254780895

254780895

hypothetical protein CLIBASIA_03960

GeneID in NCBI database:8209915Locus tag:CLIBASIA_03960
Protein GI in NCBI database:254780895Protein Accession:YP_003065308.1
Gene range:-(870150, 870425)Protein Length:91aa
Gene description:hypothetical protein
COG prediction:none
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-
MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
ccccccccccEEEcccccEEEEcccccccccEEHHHHHHHHHHHHHHccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccccEEEcccccccccccccccccccEEEEcHHHHHHHHHcccccHHHHHHHHcccHHHHHHHHHHHHHHcHHHHHHHHHHHHcc
MTEKIQSHMKyvigpdgspltianlpppntrrWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
mtekiqshmkyvigpdgspltiANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
MTEKIQSHMKYVIGPDGSPLTIANLPPPNTrrwvarrkaevvaavKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
************IGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQ****
********MKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
****IQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE
MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRTTQIQKYRE

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
254781217162 hypothetical protein CLIBASIA_05620 [Candidatus Li 0.045
>gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] Length = 162 Back     alignment
 Score = 27.3 bits (59), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%)

Query: 32 RWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69
          ++   R   ++A+  GGL SL ++C+ + +TV  F  W
Sbjct: 5  KYTKERIDNILASFSGGL-SLSQSCKKHGVTVVSFHGW 41

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
31512268791 hypothetical protein CKC_04695 [Candidatus Liberibacter 1 2e-44
11625349591 hypothetical protein RL3754 [Rhizobium leguminosarum bv 1 3e-37
86358928108 hypothetical protein RHE_CH03330 [Rhizobium etli CFN 42 1 3e-37
32529378091 hypothetical protein AGROH133_08290 [Agrobacterium sp. 1 1e-36
90419039103 conserved hypothetical protein [Aurantimonas manganoxyd 1 1e-36
1588970091 hypothetical protein Atu2430 [Agrobacterium tumefaciens 1 1e-36
11470663696 hypothetical protein FP2506_12829 [Fulvimarina pelagi H 1 2e-36
1798671091 hypothetical protein BMEI0427 [Brucella melitensis bv. 1 2e-36
21845920891 hypothetical protein RetlK5_06885 [Rhizobium etli Kim 5 1 2e-36
32854276291 hypothetical protein SL003B_1142 [polymorphum gilvum SL 1 2e-36
>gi|315122687|ref|YP_004063176.1| hypothetical protein CKC_04695 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 91 Back     alignment and organism information
 Score =  181 bits (460), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 85/91 (93%), Positives = 90/91 (98%)

Query: 1  MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT 60
          MTEK+QSHMKYVIGPDGSPLT+ANLPPPNTRRWV RRKAEVVAAV+GGLLSLEEACQIYT
Sbjct: 1  MTEKLQSHMKYVIGPDGSPLTMANLPPPNTRRWVVRRKAEVVAAVQGGLLSLEEACQIYT 60

Query: 61 LTVEEFLSWQASIVQHGLAGLRTTQIQKYRE 91
          LTVEEFLSWQASI+QHGLAGLRTT+IQKYRE
Sbjct: 61 LTVEEFLSWQASIIQHGLAGLRTTRIQKYRE 91


