254780897

254780897

trigger factor

GeneID in NCBI database:8209917Locus tag:CLIBASIA_03970
Protein GI in NCBI database:254780897Protein Accession:YP_003065310.1
Gene range:+(872690, 874111)Protein Length:473aa
Gene description:trigger factor
COG prediction:[O] FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor)
KEGG prediction:tig; trigger factor (EC:5.2.1.8); K03545 trigger factor
SEED prediction:Cell division trigger factor (EC 5.2.1.8)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Bacterial Cell Division
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470---
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKLLDKSSKVETFQSEEAPSEIS
cccEEEEccccEEEEEEEEcHHHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEEEEEcccccccccccEEEEEEEEccHHHHHHHHHHHHHHcccccccccHHccccEEEEEEEEEEccEEccccccccEEEEEccccccccHHHHccccccccEEEEEEEcccccccccccccEEEEEEEEEEccccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHccccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcEEEEEcccHHHHcccccccccccccHHHHHHHHHHHHccccccc
ccEEEEEccccEEEEEEEEcHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccEEcccccccccccHccccccEEEEEEEEEEccEEEccccccEEEEEEEEEcHHHHHHHHHHHHHHHHcHHHHHHHHccccEEEEEEEEEEccEEcccccccccEEEEcccccccccHHcccccccccEEEEEEcccHHHcHHHccccEEEEEEEEEEEcccccccccHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHcHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHcccHHHHHcccccccccEEEccccccccccc
MQVIEKFSEGLKREldviipsnrltdsfNERIEDIRSKanikgfrpgkvplshikslygksilSETIDEIIKEIVPEILskrderaamrpsitinegesditsglieGTVDLKLRlsydilpqieissfddlqVTQDICEVDEKEIDRQMAEIAKNNvafevketeseigdkvTVDYTVSVDNViledqskknVQFIVGSADLFSETTEILVGLktgdqkeierffpedhsikdlagkkvrlnfsikevfsplpvvvnndlavrlgfesesaMRGLCSQKIKQHSEFLVRQKVKRQILDYISnkytfdvpeslvenEYNGILQKVRFEMSsanqksqnvdsideEDLQYYHMLAKRRVLTGIVLgtigeknniEVTEEEMQSALYQQlgrfpghekKMLDHFQKYPNALAElrapifedkVIDHILKSVQIVDRKVTfdqlfdnssesspeklldksskvetfqseeapseis
MQVIEKFseglkreldviipsnrltdsfneRIEDIrskanikgfrpgkvplshikslygksilseTIDEIIKEIVpeilskrderaamrpsitinegesditsgLIEGTVDLKLRLSYDILPQieissfddlqvTQDICEVDEKEIDRQMAEiaknnvafevketeseigdkvtvDYTVSVDNViledqskknVQFIVGSADLFSETTEILVGLKTGDQKEIErffpedhsikdlagKKVRLNFSIKevfsplpvvvnNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKytfdvpeslVENEYNGILQKVRFEMSSanqksqnvdsiDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQlfdnssesspeklldksskvetfqseeapseis
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKLLDKSSKVETFQSEEAPSEIS
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIA*************EIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCS*****************QILDYISNKYTFDVPESLVENEYNGIL***************************YHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQ*********KKMLDHFQKYPN**AELRAPIFEDKVIDHILKSVQIVDRKVTFDQ*********************************
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEM***********SIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFD******************************
*QVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKS*NVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSSES**E***DKSSKVETFQ*********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKLLDKSSKVETFQSEEAPSEIS
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKLLDKSSKVETFQSEEAPSEIS
MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKLLDKSSKVETFQSEEAPSEIS

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
315122685459 trigger factor [Candidatus Liberibacter solanacearum CL 1 0.0
86357469494 trigger factor [Rhizobium etli CFN 42] Length = 494 1 2e-99
241204433494 trigger factor [Rhizobium leguminosarum bv. trifolii WS 1 5e-99
327189115495 chaperone trigger factor protein [Rhizobium etli CNPAF5 1 6e-99
218663471494 trigger factor [Rhizobium etli IE4771] Length = 494 1 1e-98
116251822494 trigger factor [Rhizobium leguminosarum bv. viciae 3841 1 1e-98
190891531495 chaperone trigger factor protein [Rhizobium etli CIAT 6 1 2e-98
209549106495 trigger factor [Rhizobium leguminosarum bv. trifolii WS 1 1e-97
222085803495 trigger factor protein [Agrobacterium radiobacter K84] 1 2e-97
227821953491 trigger factor [Sinorhizobium fredii NGR234] Length = 4 1 4e-97
>gi|315122685|ref|YP_004063174.1| trigger factor [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 459 Back     alignment and organism information
 Score =  664 bits (1712), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/454 (70%), Positives = 395/454 (87%), Gaps = 1/454 (0%)

Query: 1   MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGK 60
           MQ+IEKFSEGL RELDV+IPSN+LT+SFN+R+EDIRS A+IKGFRPGKVP SHIKS+YGK
Sbjct: 1   MQIIEKFSEGLNRELDVVIPSNQLTESFNKRLEDIRSTAHIKGFRPGKVPFSHIKSIYGK 60

Query: 61  SILSETIDEIIKEIVPEILSKRDERAAMRPSITINEG-ESDITSGLIEGTVDLKLRLSYD 119
           SILSE ID++IK+ VPE+LSKRDERAAMRP ITINEG E + TS L++G++DLKL LSYD
Sbjct: 61  SILSEIIDDLIKKTVPEVLSKRDERAAMRPKITINEGDEKETTSRLMDGSIDLKLGLSYD 120

Query: 120 ILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTV 179
           ILP++EI+ FDDLQ+T+D+CE+D+KEID+ M++IA+ N+AFEVKE E+ IGD++TVDYT+
Sbjct: 121 ILPKVEINIFDDLQITRDVCEIDDKEIDKHMSDIAEKNIAFEVKEKEAAIGDRITVDYTL 180

