254780890

254780890

hypothetical protein CLIBASIA_03935

GeneID in NCBI database:8209910Locus tag:CLIBASIA_03935
Protein GI in NCBI database:254780890Protein Accession:YP_003065303.1
Gene range:-(866427, 866741)Protein Length:104aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100----
MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
ccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHEEEEEEEHHHHHHHHHHHcccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHccc
ccccccHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHEEHHHHHHHHHHHHHcccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccc
mfydsrekeVFLESEVVHNIRLQIEEISAILSkksrdtpnqeiRTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
mfydsrekevflesevvhnirlQIEEISAilskksrdtpnqeirTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEirtkiyiitariialiVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
*******KEVFLESEVVHNIRLQIEEISA**************RTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCK******
MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS
**Y*SREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSI****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFYDSREKEVFLESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKSLIFDLLRTNQKTNSSLTQAIIQEIDTLQHQCKSIERDS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target104 hypothetical protein CLIBASIA_03935 [Candidatus Liberib
315122693100 hypothetical protein CKC_04725 [Candidatus Liberibacter 1 1e-18
>gi|315122693|ref|YP_004063182.1| hypothetical protein CKC_04725 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 100 Back     alignment and organism information
 Score = 96.7 bits (239), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 47/91 (51%), Positives = 71/91 (78%)

Query: 12  LESEVVHNIRLQIEEISAILSKKSRDTPNQEIRTKIYIITARIIALIVFREGEKSLIFDL 71
           LES+V+++IRLQIEEI  IL+++ ++  ++E+ TK+Y++TARIIAL   REG+KS IF  
Sbjct: 10  LESKVIYSIRLQIEEIFKILTQEKKEISDKELYTKMYLVTARIIALTALREGKKSPIFHY 69

Query: 72  LRTNQKTNSSLTQAIIQEIDTLQHQCKSIER 102
           L+ N+K +S LTQ  +QEIDTL++Q   I++
Sbjct: 70  LKKNKKYDSLLTQTTMQEIDTLKYQLTPIKK 100


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

No hit with probability above 90.00


Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00