2; DNA repair, GHL ATPase, mismatch repair, HNPCC; 1.95A {Homo sapiens} SCOP: d.14.1.3 d.122.1.2 PDB: 1h7u_A* 1ea6_A* Back     alignment and structure
>2o1u_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, AMP-PNP, GP96; HET: ANP; 2.40A {Canis lupus familiaris} PDB: 2o1v_A* 2o1w_A 2o1t_A Back     alignment and structure
>3peh_A Endoplasmin homolog; structural genomics, structural genomics consortium, SGC, HE protein, chaperone, ATP binding; HET: IBD; 2.75A {Plasmodium falciparum 3D7} PDB: 3pej_A* Back     alignment and structure
>1y4s_A Chaperone protein HTPG; HSP90, molecular chaperone, ATPase; HET: ADP; 2.90A {Escherichia coli} PDB: 1y4u_A Back     alignment and structure
>2ioq_A Chaperone protein HTPG; heat shock protein, HSP90; 3.50A {Escherichia coli} PDB: 2iop_A Back     alignment and structure
>1ei1_A DNA gyrase B, GYRB; ATPase domain, dimer, isomerase; HET: DNA ANP; 2.30A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>2wer_A ATP-dependent molecular chaperone HSP82; ATPase, cytoplasm, ATP-binding, phosphoprotein, stress response, nucleotide-binding; HET: RDC; 1.60A {Saccharomyces cerevisiae} PDB: 2weq_A* 2wep_A* 1zwh_A* 1zw9_A* 2fxs_A* 3c11_A* 3c0e_A* 2akp_A Back     alignment and structure
>2ior_A Chaperone protein HTPG; heat shock protein, HSP90; HET: ADP; 1.65A {Escherichia coli} Back     alignment and structure
>1qy5_A Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: NEC; 1.75A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1qy8_A* 1qye_A* 1u0y_A* 1yt2_A* Back     alignment and structure
>3cwv_A DNA gyrase, B subunit, truncated; structural genomics, unknown function, ATP-binding, isomerase, nucleotide-binding, topoisomerase; HET: DNA; 1.95A {Myxococcus xanthus dk 1622} Back     alignment and structure
>1zxm_A TOPO IIA ATPase, DNA topoisomerase II, alpha isozyme; GHKL nucleotide-binding fold; HET: DNA ANP; 1.87A {Homo sapiens} PDB: 1zxn_A* Back     alignment and structure
>2gqp_A Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, ligand, NECA, NPCA, adenosine; HET: PA7 PG4 1PE; 1.50A {Canis lupus familiaris} SCOP: d.122.1.1 PDB: 1tc0_A* 1tbw_A* 1u0z_A* 1u2o_A* 1ysz_A* 1yt0_A* 1yt1_A* 2exl_A* 2fyp_A* 2gfd_A* 1tc6_A* 2h8m_A* 2hch_A* 2hg1_A* 2esa_A* Back     alignment and structure
>3g7e_A DNA gyrase subunit B; isomerase; HET: DNA B46; 2.20A {Escherichia coli} PDB: 1kzn_A* 1aj6_A* Back     alignment and structure
>1yc1_A HSP 86, heat shock protein HSP 90-alpha; cell-cycle, cancer, drug design, cell cycle; HET: 4BC; 1.70A {Homo sapiens} SCOP: d.122.1.1 PDB: 1yc3_A* 1yc4_A* Back     alignment and structure
>1kij_A DNA gyrase subunit B; topoisomerase, gyrase B-coumarin complex; HET: DNA NOV; 2.30A {Thermus thermophilus} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>1pvg_A DNA topoisomerase II; GHKL ATPase domain; HET: DNA ANP; 1.80A {Saccharomyces cerevisiae} SCOP: d.14.1.3 d.122.1.2 PDB: 1qzr_A* Back     alignment and structure
>1s16_A Topoisomerase IV subunit B; two-domain protein complexed with ADPNP; HET: ANP; 2.10A {Escherichia coli} SCOP: d.14.1.3 d.122.1.2 Back     alignment and structure