Query: 180 SVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKK 239
           SVD+V+L+D SK+N+QFIVGS +LF ETT  LV LK G+ KEIER FPEDHSIKDLAGKK
Sbjct: 181 SVDDVVLKDHSKENIQFIVGSEELFPETTNTLVDLKAGEHKEIERVFPEDHSIKDLAGKK 240

Query: 240 VRLNFSIKEVFSPLPVVVNNDLAVRLGFESESAMRGLCSQKIKQHSEFLVRQKVKRQILD 299
           V+LNFSIKEV SPLP +VN+DLA+RLGFESE+ MR   S +IK+ SE  VRQK+KRQ++D
Sbjct: 241 VKLNFSIKEVSSPLPAIVNDDLAIRLGFESEAIMRDFLSNQIKKQSEVAVRQKLKRQVID 300

Query: 300 YISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVL 359
           Y++ KY FD+P+SL++NEYNGILQ++R EM+ +    QN DSI EEDLQ Y +LA+RRV 
Sbjct: 301 YLNEKYIFDIPQSLLDNEYNGILQQIRSEMNPSGNDMQNNDSIKEEDLQDYRLLAERRVR 360

Query: 360 TGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFED 419
            GIVLGTIGEKN+IEVTEEE++SALYQQL RFPG EKKMLD+FQ  PNA+AELRAPIFE+
Sbjct: 361 AGIVLGTIGEKNSIEVTEEEIKSALYQQLSRFPGQEKKMLDYFQNSPNAIAELRAPIFEE 420

Query: 420 KVIDHILKSVQIVDRKVTFDQLFDNSSESSPEKL 453
           KVID+ILK+ Q+VD+KVT +QLF  S ESS +++
Sbjct: 421 KVIDYILKNAQVVDKKVTIEQLFSYSVESSQDEV 454


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86357469|ref|YP_469361.1| trigger factor [Rhizobium etli CFN 42] Length = 494 Back     alignment and organism information
>gi|241204433|ref|YP_002975529.1| trigger factor [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 494 Back     alignment and organism information
>gi|327189115|gb|EGE56300.1| chaperone trigger factor protein [Rhizobium etli CNPAF512] Length = 495 Back     alignment and organism information
>gi|218663471|ref|ZP_03519401.1| trigger factor [Rhizobium etli IE4771] Length = 494 Back     alignment and organism information
>gi|116251822|ref|YP_767660.1| trigger factor [Rhizobium leguminosarum bv. viciae 3841] Length = 494 Back     alignment and organism information
>gi|190891531|ref|YP_001978073.1| chaperone trigger factor protein [Rhizobium etli CIAT 652] Length = 495 Back     alignment and organism information
>gi|209549106|ref|YP_002281023.1| trigger factor [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 495 Back     alignment and organism information
>gi|222085803|ref|YP_002544333.1| trigger factor protein [Agrobacterium radiobacter K84] Length = 495 Back     alignment and organism information
>gi|227821953|ref|YP_002825924.1| trigger factor [Sinorhizobium fredii NGR234] Length = 491 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
PRK01490435 PRK01490, tig, trigger factor; Provisional 1e-80
TIGR00115408 TIGR00115, tig, trigger factor 3e-71
COG0544441 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans isome 2e-61
pfam05697144 pfam05697, Trigger_N, Bacterial trigger factor protein 2e-24
pfam05698162 pfam05698, Trigger_C, Bacterial trigger factor protein 2e-18
pfam0025495 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans 0.004
>gnl|CDD|179299 PRK01490, tig, trigger factor; Provisional Back     alignment and domain information
>gnl|CDD|161716 TIGR00115, tig, trigger factor Back     alignment and domain information
>gnl|CDD|30890 COG0544, Tig, FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|147704 pfam05697, Trigger_N, Bacterial trigger factor protein (TF) Back     alignment and domain information
>gnl|CDD|147705 pfam05698, Trigger_C, Bacterial trigger factor protein (TF) C-terminus Back     alignment and domain information
>gnl|CDD|144003 pfam00254, FKBP_C, FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 473 trigger factor [Candidatus Liberibacter asiaticus str.
PRK01490435 tig trigger factor; Provisional 100.0
COG0544441 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trig 100.0
TIGR00115475 tig trigger factor; InterPro: IPR005215 The trigger fac 100.0
pfam05697144 Trigger_N Bacterial trigger factor protein (TF). In the 99.96
pfam05698162 Trigger_C Bacterial trigger factor protein (TF) C-termi 99.89
pfam0025495 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase. 98.39
PRK10737196 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisio 98.27
COG1047174 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [ 98.14
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [ 97.5
KOG0552226 consensus 97.47
KOG0549188 consensus 97.26
PRK10902270 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisio 97.01
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding motility 96.97
KOG0544108 consensus 96.95
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 96.77
KOG0543397 consensus 92.49
PRK01885159 greB transcription elongation factor GreB; Reviewed 92.07
TIGR01462155 greA transcription elongation factor GreA; InterPro: IP 91.45
PRK00226157 greA transcription elongation factor GreA; Reviewed 90.92
pfam09312118 SurA_N SurA N-terminal domain. This domain is found at 97.09
PRK00059336 prsA peptidylprolyl isomerase; Provisional 96.91
PRK10770428 peptidyl-prolyl cis-trans isomerase SurA; Provisional 96.81
PRK12450309 foldase protein PrsA; Reviewed 96.53
PRK03095287 prsA peptidylprolyl isomerase; Reviewed 96.08
PRK01326310 prsA foldase protein PrsA; Reviewed 95.84
PRK02998283 prsA peptidylprolyl isomerase; Reviewed 95.3
PRK04405298 prsA peptidylprolyl isomerase; Provisional 95.02
PRK10788622 peptidyl-prolyl cis-trans isomerase (rotamase D); Provi 93.97
PRK00059336 prsA peptidylprolyl isomerase; Provisional 95.4
>PRK01490 tig trigger factor; Provisional Back     alignment and domain information
>COG0544 Tig FKBP-type peptidyl-prolyl cis-trans isomerase (trigger factor) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00115 tig trigger factor; InterPro: IPR005215 The trigger factor is found in several prokaryotes, and is involved in protein export Back     alignment and domain information
>pfam05697 Trigger_N Bacterial trigger factor protein (TF) Back     alignment and domain information
>pfam05698 Trigger_C Bacterial trigger factor protein (TF) C-terminus Back     alignment and domain information
>pfam00254 FKBP_C FKBP-type peptidyl-prolyl cis-trans isomerase Back     alignment and domain information
>PRK10737 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>COG1047 SlpA FKBP-type peptidyl-prolyl cis-trans isomerases 2 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0552 consensus Back     alignment and domain information
>KOG0549 consensus Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>KOG0544 consensus Back     alignment and domain information
>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0543 consensus Back     alignment and domain information
>PRK01885 greB transcription elongation factor GreB; Reviewed Back     alignment and domain information
>TIGR01462 greA transcription elongation factor GreA; InterPro: IPR006359 Bacterial GreA and GreB IPR006358 from INTERPRO promote transcription elongation by stimulating an endogenous, endonucleolytic transcript cleavage activity of the RNA polymerase (RNAP) , allowing RNA transcription to continue past template-encoded arresting sites Back     alignment and domain information
>PRK00226 greA transcription elongation factor GreA; Reviewed Back     alignment and domain information
>pfam09312 SurA_N SurA N-terminal domain Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK10770 peptidyl-prolyl cis-trans isomerase SurA; Provisional Back     alignment and domain information
>PRK12450 foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK03095 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK01326 prsA foldase protein PrsA; Reviewed Back     alignment and domain information
>PRK02998 prsA peptidylprolyl isomerase; Reviewed Back     alignment and domain information
>PRK04405 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information
>PRK10788 peptidyl-prolyl cis-trans isomerase (rotamase D); Provisional Back     alignment and domain information
>PRK00059 prsA peptidylprolyl isomerase; Provisional Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
1w26_A432 Trigger Factor In Complex With The Ribosome Forms A 3e-62
3gty_X433 Promiscuous Substrate Recognition In Folding And As 1e-17
3gu0_A412 Promiscuous Substrate Recognition In Folding And As 1e-16
1t11_A392 Trigger Factor Length = 392 5e-53
1w2b_5144 Trigger Factor Ribosome Binding Domain In Complex W 3e-29
1p9y_A121 Ribosome Binding Of E. Coli Trigger Factor Mutant F 1e-26
1oms_A121 Structure Determination By Mad: E.Coli Trigger Fact 2e-26
2d3o_1112 Structure Of Ribosome Binding Domain Of The Trigger 4e-17
2aar_7113 Structure Of Trigger Factor Binding Domain In Biolo 6e-17
2nsb_A109 Structures Of And Interactions Between Domains Of T 4e-07
1l1p_A106 Solution Structure Of The Ppiase Domain From E. Col 3e-04
>gi|55670527|pdb|1W26|A Chain A, Trigger Factor In Complex With The Ribosome Forms A Molecular Cradle For Nascent Proteins Length = 432 Back     alignment and structure
 Score =  244 bits (621), Expect = 3e-62,   Method: Composition-based stats.
 Identities = 89/447 (19%), Positives = 200/447 (44%), Gaps = 18/447 (4%)

