254780893

254780893

two component response regulator

GeneID in NCBI database:8209913Locus tag:CLIBASIA_03950
Protein GI in NCBI database:254780893Protein Accession:YP_003065306.1
Gene range:-(868549, 869259)Protein Length:236aa
Gene description:two component response regulator
COG prediction:[T] [K] Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain
KEGG prediction:ctrA; two component response regulator; K13584 two-component system, cell cycle response regulator CtrA
SEED prediction:putative two-component response regulator transcriptional regulatory protein
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA
cEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHccccEEEEEcccccccHHHHHHHHHHccccccEEEEEccccHHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHHHccccEEcHHHHHHHHcccccccccHHHHHHHHHHHHHHccccccccEEEEEccccEEEccccccccccccccc
cEEEEEcccHHHHHHHHHHHHHcccEEEEEccHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHccccccEEEEEEccHHHHHHHcccccccEEEEEcccHHHHHHHHHHHHHHcccccccEEEEccEEEccccEEEEEccEEEEccHHHHHHHHHHHHccccEEcHHHHHHHHcccccccccccEEHHHHHHHHHHHcccccccEEEEEEcccEEEccccHHHHHHHHHcc
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILdlgltdipgFEVLRALRVAKISTPVCILSGMSSIEDKVRGLqsgaddyiskpfnKEELVARIRAIVRRSRGHAQSLIVtgdlsvnldaktvevqghrihltGKEYQMIELLSLRKNTTLTKEMFLNhlydgrdepevKIIDVFICKLRKKlsnaaggknyiETVWGRgyvlrenakdETCEYLETA
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSgaddyiskpfnkeELVARIRAIVRrsrghaqslivtgdlsvnlDAKTVEvqghrihltgkeyqMIELLSLRKNTTLTKEMFLnhlydgrdepeVKIIDVFICKLRKklsnaaggknyietvwgrgyvlrenakdetceyleta
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELvariraivrrSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYV****************
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA
MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target236 two component response regulator [Candidatus Liberibact
254780526223 putative transcription regulator protein [Candidat 2e-14
254780476123 two component response regulator [Candidatus Liber 1e-05
254780450803 two-component sensor histidine kinase/response reg 2e-04
254780892133 probable two-component response regulator protein 0.047
>gi|254780526|ref|YP_003064939.1| putative transcription regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 223 Back     alignment
 Score = 70.9 bits (172), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 56/196 (28%), Positives = 90/196 (45%), Gaps = 21/196 (10%)

Query: 28  YVTDLGEDGIELCKF--YEFDAIILDLGLTDIPGFEVL------RALRVAKI-----STP 74
           Y+   G+DG+ L  F   EF+  +      D+   E        + L + +I       P
Sbjct: 15  YIALFGDDGVSLEGFNSLEFEEWLQSSAREDVSAIEAFLIGKGEKVLELPRIIRAHSQVP 74

Query: 75  VCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRR---SRGHAQSLIVTGD 131
           +  +S   S++  +    SG DD ++KP +  E++AR+ AI RR   S   A+    TG 
Sbjct: 75  LIGISDYPSLQTTLDFFDSGVDDVVNKPIHHREILARVAAIYRRLKVSNNRAE----TGP 130

Query: 132 LSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYDGRDEP-EVKII 190
           + V  D +  EVQG    L  +E +++E L   +   + K    + +Y   DE  E  ++
Sbjct: 131 IRVFSDGRDPEVQGEVFPLPRRERRILEYLMANRGKRVAKTQIFSAIYGLFDEAVEENVV 190

Query: 191 DVFICKLRKKLSNAAG 206
           +  I KLRKKL N  G
Sbjct: 191 ESHISKLRKKLRNKLG 206

>gi|254780476|ref|YP_003064889.1| two component response regulator [Candidatus Liberibacter asiaticus str. psy62] Length = 123 Back     alignment
 Score = 41.2 bits (95), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 24/105 (22%), Positives = 55/105 (52%), Gaps = 2/105 (1%)

Query: 2   RILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFE 61
           +++++ED++        ++++  +    T  G + +EL + ++ D II+D+ L +I G E
Sbjct: 4   KVMIVEDNELNMKLFRDLIETSGYIALQTRNGMEALELARQHKPDVIIMDIQLQEISGLE 63

Query: 62  VLRALRVAK--ISTPVCILSGMSSIEDKVRGLQSGADDYISKPFN 104
           + + ++        PV  ++  +   D+ R  + G + YISKP +
Sbjct: 64  ITKQIKEDSELQEIPVIAVTAFAMKGDEERIRKGGCEAYISKPIS 108

>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 37.7 bits (86), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/119 (24%), Positives = 62/119 (52%), Gaps = 6/119 (5%)

Query: 3   ILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYE--FDAIILDLGLTDIPGF 60
           +LL+ED+ ++    + ML++  + V+    G D +++ +  +   D +I D+ + ++ G 
Sbjct: 684 VLLVEDEDSVRRGSKRMLETRGYTVHEAFSGTDALKVMEKLQGRVDIVISDVVMPEMDGP 743

Query: 61  EVLRALRVAKISTPVCILSGMSSIEDKV-RGLQSGAD-DYISKPFNKEELVARIRAIVR 117
            +LR LR    S     +SG +  ED   + L   A   ++SKPF+ ++L   +  +++
Sbjct: 744 TLLRELRKTYPSLKFIFISGYA--EDAFSKNLPKDAKFSFLSKPFSLKQLATSVHELLQ 800

>gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62] Length = 133 Back     alignment
 Score = 29.6 bits (65), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 14/45 (31%), Positives = 27/45 (60%), Gaps = 2/45 (4%)

Query: 84  IEDKVRGLQSGADDYISKPFNKEELVARIRAI--VRRSRGHAQSL 126
            E  + G ++GA+ ++ KPFN+E L   +R +  +++S+   Q L
Sbjct: 86  FEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target236 two component response regulator [Candidatus Liberibact
315122690236 two component response regulator [Candidatus Liberibact 1 1e-116
222149588233 two component response regulator [Agrobacterium vitis S 1 1e-100
15889704234 two component response regulator [Agrobacterium tumefac 1 1e-100
325293784234 cell cycle transcriptional regulator ctrA [Agrobacteriu 1 1e-100
15966471233 response regulator,controls chromosomal replication ini 1 1e-99
150397803233 two component transcriptional regulator [Sinorhizobium 1 1e-99
116253499233 two-component response regulator transcriptional regula 1 1e-99
86358932233 two-component response regulator protein controls chrom 1 2e-99
227823287233 two component response regulator [Sinorhizobium fredii 1 3e-99
220923532233 winged helix family two component transcriptional regul 1 3e-99
>gi|315122690|ref|YP_004063179.1| two component response regulator [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 236 Back     alignment and organism information
 Score =  420 bits (1079), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 205/236 (86%), Positives = 219/236 (92%)