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|116253495|ref|YP_769333.1| hypothetical protein RL3754 [Rhizobium leguminosarum bv. viciae 3841] Length = 91 Back     alignment and organism information
>gi|86358928|ref|YP_470820.1| hypothetical protein RHE_CH03330 [Rhizobium etli CFN 42] Length = 108 Back     alignment and organism information
>gi|325293780|ref|YP_004279644.1| hypothetical protein AGROH133_08290 [Agrobacterium sp. H13-3] Length = 91 Back     alignment and organism information
>gi|90419039|ref|ZP_01226950.1| conserved hypothetical protein [Aurantimonas manganoxydans SI85-9A1] Length = 103 Back     alignment and organism information
>gi|15889700|ref|NP_355381.1| hypothetical protein Atu2430 [Agrobacterium tumefaciens str. C58] Length = 91 Back     alignment and organism information
>gi|114706636|ref|ZP_01439537.1| hypothetical protein FP2506_12829 [Fulvimarina pelagi HTCC2506] Length = 96 Back     alignment and organism information
>gi|17986710|ref|NP_539344.1| hypothetical protein BMEI0427 [Brucella melitensis bv. 1 str. 16M] Length = 91 Back     alignment and organism information
>gi|218459208|ref|ZP_03499299.1| hypothetical protein RetlK5_06885 [Rhizobium etli Kim 5] Length = 91 Back     alignment and organism information
>gi|328542762|ref|YP_004302871.1| hypothetical protein SL003B_1142 [polymorphum gilvum SL003B-26A1] Length = 91 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
pfam0662790 pfam06627, DUF1153, Protein of unknown function (DUF115 3e-39
>gnl|CDD|148310 pfam06627, DUF1153, Protein of unknown function (DUF1153) Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
pfam0662790 DUF1153 Protein of unknown function (DUF1153). This fam 100.0
PRK09413121 insertion sequence 2 OrfA protein; Reviewed 90.78
>pfam06627 DUF1153 Protein of unknown function (DUF1153) Back     alignment and domain information
>PRK09413 insertion sequence 2 OrfA protein; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
2oa4_A101 Solution Nmr Structure: Northeast Structural Genomi 3e-33
2jrt_A95 Nmr Solution Structure Of The Protein Coded By Gene 3e-32
>gi|134105089|pdb|2OA4|A Chain A, Solution Nmr Structure: Northeast Structural Genomics Consortium Target Sir5 Length = 101 Back     alignment and structure
 Score =  144 bits (365), Expect = 3e-33,   Method: Composition-based stats.
 Identities = 42/84 (50%), Positives = 56/84 (66%)

Query: 8  HMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFL 67
            + V  PDGS +T A+LPP NTRRWVA RK  VV  V  GL++L EA Q Y L+ EEF 
Sbjct: 9  GPRSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFN 68

Query: 68 SWQASIVQHGLAGLRTTQIQKYRE 91
          SW +++ +HG   L+ T ++KYR+
Sbjct: 69 SWVSALAEHGKDALKVTALKKYRQ 92


>gi|159794898|pdb|2JRT|A Chain A, Nmr Solution Structure Of The Protein Coded By Gene Rhos4_12090 Of Rhodobacter Sphaeroides. Northeast Structural Genomics Target Rhr5 Length = 95 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
2oa4_A101 SIR5; structure, structural genomics, PSI-2, protein st 2e-31
2jrt_A95 Uncharacterized protein; solution, structure, NESG, PSI 4e-31
>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Length = 101 Back     alignment and structure
 Score =  129 bits (326), Expect = 2e-31
 Identities = 42/82 (51%), Positives = 56/82 (68%)

Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69
          + V  PDGS +T A+LPP NTRRWVA RK  VV  V  GL++L EA Q Y L+ EEF SW
Sbjct: 11 RSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSW 70

Query: 70 QASIVQHGLAGLRTTQIQKYRE 91
           +++ +HG   L+ T ++KYR+
Sbjct: 71 VSALAEHGKDALKVTALKKYRQ 92


>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Length = 95 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
2jrt_A95 Uncharacterized protein; solution, structure, NESG, PSI 100.0
2oa4_A101 SIR5; structure, structural genomics, PSI-2, protein st 100.0
>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
Probab=100.00  E-value=0  Score=293.11  Aligned_cols=91  Identities=47%  Similarity=0.709  Sum_probs=86.3