>3g75_A DNA gyrase subunit B; antibiotic resistance, isomerase; HET: DNA B48; 2.30A {Staphylococcus aureus} PDB: 3g7b_A* Back     alignment and structure
>1uyl_A HSP 86, heat shock protein HSP 90-alpha; ATPase, chaperone, ATP-binding; 1.4A {Homo sapiens} SCOP: d.122.1.1 PDB: 1uy7_A* 1uy8_A* 1uy9_A* 1uyc_A* 1uyd_A* 1uye_A* 1uyf_A* 1uyg_A* 1uyh_A* 1uyk_A* 1uy6_A 2cdd_A* 2uwd_A* 2vci_A* 2vcj_A* 2wi1_A* 2wi2_A* 2wi3_A* 2wi4_A* 2wi5_A* ... Back     alignment and structure
>3fv5_A DNA topoisomerase 4 subunit B; topoisomerase IV B subunit complex, antibiotic resistance, ATP-binding, nucleotide-binding; HET: DNA 1EU; 1.80A {Escherichia coli} PDB: 1s14_A* Back     alignment and structure
>3a0y_A Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>1r62_A Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transferase; 1.60A {Escherichia coli K12} SCOP: d.122.1.3 Back     alignment and structure
>1ixm_A SPO0B, protein (sporulation response regulatory protein); phosphotransferase, two component system; 2.60A {Bacillus subtilis} SCOP: d.123.1.1 PDB: 2ftk_A* 1f51_A Back     alignment and structure
>1joy_A Protein (ENVZ_ecoli); histidine kinase, sensory transduction, osmolarity sensor protein, inner membrane, phosphorylation, transferase; NMR {Escherichia coli} SCOP: a.30.2.1 Back     alignment and structure
>3na3_A DNA mismatch repair protein MLH1; MUTL protein homolog 1, DNA damag repair, structural genomics consortium, SGC, protein bindin; HET: DNA ATP; 2.50A {Homo sapiens} Back     alignment and structure
>1b63_A MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A {Escherichia coli K12} SCOP: d.14.1.3 d.122.1.2 PDB: 1nhh_A* 1nhi_A* 1bkn_A 1nhj_A* 1b62_A* Back     alignment and structure
>3ied_A Heat shock protein; HSP90, chaperone, structural genomics, structural genomics consortium, SGC, stress response; HET: AN2; 2.01A {Plasmodium falciparum 3D7} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
d2c2aa2161 Sensor histidine kinase TM0853 {Thermotoga maritima [Ta 99.93
d1gkza2193 Branched-chain alpha-ketoacid dehydrogenase kinase (BCK 99.92
d1r62a_156 Nitrogen regulation protein NtrB, C-terminal domain {Es 99.91
d1id0a_146 Histidine kinase PhoQ domain {Escherichia coli [TaxId: 99.92
d1jm6a2190 Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), 99.92
d1ysra1148 Sensor-type histidine kinase PrrB {Mycobacterium tuberc 99.92
d1bxda_161 Histidine kinase domain of the osmosensor EnvZ {Escheri 99.9
d2hkja3219 Topoisomerase VI-B subunit {Archaeon Sulfolobus shibata 99.52
d1th8a_139 Anti-sigma factor spoIIab {Bacillus stearothermophilus 99.39
d1i58a_189 Histidine kinase CheA {Thermotoga maritima [TaxId: 2336 99.31
d1h7sa2203 DNA mismatch repair protein PMS2 {Human (Homo sapiens) 97.55
d2gqpa1227 HSP90 {Dog (Canis familiaris) [TaxId: 9615]} 96.56
d1uyla_208 HSP90 {Human (Homo sapiens) [TaxId: 9606]} 96.5
d2iwxa1213 HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 96.48
d1ei1a2219 DNA gyrase B {Escherichia coli [TaxId: 562]} 96.27
d1kija2212 DNA gyrase B {Thermus thermophilus [TaxId: 274]} 95.83
d1pvga2239 DNA topoisomerase II {Baker's yeast (Saccharomyces cere 95.82
d1s14a_168 Topoisomerase IV subunit B {Escherichia coli [TaxId: 56 95.53