Query: 1   MRILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGF 60
           MR+LLIEDD ALA+SIELMLKSENFNVYVT+LGEDG++L K Y++D I+LDL L DI GF
Sbjct: 1   MRVLLIEDDSALANSIELMLKSENFNVYVTNLGEDGVDLGKIYDYDIILLDLNLPDISGF 60

Query: 61  EVLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSR 120
           EVLR LR+A+ISTPVCILSGMSSIEDKVRGL  GADDYISKP NK+ELVARI AIVRRSR
Sbjct: 61  EVLRTLRMARISTPVCILSGMSSIEDKVRGLGYGADDYISKPLNKDELVARIHAIVRRSR 120

Query: 121 GHAQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYD 180
           GHAQS+I TGDL VNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYD
Sbjct: 121 GHAQSVIATGDLVVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHLYD 180

Query: 181 GRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLRENAKDETCEYLETA 236
           GRDEPEVKIIDVFICKLRKKLSNAA GKNYIETVWGRGYVLRE+ K+ TCEYLETA
Sbjct: 181 GRDEPEVKIIDVFICKLRKKLSNAADGKNYIETVWGRGYVLRESDKNATCEYLETA 236


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149588|ref|YP_002550545.1| two component response regulator [Agrobacterium vitis S4] Length = 233 Back     alignment and organism information
>gi|15889704|ref|NP_355385.1| two component response regulator [Agrobacterium tumefaciens str. C58] Length = 234 Back     alignment and organism information
>gi|325293784|ref|YP_004279648.1| cell cycle transcriptional regulator ctrA [Agrobacterium sp. H13-3] Length = 234 Back     alignment and organism information
>gi|15966471|ref|NP_386824.1| response regulator,controls chromosomal replication initiation protein [Sinorhizobium meliloti 1021] Length = 233 Back     alignment and organism information
>gi|150397803|ref|YP_001328270.1| two component transcriptional regulator [Sinorhizobium medicae WSM419] Length = 233 Back     alignment and organism information
>gi|116253499|ref|YP_769337.1| two-component response regulator transcriptional regulatory protein [Rhizobium leguminosarum bv. viciae 3841] Length = 233 Back     alignment and organism information
>gi|86358932|ref|YP_470824.1| two-component response regulator protein controls chromosomal replication initiation [Rhizobium etli CFN 42] Length = 233 Back     alignment and organism information
>gi|227823287|ref|YP_002827259.1| two component response regulator [Sinorhizobium fredii NGR234] Length = 233 Back     alignment and organism information
>gi|220923532|ref|YP_002498834.1| winged helix family two component transcriptional regulator [Methylobacterium nodulans ORS 2060] Length = 233 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target236 two component response regulator [Candidatus Liberibact
PRK10643222 PRK10643, PRK10643, DNA-binding transcriptional regulat 3e-42
TIGR01387218 TIGR01387, cztR_silR_copR, heavy metal response regulat 2e-35
PRK11083228 PRK11083, PRK11083, DNA-binding response regulator CreB 1e-34
PRK09836227 PRK09836, PRK09836, DNA-binding transcriptional activat 2e-33
PRK15479221 PRK15479, PRK15479, transcriptional regulatory protein 2e-33
TIGR02154226 TIGR02154, PhoB, phosphate regulon transcriptional regu 2e-32
PRK10816223 PRK10816, PRK10816, DNA-binding transcriptional regulat 1e-31
PRK10336219 PRK10336, PRK10336, DNA-binding transcriptional regulat 7e-31
PRK11517223 PRK11517, PRK11517, transcriptional regulatory protein 8e-31
PRK10955232 PRK10955, PRK10955, DNA-binding transcriptional regulat 3e-29
CHL00148240 CHL00148, orf27, Ycf27; Reviewed 4e-28
PRK09468239 PRK09468, ompR, osmolarity response regulator; Provisio 4e-28
PRK10529225 PRK10529, PRK10529, DNA-binding transcriptional activat 2e-25
PRK10710240 PRK10710, PRK10710, DNA-binding transcriptional regulat 1e-21
PRK10161229 PRK10161, PRK10161, transcriptional regulator PhoB; Pro 1e-21
PRK13856241 PRK13856, PRK13856, two-component response regulator Vi 3e-18
PRK10766221 PRK10766, PRK10766, DNA-binding transcriptional regulat 5e-18
TIGR03787227 TIGR03787, marine_sort_RR, proteobacterial dedicated so 2e-17
PRK10701240 PRK10701, PRK10701, DNA-binding transcriptional regulat 4e-14
PRK11173237 PRK11173, PRK11173, two-component response regulator; P 2e-11
COG3947 361 COG3947, COG3947, Response regulator containing CheY-li 2e-08
COG0745229 COG0745, OmpR, Response regulators consisting of a CheY 1e-53
cd00156113 cd00156, REC, Signal receiver domain; originally though 6e-23
pfam00072111 pfam00072, Response_reg, Response regulator receiver do 3e-22
PRK09581 457 PRK09581, pleD, response regulator PleD; Reviewed 6e-17
COG0784130 COG0784, CheY, FOG: CheY-like receiver [Signal transduc 3e-16
COG3706435 COG3706, PleD, Response regulator containing a CheY-lik 7e-16
PRK11361 457 PRK11361, PRK11361, acetoacetate metabolism regulatory 2e-12
COG4566202 COG4566, TtrR, Response regulator [Signal transduction 6e-12
COG4567182 COG4567, COG4567, Response regulator consisting of a Ch 2e-11
PRK09390202 PRK09390, fixJ, response regulator FixJ; Provisional 2e-11
PRK09581457 PRK09581, pleD, response regulator PleD; Reviewed 1e-10
PRK10651216 PRK10651, PRK10651, transcriptional regulator NarL; Pro 7e-10
COG4565224 COG4565, CitB, Response regulator of citrate/malate met 1e-09
PRK15115 444 PRK15115, PRK15115, response regulator GlrR; Provisiona 1e-09
COG4753 475 COG4753, COG4753, Response regulator containing CheY-li 3e-09
TIGR01818 463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 4e-09
KOG0519786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 2e-08
COG3706 435 COG3706, PleD, Response regulator containing a CheY-lik 3e-07
TIGR02875262 TIGR02875, spore_0_A, sporulation transcription factor 1e-06
PRK11091779 PRK11091, PRK11091, aerobic respiration control sensor 2e-06
TIGR02956968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 3e-06
PRK10610129 PRK10610, PRK10610, chemotaxis regulatory protein CheY; 4e-06
PRK15347921 PRK15347, PRK15347, two component system sensor kinase 5e-05
PRK10693303 PRK10693, PRK10693, response regulator of RpoS; Provisi 5e-05
COG3707194 COG3707, AmiR, Response regulator with putative antiter 6e-05
PRK099591197 PRK09959, PRK09959, hybrid sensory histidine kinase in 1e-04
PRK10403215 PRK10403, PRK10403, transcriptional regulator NarP; Pro 1e-04
PRK09935210 PRK09935, PRK09935, transcriptional regulator FimZ; Pro 2e-04
PRK00742 354 PRK00742, PRK00742, chemotaxis-specific methylesterase; 0.002
cd0038395 cd00383, trans_reg_C, Effector domain of response regul 6e-20
pfam0048677 pfam00486, Trans_reg_C, Transcriptional regulatory prot 7e-18
smart0086278 smart00862, Trans_reg_C, Transcriptional regulatory pro 4e-16
COG3710148 COG3710, CadC, DNA-binding winged-HTH domains [Transcri 1e-05
COG2204 464 COG2204, AtoC, Response regulator containing CheY-like 8e-19
COG3437 360 COG3437, COG3437, Response regulator containing a CheY- 6e-16
COG2197211 COG2197, CitB, Response regulator containing a CheY-lik 2e-14
PRK10365 441 PRK10365, PRK10365, transcriptional regulatory protein 4e-11
COG3279244 COG3279, LytT, Response regulator of the LytR/AlgR fami 6e-07
PRK15369211 PRK15369, PRK15369, two component system sensor kinase 7e-05
