254780896

254780896

ABC transporter membrane spanning protein (branched chain amino acid)

GeneID in NCBI database:8209916Locus tag:CLIBASIA_03965
Protein GI in NCBI database:254780896Protein Accession:YP_003065309.1
Gene range:+(871008, 872063)Protein Length:351aa
Gene description:ABC transporter membrane spanning protein (branched chain amino acid)
COG prediction:[E] ABC-type branched-chain amino acid transport system, permease component
KEGG prediction:ABC transporter membrane spanning protein (branched chain amino acid); K01998 branched-chain amino acid transport system permease protein
SEED prediction:Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)
Pathway involved in KEGG:ABC transporters [PATH:las02010]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM8 TM-Helix
TOPPRED7 TM-Helix
HMMTOP10 TM-Helix
MEMSAT10 TM-Helix
MEMSAT_SVM9 TM-Helix
PHOBIUS10 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER
ccEEEEEccHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccccHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccHHHHHcc
cccccccccHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcccHHHccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEcccHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEccc
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACgmimglpslkfrGDYLAIATLIMSEIFQNILIkwkpitngkagiyVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFfaasrdrispdmfkfseNIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNsllkfdcsfnmrHTTLMVIALFLVILMRSHsllrlrtpsnfler
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRShsllrlrtpsnfler
MSIFSLRLNKYDKIlcllavvyplllflflGATKSQKYIDSMGIQILIYVMFAWglsivvgslgllslNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVssafigmagaffaasRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER
*******LNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRT*******
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER
**IFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPS*****
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxx
iiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiHHHHHHHHHHHHHHHHHHHooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER
MSIFSLRLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLER

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target351 ABC transporter membrane spanning protein (branched cha
315122686353 ABC transporter membrane spanning protein (branched cha 1 1e-135
222149578463 ABC transporter membrane spanning protein (branched cha 1 2e-64
190893150463 amino acid ABC transporter permease [Rhizobium etli CIA 1 5e-64
86358923463 amino acid ABC transporter, permease protein [Rhizobium 1 2e-62
241206017463 inner-membrane translocator [Rhizobium leguminosarum bv 1 3e-62
6996600462 integral membrane protein [Rhizobium leguminosarum bv. 1 5e-62
116253490463 transmembrane component of ABC transporter [Rhizobium l 1 9e-62
209550647463 inner-membrane translocator [Rhizobium leguminosarum bv 1 2e-61
13473392531 permease of ABC branched-chain amino acid transporter ( 1 3e-61
30911168455 BraE [Rhizobium leguminosarum bv. trifolii] Length = 45 1 4e-61
>gi|315122686|ref|YP_004063175.1| ABC transporter membrane spanning protein (branched chain amino acid) [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 353 Back     alignment and organism information
 Score =  485 bits (1249), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 233/344 (67%), Positives = 285/344 (82%)

Query: 7   RLNKYDKILCLLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLL 66
           R+ KYDK L  LA +YPL+LF      K+QKYIDS+GIQ LIYVM AWGLS++ GS GL 
Sbjct: 7   RMKKYDKFLFCLATIYPLVLFFLFNTNKAQKYIDSIGIQALIYVMLAWGLSVIAGSAGLF 66

Query: 67  SLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGDYLAIAT 126
           SLN V+AYA+GAY+YVILG+ YG S WLL+P+SA++SGACG+++GLPSLKFRGDYLAIAT
Sbjct: 67  SLNYVVAYAVGAYTYVILGNNYGFSPWLLLPMSAILSGACGLVLGLPSLKFRGDYLAIAT 126

Query: 127 LIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYV 186
            I+SEIF NILI+WKP+TNGKAG+Y+ADRL +LG  +R ++RFFR+PSS V Y+IFMYYV
Sbjct: 127 FIISEIFHNILIRWKPLTNGKAGLYIADRLMYLGADLRGILRFFRYPSSIVFYKIFMYYV 186

Query: 187 LLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAG 246
           +L +CFLSA IIL LRRT++ NAWRTI+DNQ+AF S NTTIIF+KLSAF+    F G+AG
Sbjct: 187 VLFLCFLSAWIILRLRRTSMGNAWRTIKDNQRAFSSFNTTIIFSKLSAFSFGCMFAGVAG 246

Query: 247 AFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAILIGVVELCCGMNFYYF 306
              AASR  +SPDMFK SENI +ISIVILGGMTSLS IA    I+I  +EL CG+NFYYF
Sbjct: 247 GLLAASRGYVSPDMFKMSENIALISIVILGGMTSLSHIAWVALIMISGMELLCGVNFYYF 306