Query: 2   QVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKS 61
           QV  + ++GL R + + I ++ +  +    + ++  K  I GFR GKVP + +   YG S
Sbjct: 2   QVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPXNIVAQRYGAS 61

Query: 62  ILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDIL 121
           +  + + ++      + + K     A  P+            G  +   D    + +++ 
Sbjct: 62  VRQDVLGDLXSRNFIDAIIKEKINPAGAPT---------YVPGEYKLGEDFTYSVEFEVY 112

Query: 122 PQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVSV 181
           P++E+   + ++V + I EV + ++D  +  + K    ++ K+   E  D+VT+D+T SV
Sbjct: 113 PEVELQGLEAIEVEKPIVEVTDADVDGXLDTLRKQQATWKEKDGAVEAEDRVTIDFTGSV 172

Query: 182 DNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKVR 241
           D    E     +     G         + + G K G++  I+  FPE++  ++L GK  +
Sbjct: 173 DGEEFEGGKASDFVLAXGQGRXIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAAK 232

Query: 242 LNFSIKEVFSPLPVVVNNDLAVRLGFES--ESAMRGLCSQKIKQHSEFLVRQKVKRQILD 299
              ++K+V       +  +   R G E      +R    +  ++  +  +R +VK Q ++
Sbjct: 233 FAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNXERELKSAIRNRVKSQAIE 292

Query: 300 YISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVL 359
            +      DVP +L+++E + + ++             N     E   + +   AKRRV+
Sbjct: 293 GLVKANDIDVPAALIDSEIDVLRRQAAQRFGG------NEKQALELPRELFEEQAKRRVV 346

Query: 360 TGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFED 419
            G++LG +   N ++  EE ++  + +    +    K++++ + K        R    E+
Sbjct: 347 VGLLLGEVIRTNELKADEERVKGLIEEXASAY-EDPKEVIEFYSKNKELXDNXRNVALEE 405

Query: 420 KVIDHILKSVQIVDRKVTFDQLFDNSS 446
           + ++ +L   ++ +++ TF++L +  +
Sbjct: 406 QAVEAVLAKAKVTEKETTFNELXNQQA 432