PRK14084246 PRK14084, PRK14084, two-component response regulator; P 5e-04
smart0044855 smart00448, REC, cheY-homologous receiver domain 2e-08
PRK10923 469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 1e-05
>gnl|CDD|182612 PRK10643, PRK10643, DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>gnl|CDD|130454 TIGR01387, cztR_silR_copR, heavy metal response regulator Back     alignment and domain information
>gnl|CDD|182950 PRK11083, PRK11083, DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>gnl|CDD|182102 PRK09836, PRK09836, DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>gnl|CDD|185376 PRK15479, PRK15479, transcriptional regulatory protein TctD; Provisional Back     alignment and domain information
>gnl|CDD|131209 TIGR02154, PhoB, phosphate regulon transcriptional regulatory protein PhoB Back     alignment and domain information
>gnl|CDD|182755 PRK10816, PRK10816, DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>gnl|CDD|182387 PRK10336, PRK10336, DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>gnl|CDD|183172 PRK11517, PRK11517, transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>gnl|CDD|182864 PRK10955, PRK10955, DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>gnl|CDD|164540 CHL00148, orf27, Ycf27; Reviewed Back     alignment and domain information
>gnl|CDD|181883 PRK09468, ompR, osmolarity response regulator; Provisional Back     alignment and domain information
>gnl|CDD|182522 PRK10529, PRK10529, DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>gnl|CDD|182665 PRK10710, PRK10710, DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>gnl|CDD|182277 PRK10161, PRK10161, transcriptional regulator PhoB; Provisional Back     alignment and domain information
>gnl|CDD|172377 PRK13856, PRK13856, two-component response regulator VirG; Provisional Back     alignment and domain information
>gnl|CDD|182711 PRK10766, PRK10766, DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>gnl|CDD|163499 TIGR03787, marine_sort_RR, proteobacterial dedicated sortase system response regulator Back     alignment and domain information
>gnl|CDD|182660 PRK10701, PRK10701, DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>gnl|CDD|183013 PRK11173, PRK11173, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|33728 COG3947, COG3947, Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|31088 COG0745, OmpR, Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|29071 cd00156, REC, Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>gnl|CDD|143854 pfam00072, Response_reg, Response regulator receiver domain Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|31127 COG0784, CheY, FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|34204 COG4566, TtrR, Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|34205 COG4567, COG4567, Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|181815 PRK09390, fixJ, response regulator FixJ; Provisional Back     alignment and domain information
>gnl|CDD|181966 PRK09581, pleD, response regulator PleD; Reviewed Back     alignment and domain information
>gnl|CDD|182619 PRK10651, PRK10651, transcriptional regulator NarL; Provisional Back     alignment and domain information
>gnl|CDD|34203 COG4565, CitB, Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|34367 COG4753, COG4753, Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33501 COG3706, PleD, Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|131922 TIGR02875, spore_0_A, sporulation transcription factor Spo0A Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|170568 PRK10610, PRK10610, chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|182652 PRK10693, PRK10693, response regulator of RpoS; Provisional Back     alignment and domain information
>gnl|CDD|33502 COG3707, AmiR, Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|182431 PRK10403, PRK10403, transcriptional regulator NarP; Provisional Back     alignment and domain information
>gnl|CDD|182154 PRK09935, PRK09935, transcriptional regulator FimZ; Provisional Back     alignment and domain information
>gnl|CDD|179106 PRK00742, PRK00742, chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>gnl|CDD|29475 cd00383, trans_reg_C, Effector domain of response regulator Back     alignment and domain information
>gnl|CDD|144178 pfam00486, Trans_reg_C, Transcriptional regulatory protein, C terminal Back     alignment and domain information
>gnl|CDD|129095 smart00862, Trans_reg_C, Transcriptional regulatory protein, C terminal Back     alignment and domain information
>gnl|CDD|33505 COG3710, CadC, DNA-binding winged-HTH domains [Transcription] Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33243 COG3437, COG3437, Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|33090 COG3279, LytT, Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185267 PRK15369, PRK15369, two component system sensor kinase SsrB; Provisional Back     alignment and domain information
>gnl|CDD|184495 PRK14084, PRK14084, two-component response regulator; Provisional Back     alignment and domain information
>gnl|CDD|128724 smart00448, REC, cheY-homologous receiver domain Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 236 two component response regulator [Candidatus Liberibact
TIGR02154226 PhoB phosphate regulon transcriptional regulatory prote 100.0
PRK09468239 ompR osmolarity response regulator; Provisional 100.0
PRK10701240 DNA-binding transcriptional regulator RstA; Provisional 100.0
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 100.0
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 100.0
PRK11083229 DNA-binding response regulator CreB; Provisional 100.0
CHL00148240 orf27 Ycf27; Reviewed 100.0
PRK11517223 transcriptional regulatory protein YedW; Provisional 100.0
PRK10529225 DNA-binding transcriptional activator KdpE; Provisional 100.0
PRK10161229 transcriptional regulator PhoB; Provisional 100.0
PRK10955232 DNA-binding transcriptional regulator CpxR; Provisional 100.0
TIGR01387219 cztR_silR_copR heavy metal response regulator; InterPro 100.0
PRK10816223 DNA-binding transcriptional regulator PhoP; Provisional 100.0
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 100.0
COG0745229 OmpR Response regulators consisting of a CheY-like rece 100.0
PRK11173237 two-component response regulator; Provisional 100.0
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 100.0
PRK13856241 two-component response regulator VirG; Provisional 100.0
PRK10766224 DNA-binding transcriptional regulator TorR; Provisional 100.0
PRK09390202 fixJ response regulator FixJ; Provisional 100.0
PRK10651216 transcriptional regulator NarL; Provisional 99.97
PRK10403215 transcriptional regulator NarP; Provisional 99.97
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.97
COG3947 361 Response regulator containing CheY-like receiver and SA 99.96
PRK09483216 response regulator; Provisional 99.96
PRK09935210 transcriptional regulator FimZ; Provisional 99.96
COG2197211 CitB Response regulator containing a CheY-like receiver 99.95