Query: 307 NSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPSNFLE 350
           NS LKFDCSFNMRH+ LM+++LF VIL+RS+SL++LR PS FL+
Sbjct: 307 NSFLKFDCSFNMRHSVLMIVSLFFVILLRSYSLIKLRYPSPFLD 350


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222149578|ref|YP_002550535.1| ABC transporter membrane spanning protein (branched chain amino acid) [Agrobacterium vitis S4] Length = 463 Back     alignment and organism information
>gi|190893150|ref|YP_001979692.1| amino acid ABC transporter permease [Rhizobium etli CIAT 652] Length = 463 Back     alignment and organism information
>gi|86358923|ref|YP_470815.1| amino acid ABC transporter, permease protein [Rhizobium etli CFN 42] Length = 463 Back     alignment and organism information
>gi|241206017|ref|YP_002977113.1| inner-membrane translocator [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 463 Back     alignment and organism information
>gi|6996600|emb|CAB75550.1| integral membrane protein [Rhizobium leguminosarum bv. viciae] Length = 462 Back     alignment and organism information
>gi|116253490|ref|YP_769328.1| transmembrane component of ABC transporter [Rhizobium leguminosarum bv. viciae 3841] Length = 463 Back     alignment and organism information
>gi|209550647|ref|YP_002282564.1| inner-membrane translocator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 463 Back     alignment and organism information
>gi|13473392|ref|NP_104959.1| permease of ABC branched-chain amino acid transporter (high-affinity branched-chain amino acid transport) [Mesorhizobium loti MAFF303099] Length = 531 Back     alignment and organism information
>gi|30911168|gb|AAP41936.1| BraE [Rhizobium leguminosarum bv. trifolii] Length = 455 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target351 ABC transporter membrane spanning protein (branched cha
PRK11301419 PRK11301, livM, leucine/isoleucine/valine transporter p 3e-40
COG4177314 COG4177, LivM, ABC-type branched-chain amino acid trans 2e-30
pfam02653267 pfam02653, BPD_transp_2, Branched-chain amino acid tran 1e-12
TIGR03727364 TIGR03727, urea_t_UrtC_arc, urea ABC transporter, perme 5e-06
COG1172316 COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC- 1e-05
cd06582272 cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) 3e-09
cd06574266 cd06574, TM_PBP1_branched-chain-AA_like, Transmembrane 4e-09
TIGR03408313 TIGR03408, urea_trans_UrtC, urea ABC transporter, perme 2e-05
cd06579263 cd06579, TM_PBP1_transp_AraH_like, Transmembrane subuni 3e-05
cd06581268 cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) 2e-37
COG0559297 COG0559, LivH, Branched-chain amino acid ABC-type trans 3e-07
>gnl|CDD|183081 PRK11301, livM, leucine/isoleucine/valine transporter permease subunit; Provisional Back     alignment and domain information
>gnl|CDD|33917 COG4177, LivM, ABC-type branched-chain amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|111540 pfam02653, BPD_transp_2, Branched-chain amino acid transport system / permease component Back     alignment and domain information
>gnl|CDD|163439 TIGR03727, urea_t_UrtC_arc, urea ABC transporter, permease protein UrtC, archaeal type Back     alignment and domain information
>gnl|CDD|31365 COG1172, AraH, Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|119324 cd06582, TM_PBP1_LivH_like, Transmembrane subunit (TM) of Escherichia coli LivH and related proteins Back     alignment and domain information
>gnl|CDD|119320 cd06574, TM_PBP1_branched-chain-AA_like, Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose Back     alignment and domain information
>gnl|CDD|132449 TIGR03408, urea_trans_UrtC, urea ABC transporter, permease protein UrtC Back     alignment and domain information
>gnl|CDD|119321 cd06579, TM_PBP1_transp_AraH_like, Transmembrane subunit (TM) of Escherichia coli AraH and related proteins Back     alignment and domain information
>gnl|CDD|119323 cd06581, TM_PBP1_LivM_like, Transmembrane subunit (TM) of Escherichia coli LivM and related proteins Back     alignment and domain information
>gnl|CDD|30905 COG0559, LivH, Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 351 ABC transporter membrane spanning protein (branched cha
PRK11301416 livM leucine/isoleucine/valine transporter permease sub 100.0
COG4177314 LivM ABC-type branched-chain amino acid transport syste 100.0
TIGR03408313 urea_trans_UrtC urea ABC transporter, permease protein 100.0
cd06581268 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escheri 100.0
TIGR03622283 urea_t_UrtB_arc urea ABC transporter, permease protein 100.0
TIGR03409291 urea_trans_UrtB urea ABC transporter, permease protein 100.0
PRK10740308 branched-chain amino acid transporter permease subunit 100.0
cd06582272 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escheri 100.0
COG0559297 LivH Branched-chain amino acid ABC-type transport syste 100.0
pfam02653267 BPD_transp_2 Branched-chain amino acid transport system 100.0
cd06579263 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of 100.0
PRK11618317 inner membrane ABC transporter permease protein YjfF; P 100.0
PRK11285327 araH L-arabinose transporter permease protein; Provisio 100.0
COG1172316 AraH Ribose/xylose/arabinose/galactoside ABC-type trans 100.0
PRK09512321 rbsC ribose ABC transporter permease protein; Reviewed 100.0
PRK09478336 mglC beta-methylgalactoside transporter inner membrane 100.0
PRK09699325 D-allose transporter subunit; Provisional 100.0
COG4214394 XylH ABC-type xylose transport system, permease compone 99.97
COG1079304 Uncharacterized ABC-type transport system, permease com 99.95
cd06574266 TM_PBP1_branched-chain-AA_like Transmembrane subunit (T 100.0
cd06580234 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) o 99.97
COG4603356 ABC-type uncharacterized transport system, permease com 99.91
COG4158329 Predicted ABC-type sugar transport system, permease com 99.89
COG4120293 ABC-type uncharacterized transport system, permease com 99.88
COG4211336 MglC ABC-type glucose/galactose transport system, perme 99.66