>gi|281500761|pdb|3GTY|X Chain X, Promiscuous Substrate Recognition In Folding And Assembly Activities Of The Trigger Factor Chaperone Length = 433 Back     alignment and structure
>gi|281500763|pdb|3GU0|A Chain A, Promiscuous Substrate Recognition In Folding And Assembly Activities Of The Trigger Factor Chaperone Length = 412 Back     alignment and structure
>gi|55669803|pdb|1T11|A Chain A, Trigger Factor Length = 392 Back     alignment and structure
>gi|55670534|pdb|1W2B|5 Chain 5, Trigger Factor Ribosome Binding Domain In Complex With 50s Length = 144 Back     alignment and structure
>gi|40889296|pdb|1P9Y|A Chain A, Ribosome Binding Of E. Coli Trigger Factor Mutant F44l. Length = 121 Back     alignment and structure
>gi|40889238|pdb|1OMS|A Chain A, Structure Determination By Mad: E.Coli Trigger Factor Binding At The Ribosomal Exit Tunnel. Length = 121 Back     alignment and structure
>gi|83754924|pdb|2D3O|1 Chain 1, Structure Of Ribosome Binding Domain Of The Trigger Factor On The 50s Ribosomal Subunit From D. Radiodurans Length = 112 Back     alignment and structure
>gi|75766111|pdb|2AAR|7 Chain 7, Structure Of Trigger Factor Binding Domain In Biologically Homologous Complex With Eubacterial Ribosome Length = 113 Back     alignment and structure
>gi|145579894|pdb|2NSB|A Chain A, Structures Of And Interactions Between Domains Of Trigger Factor From Themotoga Maritima Length = 109 Back     alignment and structure
>gi|159162627|pdb|1L1P|A Chain A, Solution Structure Of The Ppiase Domain From E. Coli Trigger Factor Length = 106 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
1w26_A432 Trigger factor, TF; chaperone, protein folding, ribosom 1e-52
3gty_X433 Trigger factor, TF; chaperone-client complex, cell cycl 2e-43
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-bundle 2e-44
1zxj_A218 MPN555, hypothetical protein Mg377 homolog; mostly alph 1e-20
2nsa_A170 Trigger factor, TF; chaperone; 1.70A {Thermotoga mariti 2e-19
1p9y_A121 Trigger factor, TF; alpha-beta protein, isomerase; 2.15 6e-17
2nsc_A109 Trigger factor, TF; chaperone; 2.20A {Thermotoga mariti 2e-12
2d3o_1112 Trigger factor, TF; ribosome, nascent chain, protein fo 6e-12
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR {Myco 1e-12
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Length = 432 Back     alignment and structure
 Score =  202 bits (515), Expect = 1e-52
 Identities = 91/445 (20%), Positives = 211/445 (47%), Gaps = 18/445 (4%)

Query: 1   MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGK 60
           MQV  + ++GL R + + I ++ +  +    + ++  K  I GFR GKVP++ +   YG 
Sbjct: 1   MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGA 60

Query: 61  SILSETIDEIIKEIVPEILSKRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDI 120
           S+  + + +++     + + K     A  P+    E +            D    + +++
Sbjct: 61  SVRQDVLGDLMSRNFIDAIIKEKINPAGAPTYVPGEYKLGE---------DFTYSVEFEV 111

Query: 121 LPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAFEVKETESEIGDKVTVDYTVS 180
            P++E+   + ++V + I EV + ++D  +  + K    ++ K+   E  D+VT+D+T S
Sbjct: 112 YPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATWKEKDGAVEAEDRVTIDFTGS 171

Query: 181 VDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKV 240
           VD    E     +    +G   +     + + G K G++  I+  FPE++  ++L GK  
Sbjct: 172 VDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAA 231

Query: 241 RLNFSIKEVFSPLPVVVNNDLAVRLGFE--SESAMRGLCSQKIKQHSEFLVRQKVKRQIL 298
           +   ++K+V       +  +   R G E  S   +R    + +++  +  +R +VK Q +
Sbjct: 232 KFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSAIRNRVKSQAI 291

Query: 299 DYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRV 358
           + +      DVP +L+++E + + ++         +++       E   + +   AKRRV
Sbjct: 292 EGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEKQAL------ELPRELFEEQAKRRV 345

Query: 359 LTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFE 418
           + G++LG +   N ++  EE ++  L +++       K++++ + K    +  +R    E
Sbjct: 346 VVGLLLGEVIRTNELKADEERVK-GLIEEMASAYEDPKEVIEFYSKNKELMDNMRNVALE 404