d1ixma_179 Sporulation response regulatory protein Spo0B {Bacillus 99.68
d1y8oa2125 Pyruvate dehydrogenase kinase {Human (Homo sapiens) [Ta 98.89
d1b63a2218 DNA mismatch repair protein MutL {Escherichia coli [Tax 97.21
d2c2aa189 Sensor histidine kinase TM0853 {Thermotoga maritima [Ta 98.25
d1joya_67 EnvZ histidine kinase {Escherichia coli [TaxId: 562]} 98.23
>d2c2aa2 d.122.1.3 (A:321-481) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
superfamily: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase
family: Histidine kinase
domain: Sensor histidine kinase TM0853
species: Thermotoga maritima [TaxId: 2336]
Probab=99.93  E-value=2.4e-26  Score=184.37  Aligned_cols=133  Identities=11%  Similarity=0.034  Sum_probs=103.9

Q ss_pred             CCCHHHHHHHHHHH-CCCCCCCCCCCC----CCCCCHHHHHHHHHHHHHHHHHHHHHC---CCCCCCCCCCCCEEEEEEE
Q ss_conf             00013444443220-122332110000----001000123444567664687653200---1111123557720479998
Q gi|254780891|r   82 GLGDIEQVIEDFIA-VDKRVQVSWTGE----KIDLSRERAKILLNLFMVAHASLPRGG---KVTISVQDSKNENIFSLKI  153 (215)
Q Consensus        82 ~~~~~~~~~~~~~~-~~~~~~~~~~~~----~~~~~~~~~qvl~NLi~NA~~a~~~gg---~I~i~~~~~~~~~~i~V~D  153 (215)
                      .+.++...+..... +...+.++.+.+    ...++..+.|++.||+.||++|++.++   .|.+.+...++.+.|+|+|
T Consensus        12 li~~~~~~~~~~~~~~~i~~~~~~~~~~~~~v~~D~~~l~qvl~NLi~NAik~t~~~~~~~~i~i~~~~~~~~~~i~V~D   91 (161)
T d2c2aa2          12 LVESAVNAIKEFASSHNVNVLFESNVPCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVED   91 (161)
T ss_dssp             HHHHHHHHHHHHHHHTTCEEEEEESSCSCCEEEECHHHHHHHHHHHHHHHHHTCCTTCTTCEEEEEEEEETTEEEEEEEE
T ss_pred             HHHHHHHHHHHHHHHCCCEEEEEECCCCCEEEEECHHHHHHHHHHHHHHHHHHHHCCCCCCEEEEEEEECCCEEEEEEEE
T ss_conf             99999999999998779789998389998799988999999999999999996360797530467788559999999998


Q ss_pred             CCCCCCCHHHHHHHHCCCCC------CCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEEC
Q ss_conf             78984402458874054545------789987204999999999709879999877992699999419
Q gi|254780891|r  154 NGNLARFPEKFTQIVDGNVE------STIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK  215 (215)
Q Consensus       154 ~G~Gi~~~e~~~~~~~~~~~------~~~~g~GlGl~~~~~i~~~~gG~i~v~~~~~~g~~f~~~l~~  215 (215)
                      +|+||+ ++..+++|+||+.      ++..|+|||||+|+.+++.|||+|+++|.+++|++|+++||+
T Consensus        92 ~G~GI~-~~~~~~iF~~F~~~~~~~~~~~~G~GLGL~i~k~iv~~hgG~i~v~s~~~~Gt~f~i~lP~  158 (161)
T d2c2aa2          92 NGIGIP-DHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIPK  158 (161)
T ss_dssp             CSSCCC-GGGTTGGGSTTCCCC---------CCCTHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEEC
T ss_pred             CCCCCC-HHHHHHHHCCCEECCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCEEEEEEEEEC
T ss_conf             277779-8999886398487678887888934579999999999879989999649990699999985



>d1gkza2 d.122.1.4 (A:186-378) Branched-chain alpha-ketoacid dehydrogenase kinase (BCK) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1r62a_ d.122.1.3 (A:) Nitrogen regulation protein NtrB, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1id0a_ d.122.1.3 (A:) Histidine kinase PhoQ domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jm6a2 d.122.1.4 (A:1177-1366) Pyruvate dehydrogenase kinase {Rat (Rattus norvegicus), isozyme 2 [TaxId: 10116]} Back     information, alignment and structure
