254780894

254780894

hypothetical protein CLIBASIA_03955

GeneID in NCBI database:8209914Locus tag:CLIBASIA_03955
Protein GI in NCBI database:254780894Protein Accession:YP_003065307.1
Gene range:+(869699, 870010)Protein Length:103aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:Flagellar protein fliJ
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100---
MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccc
cccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcHcccHHHHHHHHHHHHHHHHHHHHHHHccc
MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERqvgiydkdhfaypiLAKSARQRIDNLLLSIRDLLLRQESLEShlesesnsdksvs
mrlqeqrtrlkefrlnderrQLQQLRATILEFRRIVADLEKQIAIeerqvgiydkdHFAYPILAKSARQRIDNLLLSIRDLLLRQEsleshlesesnsdksvs
MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSARQridnlllsirdlllrqesleshlesesnsDKSVS
******R**LKEFRLNDERRQLQQLRATILEFRRIVADLEKQ*********IYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQE*****************
MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQESL***************
*****QRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNS*****
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRLQEQRTRLKEFRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxVGIYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS
MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS
MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAYPILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target103 hypothetical protein CLIBASIA_03955 [Candidatus Liberib
315122688101 hypothetical protein CKC_04700 [Candidatus Liberibacter 1 5e-29
222086832120 hypothetical protein Arad_3502 [Agrobacterium radiobact 1 4e-22
209550654116 hypothetical protein Rleg2_3078 [Rhizobium leguminosaru 1 1e-21
241206025116 hypothetical protein Rleg_3335 [Rhizobium leguminosarum 1 2e-21
116253498118 hypothetical protein RL3757 [Rhizobium leguminosarum bv 1 3e-21
255603801120 conserved hypothetical protein [Ricinus communis] Lengt 1 5e-21
14041670118 yypothetical protein [Rhizobium tropici] Length = 118 1 6e-21
86358931117 hypothetical protein RHE_CH03333 [Rhizobium etli CFN 42 1 6e-19
218460850116 hypothetical protein RetlK5_15685 [Rhizobium etli Kim 5 1 6e-19
190893159118 hypothetical protein RHECIAT_CH0003577 [Rhizobium etli 1 7e-19
>gi|315122688|ref|YP_004063177.1| hypothetical protein CKC_04700 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 101 Back     alignment and organism information
 Score =  130 bits (327), Expect = 5e-29,   Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 86/100 (86%)

Query: 1   MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAY 60
           M+L  Q+ RLKEF+LND+RRQLQQLRAT+ EFRRI  DLEKQ+AIEERQVGIYD +HFAY
Sbjct: 1   MKLSAQQVRLKEFQLNDKRRQLQQLRATVSEFRRIAGDLEKQVAIEERQVGIYDTNHFAY 60

Query: 61  PILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDK 100
           PILA+SARQR +NLL+SI++LLL QE LES LE   +++K
Sbjct: 61  PILARSARQRANNLLISIKELLLLQEMLESSLEQVESTEK 100


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222086832|ref|YP_002545366.1| hypothetical protein Arad_3502 [Agrobacterium radiobacter K84] Length = 120 Back     alignment and organism information
>gi|209550654|ref|YP_002282571.1| hypothetical protein Rleg2_3078 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 116 Back     alignment and organism information
>gi|241206025|ref|YP_002977121.1| hypothetical protein Rleg_3335 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 116 Back     alignment and organism information
>gi|116253498|ref|YP_769336.1| hypothetical protein RL3757 [Rhizobium leguminosarum bv. viciae 3841] Length = 118 Back     alignment and organism information
>gi|255603801|ref|XP_002538117.1| conserved hypothetical protein [Ricinus communis] Length = 120 Back     alignment and organism information
>gi|14041670|emb|CAC38771.1| yypothetical protein [Rhizobium tropici] Length = 118 Back     alignment and organism information
>gi|86358931|ref|YP_470823.1| hypothetical protein RHE_CH03333 [Rhizobium etli CFN 42] Length = 117 Back     alignment and organism information
>gi|218460850|ref|ZP_03500941.1| hypothetical protein RetlK5_15685 [Rhizobium etli Kim 5] Length = 116 Back     alignment and organism information
>gi|190893159|ref|YP_001979701.1| hypothetical protein RHECIAT_CH0003577 [Rhizobium etli CIAT 652] Length = 118 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

No hit with e-value below 0.005

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 103 hypothetical protein CLIBASIA_03955 [Candidatus Liberib
TIGR02473141 flagell_FliJ flagellar export protein FliJ; InterPro: I 97.4
pfam02050143 FliJ Flagellar FliJ protein. 90.19
>TIGR02473 flagell_FliJ flagellar export protein FliJ; InterPro: IPR012823 Members of this family are the FliJ protein found, in nearly every case, in the midst of other flagellar biosynthesis genes in bacterial genomes Back     alignment and domain information
>pfam02050 FliJ Flagellar FliJ protein Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00