Query: 419 DKVIDHILKSVQIVDRKVTFDQLFD 443
           ++ ++ +L   ++ +++ TF++L +
Sbjct: 405 EQAVEAVLAKAKVTEKETTFNELMN 429


>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_A Length = 433 Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Length = 392 Back     alignment and structure
>1zxj_A MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae} Length = 218 Back     alignment and structure
>2nsa_A Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Length = 170 Back     alignment and structure
>1p9y_A Trigger factor, TF; alpha-beta protein, isomerase; 2.15A {Escherichia coli} SCOP: d.241.2.1 PDB: 1oms_A* Length = 121 Back     alignment and structure
>2nsc_A Trigger factor, TF; chaperone; 2.20A {Thermotoga maritima} PDB: 2nsb_A Length = 109 Back     alignment and structure
>2d3o_1 Trigger factor, TF; ribosome, nascent chain, protein folding, SRP; 3.35A {Deinococcus radiodurans} PDB: 2aar_7 Length = 112 Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Length = 113 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
1w26_A432 Trigger factor, TF; chaperone, protein folding, ribosom 100.0
3gty_X433 Trigger factor, TF; chaperone-client complex, cell cycl 100.0
1t11_A392 Trigger factor, TF; helix-turn-helix, four-helix-bundle 100.0
1zxj_A218 MPN555, hypothetical protein Mg377 homolog; mostly alph 99.95
1p9y_A121 Trigger factor, TF; alpha-beta protein, isomerase; 2.15 99.92
2d3o_1112 Trigger factor, TF; ribosome, nascent chain, protein fo 99.81
2nsc_A109 Trigger factor, TF; chaperone; 2.20A {Thermotoga mariti 99.76
2nsa_A170 Trigger factor, TF; chaperone; 1.70A {Thermotoga mariti 99.87
1hxv_A113 Trigger factor; FKBP fold, ppiase, chaperone; NMR {Myco 99.79
3cgm_A158 SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone fu 98.63
2kfw_A196 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; pro 98.49
2k8i_A171 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chap 98.46
1ix5_A151 FKBP; ppiase, isomerase; NMR {Methanothermococcusthermo 98.35
2pbc_A102 FK506-binding protein 2; endoplasmic reticulum, isomera 98.09
1pbk_A116 FKBP25, EC 5.2.1.8; FKBP12 homologous domain of HFKBP25 97.75
1jvw_A167 Macrophage infectivity potentiator; chagas disease, X-R 97.65
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apoptosis, 97.64
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomyces c 97.64
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, 97.64
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuclear 97.63
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, struc 97.59
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 97.59
2ke0_A117 Peptidyl-prolyl CIS-trans isomerase; bupsa.00130.A, FK5 97.57
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repea 97.56
1fd9_A213 Protein (macrophage infectivity potentiator protein); F 97.55
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKPA; cha 97.53
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain 97.51
2ppn_A107 FK506-binding protein 1A; high resolution protein struc 97.48
2f4e_A180 ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.3 97.4
1r9h_A135 FKB-6, FK506 binding protein family; structural genomic 97.17
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotamase, T 97.08
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuclear 97.02
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain 96.97
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signa 96.82
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP1 96.82
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo 96.38
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, 96.11
2p4v_A158 Transcription elongation factor GREB; transcript cleava 90.53
1m5y_A408 SurviVal protein, surviVal protein SURA; surviVal prote 94.95
>1w26_A Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 2vrh_A 1w2b_5 Back     alignment and structure
Probab=100.00  E-value=0  Score=656.80  Aligned_cols=430  Identities=21%  Similarity=0.424  Sum_probs=409.3

Q ss_pred             CCEEEEECCCCEEEEEEEECHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             91189972797699999854899999999999998750738985897048899998610899999999999999999998
Q gi|254780897|r    1 MQVIEKFSEGLKRELDVIIPSNRLTDSFNERIEDIRSKANIKGFRPGKVPLSHIKSLYGKSILSETIDEIIKEIVPEILS   80 (473)
Q Consensus         1 M~v~~~~~~~~~~~l~v~v~~~~~~~~~~~~~~~~~~~~~ipGFRkGKvP~~ii~~~~g~~i~~e~~~~li~~~~~~~i~   80 (473)
                      |+|++++.++|+++|+|+||+++|+..++++++.++++++||||||||||++||+++||++|+.++++++++.++.+++.
T Consensus         1 M~v~ve~~~~~~~~l~v~v~~~~~~~~~~~~~~~~~k~~~ipGFRkGkvP~~vi~k~yg~~i~~e~~~~lv~~~~~~~i~   80 (432)
T 1w26_A            1 MQVSVETTQGLGRRVTITIAADSIETAVKSELVNVAKKVRIDGFRKGKVPMNIVAQRYGASVRQDVLGDLMSRNFIDAII   80 (432)
T ss_dssp             CEEECCBCSTTEEEEEEEECHHHHHHHHHHHHHHHHHHTTCGGGCCSSSCHHHHHHHHCTTTHHHHHHHHHHHHHHHHHH
T ss_pred             CCCEEEECCCCEEEEEEEECHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97279977886799999998999999999999998661877998999988999999975999999999999999999999


Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             72995422874122222233321101378820578876227877621113564310012111157899999976431000
Q gi|254780897|r   81 KRDERAAMRPSITINEGESDITSGLIEGTVDLKLRLSYDILPQIEISSFDDLQVTQDICEVDEKEIDRQMAEIAKNNVAF  160 (473)
Q Consensus        81 ~~~~~~~~~P~i~~~~~~~~~~~~~~~~~~~~~~~~~~ev~Pei~l~~y~~i~i~~~~~~vtd~~Id~~i~~l~~~~~~~  160 (473)
                      ++++.|+|+|.+....         +..+.+|+|+++|+++|+|+|++|++++++++.++||+++|+.+|+++++++|+|
T Consensus        81 e~~l~~~~~p~~~~~~---------~~~~~~~~f~~~~~v~Pe~~l~~~~~i~v~~~~~~vtde~vd~~i~~l~~~~~~~  151 (432)
T 1w26_A           81 KEKINPAGAPTYVPGE---------YKLGEDFTYSVEFEVYPEVELQGLEAIEVEKPIVEVTDADVDGMLDTLRKQQATW  151 (432)
T ss_dssp             HSCCCEEEEEEEEECC---------CCTTSCEEEEEEEEECCCCCCCCTTTCBCCEEECCCCHHHHHHHHHHHHHHTCEE
T ss_pred             HCCCCCCCCCCCCCCC---------CCCCCCCEEEEEEEECCCCCCCCCCCEEEEEECCCCCHHHHHHHHHHHHHHHCCC
T ss_conf             7699847786212342---------1125673489999963553335556437876214568899999999997641221


Q ss_pred             CCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCE
Q ss_conf             02343322111134445666426534666544203651786656310342068878875433234444444100038730
Q gi|254780897|r  161 EVKETESEIGDKVTVDYTVSVDNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDLAGKKV  240 (473)
Q Consensus       161 ~~~~~~~~~gD~v~id~~~~~dg~~~~~~~~~~~~~~lg~~~~~~~f~~~liG~k~Gd~~~~~~~~P~d~~~~~laGk~v  240 (473)
                      .+++++++.||+|+|||+++++|++++|++++++.+.+|++.++|||.++|+|||+||+++|+++||+||+.+.++|+++
T Consensus       152 ~~~~~~~~~gD~v~id~~~~~dg~~~~~~~~~~~~~~lg~~~~~~~f~~~l~G~k~Gd~~~~~~~~p~d~~~~~~agk~~  231 (432)
T 1w26_A          152 KEKDGAVEAEDRVTIDFTGSVDGEEFEGGKASDFVLAMGQGRMIPGFEDGIKGHKAGEEFTIDVTFPEEYHAENLKGKAA  231 (432)
T ss_dssp             CCCSSCCCTTCEEEECEEEESSSCBCSSCCCSSEEEETTSCCSCTTHHHHSSSCCSSCEEEEEEECCTTCSCTTTSSCEE
T ss_pred             CCCCCCCCCCCEEEEEEEEEECCCCCCCCCCCCEEEEECCCCCCCCHHHHHHHCCCCCEEEEEEECCCCCCCHHHCCCCH
T ss_conf             33334567899899999997668646677766559994798766306888753247876999875686423013225331