>d1ysra1 d.122.1.3 (A:299-446) Sensor-type histidine kinase PrrB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1bxda_ d.122.1.3 (A:) Histidine kinase domain of the osmosensor EnvZ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hkja3 d.122.1.2 (A:10-228) Topoisomerase VI-B subunit {Archaeon Sulfolobus shibatae [TaxId: 2286]} Back     information, alignment and structure
>d1th8a_ d.122.1.3 (A:) Anti-sigma factor spoIIab {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1i58a_ d.122.1.3 (A:) Histidine kinase CheA {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h7sa2 d.122.1.2 (A:29-231) DNA mismatch repair protein PMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gqpa1 d.122.1.1 (A:74-337) HSP90 {Dog (Canis familiaris) [TaxId: 9615]} Back     information, alignment and structure
>d1uyla_ d.122.1.1 (A:) HSP90 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iwxa1 d.122.1.1 (A:2-214) HSP90 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ei1a2 d.122.1.2 (A:2-220) DNA gyrase B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kija2 d.122.1.2 (A:9-220) DNA gyrase B {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1pvga2 d.122.1.2 (A:7-245) DNA topoisomerase II {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1s14a_ d.122.1.2 (A:) Topoisomerase IV subunit B {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ixma_ d.123.1.1 (A:) Sporulation response regulatory protein Spo0B {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1y8oa2 d.122.1.4 (A:177-301) Pyruvate dehydrogenase kinase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2aa1 a.30.2.1 (A:232-320) Sensor histidine kinase TM0853 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1joya_ a.30.2.1 (A:) EnvZ histidine kinase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target215 hypothetical protein CLIBASIA_03940 [Candidatus Liberib
3d36_A_244 Sporulation kinase B; GHKL ATPase, four helix bund 100.0
3a0y_A_152 Sensor protein; ATP-LID, kinase, phosphoprotein, t 99.93
2c2a_A_90-258169 Sensor histidine kinase; phosphotransfer, PHOQ, se 99.92
1r62_A_160 Nitrogen regulation protein NR(II); PII, histidine 99.92
1ysr_A_150 Sensor-type histidine kinase PRRB; ATP-binding dom 99.92
1bxd_A_161 ENVZ(290-450), protein (osmolarity sensor protein 99.92
3a0r_A_206-349144 Sensor protein; four helix bundle, PAS fold, kinas 99.91
1i58_A_189 Chemotaxis protein CHEA; beta-alpha sandwich, sign 99.81
1b3q_A_63-248186 Protein (chemotaxis protein CHEA); histine kinase, 99.81
3ehh_A_89-218130 Sensor kinase (YOCF protein); four-helix bundle, G 99.72
3ehg_A_128 Sensor kinase (YOCF protein); GHL ATPase domain, t 99.48
1gkz_A_196-388193 [3-methyl-2-oxobutanoate dehydrogenase [lipoamide] 99.92
1id0_A_152 PHOQ histidine kinase; PHOQ/PHOP, signal transduct 99.92
2btz_A_171-394224 Pyruvate dehydrogenase kinase isoenzyme 2; GHKL mo 99.92