cd06550261 TM_ABC_iron-siderophores_like Transmembrane subunit (TM 97.29
pfam00950258 ABC-3 ABC 3 transport family. 94.13
COG1108274 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease com 94.03
PRK10440330 iron-enterobactin transporter permease; Provisional 96.88
PRK09535366 btuC corrinoid ABC transporter permease; Reviewed 96.44
PRK10577 666 iron-hydroxamate transporter permease subunit; Provisio 95.61
PRK09777318 fecD iron-dicitrate transporter subunit FecD; Reviewed 95.28
PRK03784330 vtamin B12-transporter permease; Provisional 94.89
PRK10441335 iron-enterobactin transporter membrane protein; Provisi 94.79
COG0609334 FepD ABC-type Fe3+-siderophore transport system, permea 91.01
pfam01032312 FecCD FecCD transport family. This is a sub-family of b 95.5
PRK11228323 fecC iron-dicitrate transporter permease subunit; Provi 94.97
>PRK11301 livM leucine/isoleucine/valine transporter permease subunit; Provisional Back     alignment and domain information
>COG4177 LivM ABC-type branched-chain amino acid transport system, permease component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03408 urea_trans_UrtC urea ABC transporter, permease protein UrtC Back     alignment and domain information
>cd06581 TM_PBP1_LivM_like Transmembrane subunit (TM) of Escherichia coli LivM and related proteins Back     alignment and domain information
>TIGR03622 urea_t_UrtB_arc urea ABC transporter, permease protein UrtB Back     alignment and domain information
>TIGR03409 urea_trans_UrtB urea ABC transporter, permease protein UrtB Back     alignment and domain information
>PRK10740 branched-chain amino acid transporter permease subunit LivH; Reviewed Back     alignment and domain information
>cd06582 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escherichia coli LivH and related proteins Back     alignment and domain information
>COG0559 LivH Branched-chain amino acid ABC-type transport system, permease components [Amino acid transport and metabolism] Back     alignment and domain information
>pfam02653 BPD_transp_2 Branched-chain amino acid transport system / permease component Back     alignment and domain information
>cd06579 TM_PBP1_transp_AraH_like Transmembrane subunit (TM) of Escherichia coli AraH and related proteins Back     alignment and domain information
>PRK11618 inner membrane ABC transporter permease protein YjfF; Provisional Back     alignment and domain information
>PRK11285 araH L-arabinose transporter permease protein; Provisional Back     alignment and domain information
>COG1172 AraH Ribose/xylose/arabinose/galactoside ABC-type transport systems, permease components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK09512 rbsC ribose ABC transporter permease protein; Reviewed Back     alignment and domain information
>PRK09478 mglC beta-methylgalactoside transporter inner membrane component; Provisional Back     alignment and domain information
>PRK09699 D-allose transporter subunit; Provisional Back     alignment and domain information
>COG4214 XylH ABC-type xylose transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1079 Uncharacterized ABC-type transport system, permease component [General function prediction only] Back     alignment and domain information
>cd06574 TM_PBP1_branched-chain-AA_like Transmembrane subunit (TM) of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters which are involved in the uptake of branched-chain amino acids (AAs), as well as TMs of transporters involved in the uptake of monosaccharides including ribose, galactose, and arabinose Back     alignment and domain information
>cd06580 TM_PBP1_transp_TpRbsC_like Transmembrane subunit (TM) of Treponema pallidum (Tp) RbsC-1, RbsC-2 and related proteins Back     alignment and domain information
>COG4603 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4158 Predicted ABC-type sugar transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4120 ABC-type uncharacterized transport system, permease component [General function prediction only] Back     alignment and domain information
>COG4211 MglC ABC-type glucose/galactose transport system, permease component [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06550 TM_ABC_iron-siderophores_like Transmembrane subunit (TM), of Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporters involved in the uptake of siderophores, heme, vitamin B12, or the divalent cations Mg2+ and Zn2+ Back     alignment and domain information
>pfam00950 ABC-3 ABC 3 transport family Back     alignment and domain information
>COG1108 ZnuB ABC-type Mn2+/Zn2+ transport systems, permease components [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10440 iron-enterobactin transporter permease; Provisional Back     alignment and domain information
>PRK09535 btuC corrinoid ABC transporter permease; Reviewed Back     alignment and domain information
>PRK10577 iron-hydroxamate transporter permease subunit; Provisional Back     alignment and domain information
>PRK09777 fecD iron-dicitrate transporter subunit FecD; Reviewed Back     alignment and domain information
>PRK03784 vtamin B12-transporter permease; Provisional Back     alignment and domain information
>PRK10441 iron-enterobactin transporter membrane protein; Provisional Back     alignment and domain information
>COG0609 FepD ABC-type Fe3+-siderophore transport system, permease component [Inorganic ion transport and metabolism] Back     alignment and domain information
>pfam01032 FecCD FecCD transport family Back     alignment and domain information
>PRK11228 fecC iron-dicitrate transporter permease subunit; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 ABC transporter membrane spanning protein (branched cha
2nq2_A337 Hypothetical ABC transporter permease protein HI1471; p 95.29
2qi9_A326 Vitamin B12 import system permease protein BTUC; inner 93.25
>2nq2_A Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
Probab=95.29  E-value=0.1  Score=26.69  Aligned_cols=112  Identities=13%  Similarity=0.063  Sum_probs=65.7