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 99.95
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.95
PRK10840216 transcriptional regulator RcsB; Provisional 99.94
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.92
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.87
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.78
COG4567182 Response regulator consisting of a CheY-like receiver d 99.72
PRK10693337 response regulator of RpoS; Provisional 99.96
PRK09581 457 pleD response regulator PleD; Reviewed 99.96
PRK10923 469 glnG nitrogen regulation protein NR(I); Provisional 99.95
PRK10365 441 transcriptional regulatory protein ZraR; Provisional 99.95
PRK11361 457 acetoacetate metabolism regulatory protein AtoC; Provis 99.95
pfam00072111 Response_reg Response regulator receiver domain. This d 99.95
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.95
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 99.94
PRK10841947 hybrid sensory kinase in two-component regulatory syste 99.93
cd00156113 REC Signal receiver domain; originally thought to be un 99.93
PRK13435141 response regulator; Provisional 99.93
PRK099591197 hybrid sensory histidine kinase in two-component regula 99.92
TIGR02875270 spore_0_A sporulation transcription factor Spo0A; Inter 99.91
TIGR01818 471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 99.91
PRK13557538 histidine kinase; Provisional 99.91
COG2204 464 AtoC Response regulator containing CheY-like receiver, 99.91
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.9
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 99.9
PRK00742345 chemotaxis-specific methylesterase; Provisional 99.89
COG4753 475 Response regulator containing CheY-like receiver domain 99.88
COG3437 360 Response regulator containing a CheY-like receiver doma 99.87
COG3706435 PleD Response regulator containing a CheY-like receiver 99.86
PRK12555340 chemotaxis-specific methylesterase; Provisional 99.86
PRK11697239 putative two-component response-regulatory protein YehT 99.77
KOG0519786 consensus 99.76
PRK13837831 two-component VirA-like sensor kinase; Provisional 99.74
TIGR02915 451 PEP_resp_reg putative PEP-CTERM system response regulat 99.72
TIGR029561052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 99.71
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.71
PRK09191261 two-component response regulator; Provisional 99.68
COG2201 350 CheB Chemotaxis response regulator containing a CheY-li 99.6
PRK13558 674 bacterio-opsin activator; Provisional 99.44
COG3279244 LytT Response regulator of the LytR/AlgR family [Transc 99.34
COG3707194 AmiR Response regulator with putative antiterminator ou 99.3
PRK09581457 pleD response regulator PleD; Reviewed 99.13
COG3706 435 PleD Response regulator containing a CheY-like receiver 98.9
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 98.32
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.02
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 97.12
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 96.12
cd02067119 B12-binding B12 binding domain (B12-BD). This domain bi 95.09
CHL00162267 thiG thiamin biosynthesis protein G; Validated 94.19
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 93.85
pfam05690246 ThiG Thiazole biosynthesis protein ThiG. This family co 93.45
COG4999140 Uncharacterized domain of BarA-like signal transduction 93.3
PRK10669558 putative cation:proton antiport protein; Provisional 92.74
PRK11840327 bifunctional sulfur carrier protein/thiazole synthase p 92.74
PRK00208256 thiG thiazole synthase; Reviewed 92.61
cd02070201 corrinoid_protein_B12-BD B12 binding domain of corrinoi 92.55
cd04728248 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme 92.1
cd02069213 methionine_synthase_B12_BD B12 binding domain of methio 91.8
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 91.79
TIGR03471 472 HpnJ hopanoid biosynthesis associated radical SAM prote 90.71
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.96
COG4565224 CitB Response regulator of citrate/malate metabolism [T 99.87
cd0038395 trans_reg_C Effector domain of response regulator. Bact 99.91
pfam0048677 Trans_reg_C Transcriptional regulatory protein, C termi 99.81
COG3710148 CadC DNA-binding winged-HTH domains [Transcription] 99.73
smart0086278 Trans_reg_C Transcriptional regulatory protein, C termi 99.72
PRK12370 553 invasion protein regulator; Provisional 99.7
PRK10153 512 DNA-binding transcriptional activator CadC; Provisional 99.58
PRK11906 458 transcriptional regulator; Provisional 99.24
PRK07239381 bifunctional uroporphyrinogen-III synthetase/response r 98.73
COG3629 280 DnrI DNA-binding transcriptional activator of the SARP 97.85
PRK04841903 transcriptional regulator MalT; Provisional 97.11
pfam0019658 GerE Bacterial regulatory proteins, luxR family. 96.92
cd0617057 LuxR_C_like C-terminal DNA-binding domain of LuxR-like 96.88
smart0042158 HTH_LUXR helix_turn_helix, Lux Regulon. lux regulon (ac 96.62
TIGR03020247 EpsA transcriptional regulator EpsA. Proteins in this f 96.6
TIGR03541232 reg_near_HchA LuxR family transcriptional regulatory, c 96.55
PRK10188240 DNA-binding transcriptional activator SdiA; Provisional 95.94
COG2909894 MalT ATP-dependent transcriptional regulator [Transcrip 95.89
PRK13870234 transcriptional regulator TraR; Provisional 95.28
COG277165 CsgD DNA-binding HTH domain-containing proteins [Transc 93.49
PRK10857164 DNA-binding transcriptional regulator IscR; Provisional 92.26
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 98.98
PRK13566724 anthranilate synthase; Provisional 96.33
PRK09863585 putative frv operon regulatory protein; Provisional 96.24
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 95.06
PRK07765221 para-aminobenzoate synthase component II; Provisional 94.75
PRK09522 531 bifunctional anthranilate synthase/anthranilate phospho 94.6
PRK05637208 anthranilate synthase component II; Provisional 94.13
PRK07649195 para-aminobenzoate/anthranilate synthase glutamine amid 91.72
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope bi 91.61
PRK00758184 GMP synthase subunit A; Validated 91.39
PRK08007187 para-aminobenzoate synthase component II; Provisional 90.92
PRK09954362 hypothetical protein; Provisional 97.01
pfam0827955 HTH_11 HTH domain. This family includes helix-turn-heli 96.47
COG1959150 Predicted transcriptional regulator [Transcription] 94.52
COG165479 BirA Biotin operon repressor [Transcription] 94.47
TIGR00738133 rrf2_super rrf2 family protein (putative transcriptiona 94.41
PRK11920153 rirA iron-responsive transcriptional regulator; Reviewe 93.75
pfam0208282 Rrf2 Transcriptional regulator. This family is related 92.87
PRK11014141 transcriptional repressor NsrR; Provisional 91.72
PRK11886319 biotin--protein ligase; Provisional 96.58
TIGR01884231 cas_HTH CRISPR locus-related DNA-binding protein; Inter 94.27
PRK12423202 LexA repressor; Provisional 93.81
PRK00215204 LexA repressor; Validated 90.69