2e0a_A_171-355185 Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP 99.92
2q8g_A_182-368187 [pyruvate dehydrogenase [lipoamide]] kinase isozym 99.92
1y8o_A_193-379187 [pyruvate dehydrogenase [lipoamide]] kinase isozym 99.91
2zbk_B_1-228228 Type 2 DNA topoisomerase 6 subunit B; DNA binding 99.88
1mu5_A_1-229229 Type II DNA topoisomerase VI subunit B; GHKL ATPas 99.85
1th8_A_145 Anti-sigma F factor; SPOIIAB, SPOIIAA, anti-ANTI-s 99.79
2q2e_B_31-232202 Type 2 DNA topoisomerase 6 subunit B; DNA-binding, 99.71
1h7s_A_1-234234 PMS1 protein homolog 2; DNA repair, GHL ATPase, mi 97.3
3cwv_A_1-206206 DNA gyrase, B subunit, truncated; structural genom 97.2
2cg9_A_26-278 253 ATP-dependent molecular chaperone HSP82; chaperone 97.19
1ei1_A_1-218218 DNA gyrase B, GYRB; ATPase domain, dimer, isomeras 97.08
1y4s_A_1-235235 Chaperone protein HTPG; HSP90, molecular chaperone 96.88
1yc1_A_264 HSP 86, heat shock protein HSP 90-alpha; cell-cycl 96.88
2ior_A_235 Chaperone protein HTPG; heat shock protein, HSP90; 96.75
3ied_A_272 Heat shock protein; HSP90, chaperone, structural g 96.67
2ioq_A_1-235235 Chaperone protein HTPG; heat shock protein, HSP90; 96.65
1b63_A_1-207207 MUTL; DNA mismatch repair, ATPase; HET: ANP; 1.90A 96.63
2wer_A_220 ATP-dependent molecular chaperone HSP82; ATPase, c 96.56
1kij_A_1-217217 DNA gyrase subunit B; topoisomerase, gyrase B-coum 96.55
3g7e_A_203 DNA gyrase subunit B; isomerase; HET: DNA B46; 2.2 96.52
2gqp_A_236 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 96.5
2o1u_A_1-256256 Endoplasmin; GRP94, HSP82, HSP90, HTPG, chaperone, 96.47
1uyl_A_236 HSP 86, heat shock protein HSP 90-alpha; ATPase, c 96.27
1s16_A_1-217217 Topoisomerase IV subunit B; two-domain protein com 96.23
1qy5_A_ 269 Endoplasmin; GRP94, NECA, HSP90, chaperone; HET: N 96.21
3fv5_A_201 DNA topoisomerase 4 subunit B; topoisomerase IV B 96.16
1pvg_A_1-271271 DNA topoisomerase II; GHKL ATPase domain; HET: DNA 96.11
1zxm_A_1-247247 TOPO IIA ATPase, DNA topoisomerase II, alpha isozy 94.96
3g75_A_184 DNA gyrase subunit B; antibiotic resistance, isome 93.54
3a0r_A_130-19465 Sensor protein; four helix bundle, PAS fold, kinas 98.41
2c2a_A_1-8989 Sensor histidine kinase; phosphotransfer, PHOQ, se 98.26
1joy_A_67 Protein (ENVZ_ecoli); histidine kinase, sensory tr 98.17
>3d36_A (A:) Sporulation kinase B; GHKL ATPase, four helix bundle, class I two-component histidine kinase, phosphoprotein; HET: ADP; 2.03A {Geobacillus stearothermophilus} Back     alignment and structure
Probab=100.00  E-value=4.4e-32  Score=223.25  Aligned_cols=205  Identities=13%  Similarity=0.122  Sum_probs=152.1

Q ss_pred             HHHHHHH--HHHHHHHHHHHHHHHHHHHHHHHHHCCCC----HHHHHHHHHHHHHHHHHHH----HHHCCCCCCCCCCCC
Q ss_conf             7687999--99774545422799999999999614430----1478988899999999863----110011223200000
Q gi|254780891|r   11 SMDLVAL--LCSRICHDIISPIGAIHNSLELLDEVGIE----DEVMQLIRLSSMSAIIRLK----FMRLAFGYTGSVDSL   80 (215)
Q Consensus        11 ~~~laal--las~IaHdlrtPL~~I~~~~elL~~~~~~----~~~~~~i~~~~~~~~~l~~----~~r~~~~~~~~~~~~   80 (215)
                      ..+++++  +++.|||||||||++|.+++++|.+....    .+.++.|.+.++++..+++    +.+............