Q ss_pred             CCCCCCCCCCEEECCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHCHHH
Q ss_conf             96420323226777999833532175998850367799999999860886999999770679999999999999839986
Q gi|254780895|r    1 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAG   80 (91)
Q Consensus         1 m~e~~~~~~~~V~gPdGs~lt~aDLPp~~T~RWVasRKA~VV~aV~~GLis~~EA~~rY~LS~EEf~~W~~av~~hG~~g   80 (91)
                      |--..-..|++|+||||++||++||||+||+||||||||+||+||++||||++|||+||+||+|||.+|+++|++||++|
T Consensus         1 Mylkkv~GPr~VtlPDGs~lt~aDLPp~~T~RWVasRKA~VV~aV~~GLis~~EA~~rY~LS~EEf~~W~~av~~hG~~g   80 (95)
T 2jrt_A            1 MYLKRVDGPRQVTLPDGTVLSRADLPPLDTRRWVASRKAAVVKAVIHGLITEREALDRYSLSEEEFALWRSAVAAHGEKA   80 (95)
T ss_dssp             CCSCCCCSCSEEECTTSCEEETTTSCCSSCCCCCHHHHHHHHHHHHTTSSCHHHHHHHTTCCHHHHHHHHHHTTTCCTTS
T ss_pred             CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98555799852567999845413498998752035667899999971777999999996888999999999999975889


Q ss_pred             HHHHHHHHHCC
Q ss_conf             88757776339
Q gi|254780895|r   81 LRTTQIQKYRE   91 (91)
Q Consensus        81 Lr~T~lQ~YRq   91 (91)
                      ||+|+||+|||
T Consensus        81 Lr~T~lQ~yRq   91 (95)
T 2jrt_A           81 LKVTMIQKYRQ   91 (95)
T ss_dssp             CCTTHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             98999999998



>2oa4_A SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} SCOP: a.4.12.3 Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
d2oa4a193 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Sili 1e-31
>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} Length = 93 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: TrpR-like
family: SPO1678-like
domain: Uncharacterized protein SPO1678
species: Silicibacter pomeroyi [TaxId: 89184]
 Score =  128 bits (323), Expect = 1e-31
 Identities = 42/82 (51%), Positives = 56/82 (68%)

Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69
          + V  PDGS +T A+LPP NTRRWVA RK  VV  V  GL++L EA Q Y L+ EEF SW
Sbjct: 11 RSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSW 70

Query: 70 QASIVQHGLAGLRTTQIQKYRE 91
           +++ +HG   L+ T ++KYR+
Sbjct: 71 VSALAEHGKDALKVTALKKYRQ 92


Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
d2oa4a193 Uncharacterized protein SPO1678 {Silicibacter pomeroyi 100.0
>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: TrpR-like
family: SPO1678-like
domain: Uncharacterized protein SPO1678
species: Silicibacter pomeroyi [TaxId: 89184]
Probab=100.00  E-value=1e-41  Score=260.64  Aligned_cols=89  Identities=47%  Similarity=0.718  Sum_probs=85.4

Q ss_pred             CCCCCCCCEEECCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHH
Q ss_conf             42032322677799983353217599885036779999999986088699999977067999999999999983998688
Q gi|254780895|r    3 EKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLR   82 (91)
Q Consensus         3 e~~~~~~~~V~gPdGs~lt~aDLPp~~T~RWVasRKA~VV~aV~~GLis~~EA~~rY~LS~EEf~~W~~av~~hG~~gLr   82 (91)
                      -..-..|+.|+|||||+||++||||++|+||||||||+||++|.+||||++|||++|+||+|||.+|++++++||++|||
T Consensus         4 ~~~~~gpr~vt~pdgs~~t~~dLp~~~trRWva~RKaaVV~av~~Gl~S~~EAcrrY~LS~eEf~~W~~a~~~hGe~aLr   83 (93)
T d2oa4a1           4 LRKVEGPRSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALK   83 (93)
T ss_dssp             SSCCSSSCEEECSSSCEEETTSSCCSCCSCCCHHHHHHHHHHHHHTTCCHHHHHHTTCSSHHHHHHHHHHHHCCCSSSSC
T ss_pred             CCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             24589985145799984411119996664113999999999998385779999988399999999999999998699999