PRK09271160 flavodoxin; Provisional 92.04
>TIGR02154 PhoB phosphate regulon transcriptional regulatory protein PhoB; InterPro: IPR011879 PhoB is a DNA-binding response regulator protein acting with PhoR in a 2-component system responding to phosphate ion Back     alignment and domain information
>PRK09468 ompR osmolarity response regulator; Provisional Back     alignment and domain information
>PRK10701 DNA-binding transcriptional regulator RstA; Provisional Back     alignment and domain information
>PRK09836 DNA-binding transcriptional activator CusR; Provisional Back     alignment and domain information
>PRK10336 DNA-binding transcriptional regulator QseB; Provisional Back     alignment and domain information
>PRK11083 DNA-binding response regulator CreB; Provisional Back     alignment and domain information
>CHL00148 orf27 Ycf27; Reviewed Back     alignment and domain information
>PRK11517 transcriptional regulatory protein YedW; Provisional Back     alignment and domain information
>PRK10529 DNA-binding transcriptional activator KdpE; Provisional Back     alignment and domain information
>PRK10161 transcriptional regulator PhoB; Provisional Back     alignment and domain information
>PRK10955 DNA-binding transcriptional regulator CpxR; Provisional Back     alignment and domain information
>TIGR01387 cztR_silR_copR heavy metal response regulator; InterPro: IPR006291 Members of this family contain a response regulator receiver domain and an associated transcriptional regulatory region Back     alignment and domain information
>PRK10816 DNA-binding transcriptional regulator PhoP; Provisional Back     alignment and domain information
>PRK10643 DNA-binding transcriptional regulator BasR; Provisional Back     alignment and domain information
>COG0745 OmpR Response regulators consisting of a CheY-like receiver domain and a winged-helix DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK11173 two-component response regulator; Provisional Back     alignment and domain information
>PRK10710 DNA-binding transcriptional regulator BaeR; Provisional Back     alignment and domain information
>PRK13856 two-component response regulator VirG; Provisional Back     alignment and domain information
>PRK10766 DNA-binding transcriptional regulator TorR; Provisional Back     alignment and domain information
>PRK09390 fixJ response regulator FixJ; Provisional Back     alignment and domain information
>PRK10651 transcriptional regulator NarL; Provisional Back     alignment and domain information
>PRK10403 transcriptional regulator NarP; Provisional Back     alignment and domain information
>PRK09958 DNA-binding transcriptional activator EvgA; Provisional Back     alignment and domain information
>COG3947 Response regulator containing CheY-like receiver and SARP domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK09483 response regulator; Provisional Back     alignment and domain information
>PRK09935 transcriptional regulator FimZ; Provisional Back     alignment and domain information
>COG2197 CitB Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10430 DNA-binding transcriptional activator DcuR; Provisional Back     alignment and domain information
>PRK10360 DNA-binding transcriptional activator UhpA; Provisional Back     alignment and domain information
>PRK10840 transcriptional regulator RcsB; Provisional Back     alignment and domain information
>COG4566 TtrR Response regulator [Signal transduction mechanisms] Back     alignment and domain information
>PRK10100 DNA-binding transcriptional regulator CsgD; Provisional Back     alignment and domain information
>PRK11475 DNA-binding transcriptional activator BglJ; Provisional Back     alignment and domain information
>COG4567 Response regulator consisting of a CheY-like receiver domain and a Fis-type HTH domain [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>PRK10693 response regulator of RpoS; Provisional Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>pfam00072 Response_reg Response regulator receiver domain Back     alignment and domain information
>PRK10610 chemotaxis regulatory protein CheY; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>cd00156 REC Signal receiver domain; originally thought to be unique to bacteria (CheY, OmpR, NtrC, and PhoB), now recently identified in eukaroytes ETR1 Arabidopsis thaliana; this domain receives the signal from the sensor partner in a two-component systems; contains a phosphoacceptor site that is phosphorylated by histidine kinase homologs; usually found N-terminal to a DNA binding effector domain; forms homodimers Back     alignment and domain information
>PRK13435 response regulator; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>TIGR02875 spore_0_A sporulation transcription factor Spo0A; InterPro: IPR012052 Members of this group are response regulators/transcription factors that contain CheY-like receiver (phosphoacceptor) domain and a unique DNA-binding domain Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK00742 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>COG4753 Response regulator containing CheY-like receiver domain and AraC-type DNA-binding domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3437 Response regulator containing a CheY-like receiver domain and an HD-GYP domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK12555 chemotaxis-specific methylesterase; Provisional Back     alignment and domain information
>PRK11697 putative two-component response-regulatory protein YehT; Provisional Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT) Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>COG0784 CheY FOG: CheY-like receiver [Signal transduction mechanisms] Back     alignment and domain information
>PRK09191 two-component response regulator; Provisional Back     alignment and domain information
>COG2201 CheB Chemotaxis response regulator containing a CheY-like receiver domain and a methylesterase domain [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>COG3279 LytT Response regulator of the LytR/AlgR family [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3707 AmiR Response regulator with putative antiterminator output domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK09581 pleD response regulator PleD; Reviewed Back     alignment and domain information
>COG3706 PleD Response regulator containing a CheY-like receiver domain and a GGDEF domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>pfam06490 FleQ Flagellar regulatory protein FleQ Back     alignment and domain information
>pfam03709 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain Back     alignment and domain information
>TIGR01815 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 This entry represents a small clade of anthranilate synthases from alpha proteobacteria and Nostoc (a cyanobacterium) Back     alignment and domain information
>cd02067 B12-binding B12 binding domain (B12-BD) Back     alignment and domain information