Q ss_pred             EEEEEHHHHHCCCCCCCCHHHHHHHC--CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHH
Q ss_conf             46761011002467776747887502--3655789999998878999977777669999999986400347999999997
Q gi|254780897|r  241 RLNFSIKEVFSPLPVVVNNDLAVRLG--FESESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEY  318 (473)
Q Consensus       241 ~f~v~v~~I~~~~~pel~def~k~~~--~~t~~elk~~ik~~l~~~~~~~~~~~~~~~i~~~L~~~~~~~lPe~lv~~e~  318 (473)
                      .|.|+|++|+++++|++||+|++++|  .+|+++||+.|+++++.+++..+.+.++++++++|++.++|++|++++++++
T Consensus       232 ~f~v~v~~i~~~~~pel~def~k~~~~e~~t~eelk~~ik~~l~~~~~~~~~~~~~~~i~~~L~~~~~~~lp~~~~~~~~  311 (432)
T 1w26_A          232 KFAINLKKVEERELPELTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEI  311 (432)
T ss_dssp             EEEEECCEECCEECCCCSHHHHTTTTCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_pred             HHEEEEEEECCCCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHH
T ss_conf             21123223204558864489998728520269999999999999999999999999999999987466668889999999


Q ss_pred             HHHHHHHHHHHHHCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHH
Q ss_conf             76789999997534864001100013456778999999999999999998643874289999999999998639998999
Q gi|254780897|r  319 NGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKM  398 (473)
Q Consensus       319 ~~~~~~~~~~l~~~~~~~~~~~~~~e~~~~~~~~~Aek~vk~~lil~~Ia~~e~I~vs~~Ei~~~i~~~~~~~~~~~~~~  398 (473)
                      ..++.++..++..++..      +.+.+++.+++.|++++||+||+++||+.++|+||++||++++.+++++|+ .+.++
T Consensus       312 ~~~~~~~~~~~~~~~~~------~~e~~~e~~~~~a~~~vk~~lil~~Ia~~e~I~vt~eei~~~i~~~a~~~~-~~~~~  384 (432)
T 1w26_A          312 DVLRRQAAQRFGGNEKQ------ALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYE-DPKEV  384 (432)
T ss_dssp             HHHHHHHHTTTTCCTTS------STTSCGGGTHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHTTSS-CHHHH
T ss_pred             HHHHHHHHHHHCCCCHH------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHCC-CHHHH
T ss_conf             99999999875021100------057799999999999999999999999993898899999999999998769-98999


Q ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEECHHHHCCCCC
Q ss_conf             999870999899999999999999999885356655314888406765
Q gi|254780897|r  399 LDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKVTFDQLFDNSS  446 (473)
Q Consensus       399 ~~~~~~~~~~~~~i~~~ile~Kv~d~l~~~a~i~ek~~~~~el~~~~~  446 (473)
                      +++|.++++.+..+++.++++|+++||+++|+++++++|++||++..+
T Consensus       385 ~~~~~~~~~~~~~i~~~i~~~Kv~~~l~e~a~i~ek~~s~~e~~~~~a  432 (432)
T 1w26_A          385 IEFYSKNKELMDNMRNVALEEQAVEAVLAKAKVTEKETTFNELMNQQA  432 (432)
T ss_dssp             HHHHHHCHHHHHHHHHHHHHHHHHHHHHTTSBCCEEECCHHHHTCCCC
T ss_pred             HHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEECCHHHHHCCCC
T ss_conf             999986989999999999999999999985976654367999716789



>3gty_X Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1t11_A Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} SCOP: a.223.1.1 d.241.2.1 d.26.1.1 PDB: 1l1p_A Back     alignment and structure
>1zxj_A MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae} Back     alignment and structure
>1p9y_A Trigger factor, TF; alpha-beta protein, isomerase; 2.15A {Escherichia coli} SCOP: d.241.2.1 PDB: 1oms_A* Back     alignment and structure
>2d3o_1 Trigger factor, TF; ribosome, nascent chain, protein folding, SRP; 3.35A {Deinococcus radiodurans} PDB: 2aar_7 Back     alignment and structure
>2nsc_A Trigger factor, TF; chaperone; 2.20A {Thermotoga maritima} PDB: 2nsb_A Back     alignment and structure
>2nsa_A Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Back     alignment and structure
>1hxv_A Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} SCOP: d.26.1.1 Back     alignment and structure
>3cgm_A SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain P rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A 3luo_A* Back     alignment and structure
>2kfw_A FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1ix5_A FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.26.1.1 Back     alignment and structure
>2pbc_A FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1pbk_A FKBP25, EC 5.2.1.8; FKBP12 homologous domain of HFKBP25, isomerase; HET: RAP; 2.50A {Homo sapiens} SCOP: d.26.1.1 Back     alignment and structure
>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>2ke0_A Peptidyl-prolyl CIS-trans isomerase; bupsa.00130.A, FK506 binding protein FKBP, structural genomics; NMR {Burkholderia pseudomallei} PDB: 2ko7_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator protein); FKBP domain, long alpha helix, dimerisation VIA helical interactions, isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKPA; chaperone, peptidyl-prolyl isomerase, heat shock protein, periplasm, FKBP family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A Back     alignment and structure
>2p4v_A Transcription elongation factor GREB; transcript cleavage, GRE-factors, RNA polymerase; 2.60A {Escherichia coli} Back     alignment and structure
>1m5y_A SurviVal protein, surviVal protein SURA; surviVal protein A, periplasmic molecular chaperone, membrane protein folding, GRAM negative bacteria; 3.00A {Escherichia coli} SCOP: a.223.1.2 d.26.1.1 d.26.1.1 PDB: 2pv3_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 473 trigger factor [Candidatus Liberibacter asiaticus str.
d1w26a1185 a.223.1.1 (A:248-432) Trigger factor, C-terminal domain 2e-19
d1t11a3113 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibr 9e-16
d1l1pa_106 d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia 1e-10
d1hxva_85 d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma 4e-09
d1t11a2129 d.241.2.1 (A:1-129) Trigger factor ribosome-binding dom 2e-15
d1p9ya_117 d.241.2.1 (A:) Trigger factor ribosome-binding domain { 3e-15
d1t11a1129 a.223.1.1 (A:248-376) Trigger factor, C-terminal domain 4e-11
>d1w26a1 a.223.1.1 (A:248-432) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]} Length = 185 Back     information, alignment and structure