T Consensus         8 ~e~~~~~~~~~~~vsHelrtPL~~i~~~~~~l~~~~~~~~~~~~~l~~i~~~~~rl~~li~~ll~~~r~~~~~~~~~~~~   87 (244)
T 3d36_A            8 AEKMEAVTHLAASISHEIRNPLTAARGFIQLIEEQPLAADKRRQYARIAIEELDRAEAIITDYLTFAKPAPETPEKLNVK   87 (244)
T ss_dssp             ---------CCCCHHHHHHHHHHHHHHHHHHGGGCTTCHHHHHHHHHHHHHHHHHHHHHHHHHHSSCCSSCCCCEEEEHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCEEECHH
T ss_conf             99999999999998999868999999999999779998599999999999999999999999999855487897165399


Q ss_pred             CCCCHHHHHHHHHHHC-CCCCCCCCCCCCC-CCCHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCEEEEEEECCCCC
Q ss_conf             0000134444432201-2233211000000-1000123444567664687653200111112355772047999878984
Q gi|254780891|r   81 IGLGDIEQVIEDFIAV-DKRVQVSWTGEKI-DLSRERAKILLNLFMVAHASLPRGGKVTISVQDSKNENIFSLKINGNLA  158 (215)
Q Consensus        81 ~~~~~~~~~~~~~~~~-~~~~~~~~~~~~~-~~~~~~~qvl~NLi~NA~~a~~~gg~I~i~~~~~~~~~~i~V~D~G~Gi  158 (215)
                      ....++...+...... .....+....+.. ..+..+.+++.|++.||++|.+.++.+.+......+...+.+.|+|.|+
T Consensus        88 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~n~l~na~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  167 (244)
T 3d36_A           88 LEIERVIDILRPLANMSCVDIQATLAPFSVIGEREKFRQCLLNVMKNAIEAMPNGGTLQVYVSIDNGRVLIRIADTGVGM  167 (244)
T ss_dssp             HHHHHHHHHHHHHHTTTTEEEEEECCCCEEEECHHHHHHHHHHHHHHHHHTCTTCEEEEEEEEEETTEEEEEEEECSSCC
T ss_pred             HHHHHHHHHHHHHHHHCCEEEEEECCCCEEEECHHHHHHHHHHHHHHHHHHCCCCCEEEEEEEEECCEEEEEEEECCCCC
T ss_conf             99999999999997526859996179856997699999999999988998676897389999960638999999758898


Q ss_pred             CCHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEEECCCCEEEEEEEEC
Q ss_conf             402458874054545789987204999999999709879999877992699999419
Q gi|254780891|r  159 RFPEKFTQIVDGNVESTIDSHDIQFYYVILLAHENKIRLLPEIIDDHNVVLSALLEK  215 (215)
Q Consensus       159 ~~~e~~~~~~~~~~~~~~~g~GlGl~~~~~i~~~~gG~i~v~~~~~~g~~f~~~l~~  215 (215)
                      ..++....||+++++++..|+|||||+|+.+++.|||+|+++|.+++|++|++.||+
T Consensus       168 ~~~~~~~~~~~~~~~~~~~GtGLGL~ivk~ive~hgG~i~v~s~~g~Gt~f~i~lP~  224 (244)
T 3d36_A          168 TKEQLERLGEPYFTTKGVKGTGLGMMVVYRIIESMNGTIRIESEIHKGTTVSIYLPL  224 (244)
T ss_dssp             CHHHHHHTTSTTCCSSGGGCCSCHHHHHHHHHHHTTCEEEEEEETTTEEEEEEEEEC
T ss_pred             CHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHCCCEEEEEECCCCCEEEEEEEEC
T ss_conf             989999865898658999998748999999999879989999659995699999878



>3a0y_A (A:) Sensor protein; ATP-LID, kinase, phosphoprotein, transferase, two-component regulatory system; 1.57A {Thermotoga maritima} PDB: 3a0t_A* 3a0x_A 3a0w_A 3a0z_A Back     alignment and structure