Q ss_pred             HHHHHHHCC
Q ss_conf             757776339
Q gi|254780895|r   83 TTQIQKYRE   91 (91)
Q Consensus        83 ~T~lQ~YRq   91 (91)
                      +|+||+|||
T Consensus        84 ~t~~q~yr~   92 (93)
T d2oa4a1          84 VTALKKYRQ   92 (93)
T ss_dssp             CHHHHHHHH
T ss_pred             HHHHHHHHC
T ss_conf             998999863



Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 91 hypothetical protein CLIBASIA_03960 [Candidatus Li
2oa4_A_101 (A:) SIR5; structure, structural genomics, PSI-2, 7e-34
2jrt_A_95 (A:) Uncharacterized protein; solution, structure, 8e-34
>2oa4_A (A:) SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi}Length = 101 Back     alignment and structure
 Score =  136 bits (345), Expect = 7e-34
 Identities = 42/82 (51%), Positives = 56/82 (68%)

Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69
          + V  PDGS +T A+LPP NTRRWVA RK  VV  V  GL++L EA Q Y L+ EEF SW
Sbjct: 11 RSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSW 70

Query: 70 QASIVQHGLAGLRTTQIQKYRE 91
           +++ +HG   L+ T ++KYR+
Sbjct: 71 VSALAEHGKDALKVTALKKYRQ 92


>2jrt_A (A:) Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides}Length = 95 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target91 hypothetical protein CLIBASIA_03960 [Candidatus Liberib
2jrt_A_95 Uncharacterized protein; solution, structure, NESG 100.0
2oa4_A_101 SIR5; structure, structural genomics, PSI-2, prote 100.0
2elh_A_87 CG11849-PA, LD40883P; structural genomics, NPPSFA, 90.03
>2jrt_A (A:) Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Back     alignment and structure
Probab=100.00  E-value=1.7e-41  Score=261.71  Aligned_cols=91  Identities=47%  Similarity=0.709  Sum_probs=86.4

Q ss_pred             CCCCCCCCCCEEECCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHCHHH
Q ss_conf             96420323226777999833532175998850367799999999860886999999770679999999999999839986
Q gi|254780895|r    1 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAG   80 (91)
Q Consensus         1 m~e~~~~~~~~V~gPdGs~lt~aDLPp~~T~RWVasRKA~VV~aV~~GLis~~EA~~rY~LS~EEf~~W~~av~~hG~~g   80 (91)
                      |-..--..|++|+|||||+||++||||++|+||||||||+||++|.+||||++|||+||+||.|||.+|++++++||++|
T Consensus         1 m~l~k~~gp~~v~~pdg~~~t~adlp~~~trRWvarRKaaVV~aV~~Gl~t~~EA~rrY~Ls~eEf~~W~~a~~~hge~a   80 (95)
T 2jrt_A            1 MYLKRVDGPRQVTLPDGTVLSRADLPPLDTRRWVASRKAAVVKAVIHGLITEREALDRYSLSEEEFALWRSAVAAHGEKA   80 (95)
T ss_dssp             CCSCCCCSCSEEECTTSCEEETTTSCCSSCCCCCHHHHHHHHHHHHTTSSCHHHHHHHTTCCHHHHHHHHHHTTTCCTTS
T ss_pred             CCCCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHH
T ss_conf             98666899850357999853120099955640359999999999982847799999884999999999999999982999


Q ss_pred             HHHHHHHHHCC
Q ss_conf             88757776339
Q gi|254780895|r   81 LRTTQIQKYRE   91 (91)
Q Consensus        81 Lr~T~lQ~YRq   91 (91)
                      ||+|++|+|||
T Consensus        81 LRat~lq~yrq   91 (95)
T 2jrt_A           81 LKVTMIQKYRQ   91 (95)
T ss_dssp             CCTTHHHHHHH
T ss_pred             HHHHHHHHHHH
T ss_conf             98878999999



>2oa4_A (A:) SIR5; structure, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Silicibacter pomeroyi} Back     alignment and structure
>2elh_A (A:) CG11849-PA, LD40883P; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Drosophila melanogaster} Back     alignment and structure