>CHL00162 thiG thiamin biosynthesis protein G; Validated Back     alignment and domain information
>pfam02310 B12-binding B12 binding domain Back     alignment and domain information
>pfam05690 ThiG Thiazole biosynthesis protein ThiG Back     alignment and domain information
>COG4999 Uncharacterized domain of BarA-like signal transduction histidine kinases [Signal transduction mechanisms] Back     alignment and domain information
>PRK10669 putative cation:proton antiport protein; Provisional Back     alignment and domain information
>PRK11840 bifunctional sulfur carrier protein/thiazole synthase protein; Provisional Back     alignment and domain information
>PRK00208 thiG thiazole synthase; Reviewed Back     alignment and domain information
>cd02070 corrinoid_protein_B12-BD B12 binding domain of corrinoid proteins Back     alignment and domain information
>cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism Back     alignment and domain information
>cd02069 methionine_synthase_B12_BD B12 binding domain of methionine synthase Back     alignment and domain information
>cd02068 radical_SAM_B12_BD B12 binding domain_like associated with radical SAM domain Back     alignment and domain information
>TIGR03471 HpnJ hopanoid biosynthesis associated radical SAM protein HpnJ Back     alignment and domain information
>PRK10046 dpiA two-component response regulator DpiA; Provisional Back     alignment and domain information
>COG4565 CitB Response regulator of citrate/malate metabolism [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>cd00383 trans_reg_C Effector domain of response regulator Back     alignment and domain information
>pfam00486 Trans_reg_C Transcriptional regulatory protein, C terminal Back     alignment and domain information
>COG3710 CadC DNA-binding winged-HTH domains [Transcription] Back     alignment and domain information
>smart00862 Trans_reg_C Transcriptional regulatory protein, C terminal Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK10153 DNA-binding transcriptional activator CadC; Provisional Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>PRK07239 bifunctional uroporphyrinogen-III synthetase/response regulator domain protein; Validated Back     alignment and domain information
>COG3629 DnrI DNA-binding transcriptional activator of the SARP family [Signal transduction mechanisms] Back     alignment and domain information
>PRK04841 transcriptional regulator MalT; Provisional Back     alignment and domain information
>pfam00196 GerE Bacterial regulatory proteins, luxR family Back     alignment and domain information
>cd06170 LuxR_C_like C-terminal DNA-binding domain of LuxR-like proteins Back     alignment and domain information
>smart00421 HTH_LUXR helix_turn_helix, Lux Regulon Back     alignment and domain information
>TIGR03020 EpsA transcriptional regulator EpsA Back     alignment and domain information
>TIGR03541 reg_near_HchA LuxR family transcriptional regulatory, chaperone HchA-associated Back     alignment and domain information
>PRK10188 DNA-binding transcriptional activator SdiA; Provisional Back     alignment and domain information
>COG2909 MalT ATP-dependent transcriptional regulator [Transcription] Back     alignment and domain information
>PRK13870 transcriptional regulator TraR; Provisional Back     alignment and domain information
>COG2771 CsgD DNA-binding HTH domain-containing proteins [Transcription] Back     alignment and domain information
>PRK10857 DNA-binding transcriptional regulator IscR; Provisional Back     alignment and domain information
>smart00448 REC cheY-homologous receiver domain Back     alignment and domain information
>PRK13566 anthranilate synthase; Provisional Back     alignment and domain information
>PRK09863 putative frv operon regulatory protein; Provisional Back     alignment and domain information
>COG0512 PabA Anthranilate/para-aminobenzoate synthases component II [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>PRK07765 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK09522 bifunctional anthranilate synthase/anthranilate phosphoribosyltransferase; Provisional Back     alignment and domain information
>PRK05637 anthranilate synthase component II; Provisional Back     alignment and domain information
>PRK07649 para-aminobenzoate/anthranilate synthase glutamine amidotransferase component II; Validated Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK00758 GMP synthase subunit A; Validated Back     alignment and domain information
>PRK08007 para-aminobenzoate synthase component II; Provisional Back     alignment and domain information
>PRK09954 hypothetical protein; Provisional Back     alignment and domain information
>pfam08279 HTH_11 HTH domain Back     alignment and domain information
>COG1959 Predicted transcriptional regulator [Transcription] Back     alignment and domain information
>COG1654 BirA Biotin operon repressor [Transcription] Back     alignment and domain information
>TIGR00738 rrf2_super rrf2 family protein (putative transcriptional regulator); InterPro: IPR000944 The following uncharacterised bacterial proteins have been shown to be evolutionary related, Desulphovibrio vulgaris protein Rrf2; Escherichia coli hypothetical proteins yfhP and yjeB; Bacillus subtilis hypothetical proteins yhdE, yrzC and ywgB; Mycobacterium tuberculosis hypothetical protein Rv1287; and Synechocystis strain PCC 6803 hypothetical protein slr0846 Back     alignment and domain information
>PRK11920 rirA iron-responsive transcriptional regulator; Reviewed Back     alignment and domain information
>pfam02082 Rrf2 Transcriptional regulator Back     alignment and domain information
>PRK11014 transcriptional repressor NsrR; Provisional Back     alignment and domain information
>PRK11886 biotin--protein ligase; Provisional Back     alignment and domain information
>TIGR01884 cas_HTH CRISPR locus-related DNA-binding protein; InterPro: IPR010163 Most but not all examples of this family are associated with CRISPR loci, a combination of DNA repeats and characteristic proteins encoded near the repeat cluster Back     alignment and domain information
>PRK12423 LexA repressor; Provisional Back     alignment and domain information
>PRK00215 LexA repressor; Validated Back     alignment and domain information
>PRK09271 flavodoxin; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target236 two component response regulator [Candidatus Liberibact
2oqr_A230 The Structure Of The Response Regulator Regx3 From 5e-45
1kgs_A225 Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG 1e-40
1ys6_A233 Crystal Structure Of The Response Regulatory Protei 2e-38
>gi|158429258|pdb|2OQR|A Chain A, The Structure Of The Response Regulator Regx3 From Mycobacterium Tuberculosis Length = 230 Back     alignment and structure
 Score =  185 bits (469), Expect = 5e-45,   Method: Composition-based stats.
 Identities = 67/224 (29%), Positives = 115/224 (51%), Gaps = 5/224 (2%)