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCC-CHHHHHHHHHHHHHCCCCC----H
Q ss_conf             9999996421222334202322367999998799999999999866440113543-1589999889887347422----3
Q gi|254780896|r  207 SNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMF-KFSENIIVISIVILGGMTS----L  281 (351)
Q Consensus       207 G~~lrAv~~n~~aA~~~Ginv~~~~~~af~is~~lAgiaG~l~a~~~~~v~p~~~-~~~~~~~~~~~vvlGG~gs----~  281 (351)
                      .|++....-+||.|+.+|+|++|.|.....+++.+++.+=..    .|   |-.| ++.  ..-++--..| ...    +
T Consensus       215 ~~~l~~l~lG~~~A~sLGv~v~~~r~~~l~l~~llta~~vs~----~G---~I~FvGLi--~Phiar~l~g-~~~~~~l~  284 (337)
T 2nq2_A          215 SWRLNLLSLDEKEAKALGVKMAPLRWLVIFLSGSLVACQVAI----SG---SIGWVGLI--IPHLSRMLVG-ANHQSLLP  284 (337)
T ss_dssp             TTGGGGGGSCHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHH----HC---CCCSSTTH--HHHHHHHHHC-SCHHHHHH
T ss_pred             HCCCCHHCCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHC----CC---CEEEHHHH--HHHHHHHHHC-CCCCHHHH
T ss_conf             300562107938898789979999999999999999999963----77---63038740--9999999818-88533999


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             89999999999999999873122100001234442025899999999999998589
Q gi|254780896|r  282 SKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSH  337 (351)
Q Consensus       282 ~Ga~lGa~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~lilvll~rP~  337 (351)
                      ..++.|+.++...+...+...+.         +........+++...++.+++|.+
T Consensus       285 ~s~l~Ga~lll~aD~i~r~l~p~---------elPvG~vtaliG~p~fl~ll~r~~  331 (337)
T 2nq2_A          285 CTMLVGATYMLLVDNVARSLSDA---------EIPISILTALIGAPLFGVLVYKLK  331 (337)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCSS---------CCCHHHHHHHHHHHHHHHHHHCC-
T ss_pred             HHHHHHHHHHHHHHHHHHHCCCC---------CEEHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999998665677---------731999999999999999999852