class: All alpha proteins
fold: Triger factor/SurA peptide-binding domain-like
superfamily: Triger factor/SurA peptide-binding domain-like
family: TF C-terminus
domain: Trigger factor, C-terminal domain
species: Escherichia coli [TaxId: 562]
 Score = 90.9 bits (225), Expect = 2e-19
 Identities = 34/187 (18%), Positives = 90/187 (48%), Gaps = 9/187 (4%)

Query: 257 VNNDLAVRLGFESES--AMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLV 314
           +  +   R G E  S   +R    + +++  +  +R +VK Q ++ +      DVP +L+
Sbjct: 1   LTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSAIRNRVKSQAIEGLVKANDIDVPAALI 60

Query: 315 ENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIE 374
           ++E + + ++         +++       E   + +   AKRRV+ G++LG +   N ++
Sbjct: 61  DSEIDVLRRQAAQRFGGNEKQA------LELPRELFEEQAKRRVVVGLLLGEVIRTNELK 114

Query: 375 VTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDR 434
             EE ++    +++       K++++ + K    +  +R    E++ ++ +L   ++ ++
Sbjct: 115 ADEERVKGL-IEEMASAYEDPKEVIEFYSKNKELMDNMRNVALEEQAVEAVLAKAKVTEK 173

Query: 435 KVTFDQL 441
           + TF++L
Sbjct: 174 ETTFNEL 180


>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Length = 113 Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Length = 85 Back     information, alignment and structure
>d1t11a2 d.241.2.1 (A:1-129) Trigger factor ribosome-binding domain {Vibrio cholerae [TaxId: 666]} Length = 129 Back     information, alignment and structure
>d1p9ya_ d.241.2.1 (A:) Trigger factor ribosome-binding domain {Escherichia coli [TaxId: 562]} Length = 117 Back     information, alignment and structure
>d1t11a1 a.223.1.1 (A:248-376) Trigger factor, C-terminal domain {Vibrio cholerae [TaxId: 666]} Length = 129 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
d1w26a1185 Trigger factor, C-terminal domain {Escherichia coli [Ta 99.96
d1t11a2129 Trigger factor ribosome-binding domain {Vibrio cholerae 99.94
d1p9ya_117 Trigger factor ribosome-binding domain {Escherichia col 99.92
d1t11a3113 Trigger factor PPIase domain {Vibrio cholerae [TaxId: 6 99.87
d1l1pa_106 Trigger factor PPIase domain {Escherichia coli [TaxId: 99.82
d1hxva_85 Trigger factor PPIase domain {Mycoplasma genitalium [Ta 99.56
d1ix5a_151 Archaeal FKBP {Archaeon Methanococcus thermolithotrophi 98.25
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) {Trypa 97.64
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId 97.63
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces ce 97.6
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri boliviensis 97.56
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) {Legio 97.54
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin {Human 97.54
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia c 97.41
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri boliviensis 97.34
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId 97.29
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId 97.14
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702 96.7
d1t11a1129 Trigger factor, C-terminal domain {Vibrio cholerae [Tax 99.69
d1m5ya1173 Porin chaperone SurA, peptide-binding domain {Escherich 97.33
d1m5ya1173 Porin chaperone SurA, peptide-binding domain {Escherich 93.4
>d1w26a1 a.223.1.1 (A:248-432) Trigger factor, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Triger factor/SurA peptide-binding domain-like
superfamily: Triger factor/SurA peptide-binding domain-like
family: TF C-terminus
domain: Trigger factor, C-terminal domain
species: Escherichia coli [TaxId: 562]
Probab=99.96  E-value=6.2e-27  Score=230.90  Aligned_cols=182  Identities=19%  Similarity=0.423  Sum_probs=170.2

Q ss_pred             CCHHHHHHHCCC--CHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCC
Q ss_conf             674788750236--557899999988789999777776699999999864003479999999977678999999753486
Q gi|254780897|r  257 VNNDLAVRLGFE--SESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQ  334 (473)
Q Consensus       257 l~def~k~~~~~--t~~elk~~ik~~l~~~~~~~~~~~~~~~i~~~L~~~~~~~lPe~lv~~e~~~~~~~~~~~l~~~~~  334 (473)
                      |||+||+.+|++  |+++||+.|+++|..++...+...++++++++|++.++|++|++||+++++++++++..++..++.
T Consensus         1 L~dEFak~~g~e~~tleelk~~ik~~l~~~~~~~~~~~~~~~i~~~L~~~~~~elP~slv~~e~~~~~~~~~~~~~~~~~   80 (185)
T d1w26a1           1 LTAEFIKRFGVEDGSVEGLRAEVRKNMERELKSAIRNRVKSQAIEGLVKANDIDVPAALIDSEIDVLRRQAAQRFGGNEK   80 (185)
T ss_dssp             CSHHHHTTTTCSSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHTTTTCCTT
T ss_pred             CCHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHCCCCC
T ss_conf             98899987388779999999999999999999999999999999999975786797899999999999998774001220