Query: 3   ILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFEV 62
           +L++ED+++LA  +  +L+ E F   V   G   +        D ++LDL L  + G +V
Sbjct: 7   VLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTDV 66

Query: 63  LRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRGH 122
            + LR      PV +++   S  DKV GL+ GADDY++KP++  EL+ARIRA++RR    
Sbjct: 67  CKQLRARSSV-PVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGDD 125

Query: 123 AQSLIV----TGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNHL 178
              +      +G + ++++   V V G  I L  KE+ ++E L       LT+   ++ +
Sbjct: 126 DSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDRV 185

Query: 179 YDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVLR 222
           +      + K +DV + +LR K+        ++ TV G GY L 
Sbjct: 186 WGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKLE 229


>gi|17942992|pdb|1KGS|A Chain A, Crystal Structure At 1.50 A Of An OmprPHOB HOMOLOG FROM Thermotoga Maritima Length = 225 Back     alignment and structure
gi|90108539|pdb|1YS6|A Chain A, Crystal Structure Of The Response Regulatory Protein Prra From Mycobacterium Tuberculosis Length = 233 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target236 two component response regulator [Candidatus Liberibact
2oqr_A230 Sensory transduction protein REGX3; response regulator, 6e-44
1kgs_A225 DRRD, DNA binding response regulator D; DNA-binding pro 3e-42
2gwr_A238 DNA-binding response regulator MTRA; two-component regu 2e-40
1p2f_A220 Response regulator; DRRB, OMPR/PHOB, transcription; HET 2e-35
1ys7_A233 Transcriptional regulatory protein PRRA; response regul 7e-35
2hqr_A223 Putative transcriptional regulator; phosporylation-inde 2e-22
1a04_A215 Nitrate/nitrite response regulator protein NARL; signal 6e-21
1yio_A208 Response regulatory protein; transcription regulation, 5e-19
3c3w_A225 Two component transcriptional regulatory protein DEVR; 2e-13
3lte_A132 Response regulator; structural genomics, PSI, protein s 5e-32
3m6m_D143 Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA h 1e-31
3f6p_A120 Transcriptional regulatory protein YYCF; unphosphorelat 3e-31
2zwm_A130 Transcriptional regulatory protein YYCF; two-component 1e-29
1mvo_A136 PHOP response regulator; phosphate regulon, transcripti 9e-29
2ayx_A254 Sensor kinase protein RCSC; two independent structural 3e-28
3nhm_A133 Response regulator; protein structure initiative II(PSI 8e-28
1jbe_A128 Chemotaxis protein CHEY; signaling protein; 1.08A {Esch 1e-27
1mb3_A124 Cell division response regulator DIVK; signal transduct 1e-27
1qkk_A155 DCTD, C4-dicarboxylate transport transcriptional regula 2e-27
3h1g_A129 Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cy 3e-27
3hdg_A137 Uncharacterized protein; two-component sensor activity, 7e-27
3hv2_A153 Response regulator/HD domain protein; PSI-2, NYSGXRC, s 1e-26
1w25_A 459 Stalked-cell differentiation controlling protein; two-c 1e-26
1w25_A459 Stalked-cell differentiation controlling protein; two-c 1e-05
3f6c_A134 Positive transcription regulator EVGA; structural genom 2e-26
1srr_A124 SPO0F, sporulation response regulatory protein; asparta 4e-26
1dc7_A124 NTRC, nitrogen regulation protein; receiver domain, pho 4e-26
2jba_A127 Phosphate regulon transcriptional regulatory protein PH 4e-26
3hdv_A136 Response regulator; PSI-II, structural genomics, protei 4e-26
3kht_A144 Response regulator; PSI-II, structural genomics, protei 9e-26
3cu5_A141 Two component transcriptional regulator, ARAC family; s 9e-26
3b2n_A133 Uncharacterized protein Q99UF4; structural genomics, PS 2e-25
3eq2_A 394 Probable two-component response regulator; adaptor sigm 2e-25
3luf_A259 Two-component system response regulator/ggdef domain pr 2e-25
3luf_A259 Two-component system response regulator/ggdef domain pr 7e-09
2qv0_A143 Protein MRKE; structural genomics, transcription, PSI-2 2e-25
3cfy_A137 Putative LUXO repressor protein; structural genomics, u 3e-25
3dzd_A 368 Transcriptional regulator (NTRC family); sigma43 activa 3e-25
3eul_A152 Possible nitrate/nitrite response transcriptional regul 4e-25
3eqz_A135 Response regulator; structural genomics, unknown functi 4e-25
2pl1_A121 Transcriptional regulatory protein PHOP; CHEY-like fold 7e-25
2a9o_A120 Response regulator; essential protein, YYCF/YYCG homolo 8e-25
3n0r_A286 Response regulator; sigma factor, receiver, two-compone 9e-25
1i3c_A149 Response regulator RCP1; phytochrome, signaling protein 1e-24
1dz3_A130 Stage 0 sporulation protein A; response regulator, doma 1e-24
2zay_A147 Response regulator receiver protein; structural genomic 1e-24
1p6q_A129 CHEY2; chemotaxis, signal transduction, response regula 2e-24
3cnb_A143 DNA-binding response regulator, MERR family; signal rec 2e-24
3kto_A136 Response regulator receiver protein; PSI-II,structural 2e-24
3bre_A 358 Probable two-component response regulator; protein-nucl 2e-24
3eod_A130 Protein HNR; response regulator, phosphoprotein, two-co 2e-24
3hzh_A157 Chemotaxis response regulator (CHEY-3); phosphatase, co 2e-24
3lua_A140 Response regulator receiver protein; two-component sign 3e-24
2qzj_A136 Two-component response regulator; 11017X, PSI-II, struc 4e-24
2qr3_A140 Two-component system response regulator; structural gen 4e-24
3i42_A127 Response regulator receiver domain protein (CHEY- like) 4e-24
1tmy_A120 CHEY protein, TMY; chemotaxis, phosphoryl transfer, sig 6e-24
2b4a_A138 BH3024; 10175646, structural genomics, joint center for 2e-23
1zh2_A121 KDP operon transcriptional regulatory protein KDPE; two 2e-23
3h5i_A140 Response regulator/sensory box protein/ggdef domain pro 2e-23
3grc_A140 Sensor protein, kinase; protein structure initiative II 3e-23
3cg4_A142 Response regulator receiver domain protein (CHEY- like) 3e-23
3cz5_A153 Two-component response regulator, LUXR family; structur 4e-23
2qxy_A142 Response regulator; regulation of transcription, NYSGXR 5e-23
2qsj_A154 DNA-binding response regulator, LUXR family; structural 5e-23
3crn_A132 Response regulator receiver domain protein, CHEY- like; 5e-23
1k66_A149 Phytochrome response regulator RCPB; CHEY homologue, ho 5e-23
1xhf_A123 DYE resistance, aerobic respiration control protein ARC 6e-23
3gl9_A122 Response regulator; beta-sheet, surrounded by alpha hel 6e-23
1zgz_A122 Torcad operon transcriptional regulatory protein TORR; 8e-23
1k68_A140 Phytochrome response regulator RCPA; phosphorylated asp 1e-22
3c3m_A138 Response regulator receiver protein; structural genomic 1e-22
2jk1_A139 HUPR, hydrogenase transcriptional regulatory protein HU 1e-22
2rjn_A154 Response regulator receiver:metal-dependent phosphohydr 1e-22
3heb_A152 Response regulator receiver domain protein (CHEY); NYSG 2e-22
3a10_A116 Response regulator; phosphoacceptor, signaling protein; 2e-22
3cg0_A140 Response regulator receiver modulated diguanylate cycla 2e-22
3c97_A140 Signal transduction histidine kinase; structural genomi 4e-22
1dbw_A126 Transcriptional regulatory protein FIXJ; doubly wound f 8e-22
1dcf_A136 ETR1 protein; beta-alpha five sandwich; 2.50A {Arabidop 1e-21
2pln_A137 HP1043, response regulator; signaling protein; 1.80A {H 2e-21
3kcn_A151 Adenylate cyclase homolog; SGX, PSI 2, structural genom 2e-21
3jte_A143 Response regulator receiver protein; structural genomic 2e-21
2rdm_A132 Response regulator receiver protein; structural genomic 3e-21
2j48_A119 Two-component sensor kinase; pseudo-receiver, circadian 7e-21
3kyj_B145 CHEY6 protein, putative histidine protein kinase; prote 1e-20
3gt7_A154 Sensor protein; structural genomics, signal receiver do 2e-20
2r25_B133 Osmosensing histidine protein kinase SLN1; alpha5-BETA5 3e-20
2gkg_A127 Response regulator homolog; social motility, receiver d 2e-19
2qvg_A143 Two component response regulator; NYSGXRC, PSI-2, struc 2e-19
1ny5_A 387 Transcriptional regulator (NTRC family); AAA+ ATPase, s 2e-19
1a2o_A 349 CHEB methylesterase; bacterial chemotaxis, adaptation, 3e-16
3ilh_A146 Two component response regulator; NYSGXRC, PSI-II, prot 3e-16
3klo_A225 Transcriptional regulator VPST; REC domain, HTH domain, 2e-12
1s8n_A205 Putative antiterminator; structural genomics, transcrip 6e-26
1qo0_D196 AMIR; binding protein, gene regulator, receptor; 2.25A 9e-15
2z9m_A120 Response regulator YYCF; two-component system, YYCG, he 1e-20
2hwv_A121 DNA-binding response regulator VICR; essential response 2e-19
2jzy_A112 Transcriptional regulatory protein PCOR; two-component- 3e-19
1opc_A110 OMPR, OMPRC; transcription regulation, response regulat 2e-18
2hqn_A109 Putative transcriptional regulator; phosporylation-inde 3e-18
2k4j_A115 Putative transcriptional regulator; response regulator, 3e-17
1gxq_A106 PHOB, phosphate regulon transcriptional regulatory prot 6e-17
2pmu_A110 Response regulator PHOP; winged helix-TUN-HELX, transcr 7e-15
2ff4_A 388 Probable regulatory protein EMBR; winged-helix, tetratr 1e-08
3cwo_X237 Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, 1e-13
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D domain swapping; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230 Back     alignment and structure
 Score =  172 bits (437), Expect = 6e-44
 Identities = 68/224 (30%), Positives = 119/224 (53%), Gaps = 5/224 (2%)