>2qi9_A Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 ABC transporter membrane spanning protein (branched cha
d1l7va_324 ABC transporter involved in vitamin B12 uptake, BtuC {E 94.44
>d1l7va_ f.22.1.1 (A:) ABC transporter involved in vitamin B12 uptake, BtuC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: ABC transporter involved in vitamin B12 uptake, BtuC
superfamily: ABC transporter involved in vitamin B12 uptake, BtuC
family: ABC transporter involved in vitamin B12 uptake, BtuC
domain: ABC transporter involved in vitamin B12 uptake, BtuC
species: Escherichia coli [TaxId: 562]
Probab=94.44  E-value=0.1  Score=25.32  Aligned_cols=111  Identities=14%  Similarity=0.039  Sum_probs=62.5

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCC-CHHHHHHHHHHHHHCCCCC---HH
Q ss_conf             9999996421222334202322367999998799999999999866440113543-1589999889887347422---38
Q gi|254780896|r  207 SNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMF-KFSENIIVISIVILGGMTS---LS  282 (351)
Q Consensus       207 G~~lrAv~~n~~aA~~~Ginv~~~~~~af~is~~lAgiaG~l~a~~~~~v~p~~~-~~~~~~~~~~~vvlGG~gs---~~  282 (351)
                      -|++....-+||.|+.+|+|++|+|......++.+++.+=.+    .|.+   .| ++.  ..-++- .+.|...   ++
T Consensus       208 ~~~L~~L~lgd~~A~sLGv~v~~~r~~~l~~~~ll~a~~va~----~G~I---~FvGLi--~PhiaR-~l~g~~~~~~lp  277 (324)
T d1l7va_         208 SRPMNMLALGEISARQLGLPLWFWRNVLVAATGWMVGVSVAL----AGAI---GFIGLV--IPHILR-LCGLTDHRVLLP  277 (324)
T ss_dssp             HHHHHHHHHCHHHHHHTTCCHHHHHHHHHHHHHHHHHHHHHH----HCCC---CSSSSH--HHHHHH-HTTCCSHHHHHH
T ss_pred             HHHHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHH----CCHH---HHHHHH--HHHHHH-HHCCCCCCHHHH
T ss_conf             844665530368887068666777799999999999999972----3644---555875--799999-860777517999


Q ss_pred             -HHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHC
Q ss_conf             -99999999999999998731221000012344420258999999999999985
Q gi|254780896|r  283 -KIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMR  335 (351)
Q Consensus       283 -Ga~lGa~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~lilvll~r  335 (351)
                       -++.|+.++...+...+....+        .+........+++....+.++.|
T Consensus       278 ~s~l~Ga~lll~aD~l~r~i~~p--------~eiPvGvitaliG~P~fi~Ll~r  323 (324)
T d1l7va_         278 GCALAGASALLLADIVARLALAA--------AELPIGVVTATLGAPVFIWLLLK  323 (324)
T ss_dssp             HHHHHHHHHHHHHHHHHHHSCSS--------SCCCHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCC--------CCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             99999999999999999760466--------56329999999999999999983



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target351 ABC transporter membrane spanning protein (branched cha
2nq2_A_94-261168 Hypothetical ABC transporter permease protein HI14 97.46
2qi9_A_326 Vitamin B12 import system permease protein BTUC; i 96.45
>2nq2_A (A:94-261) Hypothetical ABC transporter permease protein HI1471; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
Probab=97.46  E-value=0.0025  Score=37.50  Aligned_cols=57  Identities=14%  Similarity=0.120  Sum_probs=41.9

Q ss_pred             HHHHHHHHHHHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999999999999996130599999996421222334202322367999998799999999
Q gi|254780896|r  185 YVLLGMCFLSASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAG  246 (351)
Q Consensus       185 ~~~~~~~~~~~~l~~~l~rT~~G~~lrAv~~n~~aA~~~Ginv~~~~~~af~is~~lAgiaG  246 (351)
                      +........+....+++.     |++....-+||.|+.+|+|++|.|.....+++.+.+.+=
T Consensus       105 ~~~~~~~~~~~~~~~~~~-----~~l~ll~lg~~~A~slGv~v~~~~~~~l~~~~ll~a~~v  161 (168)
T 2nq2_A          105 LFFFVPFLLCSSILLSLS-----WRLNLLSLDEKEAKALGVKMAPLRWLVIFLSGSLVACQV  161 (168)
T ss_dssp             HHHHHHHHHHHHHHHHTT-----TGGGGGGSCHHHHHHTTCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHHH-----HHCCHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             432433047988888765-----525543179699845678778999999999999999998



>2qi9_A (A:) Vitamin B12 import system permease protein BTUC; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_A* Back     alignment and structure