>2c2a_A (A:90-258) Sensor histidine kinase; phosphotransfer, PHOQ, selenomethionyl MAD, two-component systems, transferase; HET: ADP; 1.9A {Thermotoga maritima} Back     alignment and structure
>1r62_A (A:) Nitrogen regulation protein NR(II); PII, histidine kinase, two component system, transferase; 1.60A {Escherichia coli K12} Back     alignment and structure
>1ysr_A (A:) Sensor-type histidine kinase PRRB; ATP-binding domain, structural genomics, mycobacterium tuberculosis structural proteomics project; 1.78A {Mycobacterium tuberculosis} Back     alignment and structure
>1bxd_A (A:) ENVZ(290-450), protein (osmolarity sensor protein (ENVZ)); histidine kinase, osmosensor, His-Asp phosphorelay system, signal transduction; HET: ANP; NMR {Escherichia coli} Back     alignment and structure
>3a0r_A (A:206-349) Sensor protein; four helix bundle, PAS fold, kinase, phosphoprotein, transferase, two-component regulatory system; 3.80A {Thermotoga maritima} Back     alignment and structure
>1i58_A (A:) Chemotaxis protein CHEA; beta-alpha sandwich, signaling protein, transferase; HET: ACP ADP; 1.60A {Thermotoga maritima} Back     alignment and structure
>1b3q_A (A:63-248) Protein (chemotaxis protein CHEA); histine kinase, signal transduction, multi- domains protein; 2.60A {Thermotoga maritima} Back     alignment and structure
>3ehh_A (A:89-218) Sensor kinase (YOCF protein); four-helix bundle, GHL ATPase domain, transferase; HET: MSE ADP; 2.10A {Bacillus subtilis} PDB: 3ehj_A* 3gie_A* 3gif_A* 3gig_A* 3ehf_A* Back     alignment and structure
>3ehg_A (A:) Sensor kinase (YOCF protein); GHL ATPase domain, transferase; HET: ATP; 1.74A {Bacillus subtilis} Back     alignment and structure
>1gkz_A (A:196-388) [3-methyl-2-oxobutanoate dehydrogenase [lipoamide]] kinase; transferase, mitochondrial protein kinase, potassium; HET: ADP; 2.2A {Rattus norvegicus} Back     alignment and structure
>1id0_A (A:) PHOQ histidine kinase; PHOQ/PHOP, signal transduction, transferase; HET: ANP; 1.60A {Escherichia coli} Back     alignment and structure
>2btz_A (A:171-394) Pyruvate dehydrogenase kinase isoenzyme 2; GHKL motif regulation, transferase; 2.2A {Homo sapiens} PDB: 2bu2_A* 2bu5_A* 2bu6_A* 2bu7_A* 2bu8_A* 3crk_A* 1jm6_A* 3crl_A* Back     alignment and structure
>2e0a_A (A:171-355) Pyruvate dehydrogenase kinase isozyme 4; PDK4, ATP-binding, structural genomics, NPPSFA; HET: ANP; 1.86A {Homo sapiens} PDB: 2zdx_A* 2zdy_A* 2zkj_A* 3d2r_A* Back     alignment and structure
>2q8g_A (A:182-368) [pyruvate dehydrogenase [lipoamide]] kinase isozyme 1; GHKL ATPase/kinase family, pyruvate dehydrogenase complex, mitochondrial kinase; HET: AZX; 1.90A {Homo sapiens} PDB: 2q8f_A* 2q8h_A Back     alignment and structure