Query: 2   RILLIEDDKALAHSIELMLKSENFNVYVTDLGEDGIELCKFYEFDAIILDLGLTDIPGFE 61
            +L++ED+++LA  +  +L+ E F   V   G   +        D ++LDL L  + G +
Sbjct: 6   SVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRAGADIVLLDLMLPGMSGTD 65

Query: 62  VLRALRVAKISTPVCILSGMSSIEDKVRGLQSGADDYISKPFNKEELVARIRAIVRRSRG 121
           V + LR  + S PV +++   S  DKV GL+ GADDY++KP++  EL+ARIRA++RR   
Sbjct: 66  VCKQLRA-RSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGGD 124

Query: 122 H----AQSLIVTGDLSVNLDAKTVEVQGHRIHLTGKEYQMIELLSLRKNTTLTKEMFLNH 177
                +  ++ +G + ++++   V V G  I L  KE+ ++E L       LT+   ++ 
Sbjct: 125 DDSEMSDGVLESGPVRMDVERHVVSVNGDTITLPLKEFDLLEYLMRNSGRVLTRGQLIDR 184

Query: 178 LYDGRDEPEVKIIDVFICKLRKKLSNAAGGKNYIETVWGRGYVL 221
           ++      + K +DV + +LR K+        ++ TV G GY L
Sbjct: 185 VWGADYVGDTKTLDVHVKRLRSKIEADPANPVHLVTVRGLGYKL 228


>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix-turn-helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 Length = 225 Back     alignment and structure
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} Length = 238 Back     alignment and structure
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1 Length = 220 Back     alignment and structure
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A Length = 233 Back     alignment and structure
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, symmetric dimer, signaling protein; NMR {Helicobacter pylori J99} Length = 223 Back     alignment and structure
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A Length = 215 Back     alignment and structure
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A Length = 208 Back     alignment and structure
>3c3w_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 2.20A {Mycobacterium tuberculosis} Length = 225 Back     alignment and structure
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, nysgrc, NEW YORK structural genomix research consortium; 2.00A {Bermanella marisrubri} Length = 132 Back     alignment and structure
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143 Back     alignment and structure
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A Length = 120 Back     alignment and structure
>2zwm_A Transcriptional regulatory protein YYCF; two-component system, response regulator, dimerization domain, phosphorylation site, cytoplasm; 2.04A {Bacillus subtilis} Length = 130 Back     alignment and structure
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1 Length = 136 Back     alignment and structure
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A Length = 254 Back     alignment and structure
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus} Length = 133 Back     alignment and structure
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 1cye_A 2che_A 2chf_A 2pl9_A* 2pmc_A ... Length = 128 Back     alignment and structure
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A Length = 124 Back     alignment and structure
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A Length = 155 Back     alignment and structure
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A Length = 129 Back     alignment and structure
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes} Length = 137 Back     alignment and structure
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5} Length = 153 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* Length = 459 Back     alignment and structure
>3f6c_A Positive transcription regulator EVGA; structural genomics, , PSI-2, protein structure initiative; 1.45A {Escherichia coli k-12} Length = 134 Back     alignment and structure
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E Length = 124 Back     alignment and structure
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A* Length = 124 Back     alignment and structure
>2jba_A Phosphate regulon transcriptional regulatory protein PHOB; transcription factor, sensory transduction, phosphate regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A Length = 127 Back     alignment and structure
>3hdv_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.09A {Pseudomonas putida KT2440} Length = 136 Back     alignment and structure
>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396} Length = 144 Back     alignment and structure
>3cu5_A Two component transcriptional regulator, ARAC family; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg} Length = 141 Back     alignment and structure
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative; 2.04A {Staphylococcus aureus} Length = 133 Back     alignment and structure
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} Length = 394 Back     alignment and structure
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A* Length = 259 Back     alignment and structure