Q ss_pred             CCHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCHHHHHHHHH
Q ss_conf             40011000134567789999999999999999986438742899999999999986399989999998709998999999
Q gi|254780897|r  335 KSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRA  414 (473)
Q Consensus       335 ~~~~~~~~~e~~~~~~~~~Aek~vk~~lil~~Ia~~e~I~vs~~Ei~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~  414 (473)
                      .      ..+.++..+++.|+++||++||+++||+.++|+||++||..++.+++.+|+ .+.+.+++|+++++++..+++
T Consensus        81 ~------~~e~~~~~~~~~A~~~vk~~lil~~Ia~~e~i~vt~eei~~~i~~~a~~~~-~~~~~~~~~~~~~~~~~~i~~  153 (185)
T d1w26a1          81 Q------ALELPRELFEEQAKRRVVVGLLLGEVIRTNELKADEERVKGLIEEMASAYE-DPKEVIEFYSKNKELMDNMRN  153 (185)
T ss_dssp             S------STTSCGGGTHHHHHHHHHHHHHHHHHHHHTTCCCCHHHHHHHHHHHHTTSS-CHHHHHHHHHHCHHHHHHHHH
T ss_pred             H------HHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHCCC-CHHHHHHHHHHCHHHHHHHHH
T ss_conf             0------024458999999999999999999999873687899999999987652159-889999999829999999999


Q ss_pred             HHHHHHHHHHHHHHCEEEEEEECHHHHCCCC
Q ss_conf             9999999999988535665531488840676
Q gi|254780897|r  415 PIFEDKVIDHILKSVQIVDRKVTFDQLFDNS  445 (473)
Q Consensus       415 ~ile~Kv~d~l~~~a~i~ek~~~~~el~~~~  445 (473)
                      .++++||++||+++|+++++++|++||++..
T Consensus       154 ~i~~~Kv~~~l~~~akv~ek~~s~~El~~~~  184 (185)
T d1w26a1         154 VALEEQAVEAVLAKAKVTEKETTFNELMNQQ  184 (185)
T ss_dssp             HHHHHHHHHHHHTTSBCCEEECCHHHHTCCC
T ss_pred             HHHHHHHHHHHHHHCEEEEEECCHHHHHCCC
T ss_conf             9999999999998683000105599972678



>d1t11a2 d.241.2.1 (A:1-129) Trigger factor ribosome-binding domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1p9ya_ d.241.2.1 (A:) Trigger factor ribosome-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t11a3 d.26.1.1 (A:135-247) Trigger factor PPIase domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l1pa_ d.26.1.1 (A:) Trigger factor PPIase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hxva_ d.26.1.1 (A:) Trigger factor PPIase domain {Mycoplasma genitalium [TaxId: 2097]} Back     information, alignment and structure
>d1ix5a_ d.26.1.1 (A:) Archaeal FKBP {Archaeon Methanococcus thermolithotrophicus [TaxId: 2186]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t11a1 a.223.1.1 (A:248-376) Trigger factor, C-terminal domain {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1m5ya1 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m5ya1 a.223.1.2 (A:25-164,A:395-427) Porin chaperone SurA, peptide-binding domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 473 trigger factor [Candidatus Liberibacter asiaticus
1zxj_A_218 (A:) MPN555, hypothetical protein Mg377 homolog; m 5e-23
2nsa_A_170 (A:) Trigger factor, TF; chaperone; 1.70A {Thermot 2e-18
1t11_A_121-151_258-392166 (A:121-151,A:258-392) Trigger factor, TF; helix-tu 1e-14
1t11_A_1-120120 (A:1-120) Trigger factor, TF; helix-turn-helix, fo 3e-18
1p9y_A_121 (A:) Trigger factor, TF; alpha-beta protein, isome 5e-18
1w26_A_1-117117 (A:1-117) Trigger factor, TF; chaperone, protein f 8e-17
3gty_X_1-108108 (X:1-108) Trigger factor, TF; chaperone-client com 1e-15
2d3o_1_112 (1:) Trigger factor, TF; ribosome, nascent chain, 2e-13
2nsc_A_21-10989 (A:21-109) Trigger factor, TF; chaperone; 2.20A {T 1e-11
1w26_A_133-254122 (A:133-254) Trigger factor, TF; chaperone, protein 1e-12
1t11_A_152-257106 (A:152-257) Trigger factor, TF; helix-turn-helix, 6e-11
3gty_X_146-23994 (X:146-239) Trigger factor, TF; chaperone-client c 2e-09
1hxv_A_113 (A:) Trigger factor; FKBP fold, ppiase, chaperone; 4e-09
1p5q_A_1-136136 (A:1-136) FKBP52, FK506-binding protein 4; isomera 6e-09
2kfw_A_1-70_125-196142 (A:1-70,A:125-196) FKBP-type peptidyl-prolyl CIS-t 7e-09
3cgm_A_1-64_121-158102 (A:1-64,A:121-158) SLYD, peptidyl-prolyl CIS-trans 9e-09
2k8i_A_1-69_125-171116 (A:1-69,A:125-171) SLYD, peptidyl-prolyl CIS-trans 1e-07
1ix5_A_1-82_135-15199 (A:1-82,A:135-151) FKBP; ppiase, isomerase; NMR {M 0.001
1w26_A_118-132_255-301_415-43280 (A:118-132,A:255-301,A:415-432) Trigger factor, TF 5e-04
>1zxj_A (A:) MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae}Length = 218 Back     alignment and structure
 Score =  103 bits (258), Expect = 5e-23
 Identities = 21/232 (9%), Positives = 71/232 (30%), Gaps = 27/232 (11%)

Query: 211 LVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLGFES- 269
                     +I       +    +A         +K +     + V    A     E  
Sbjct: 3   SSHHHHHHDYDIP-TTENLYFQGHMATNLKSTAKLVKPIQYDEVIEVERIFADPAFIEQH 61

Query: 270 -----ESAMRGLCSQKIKQHSEFLVRQKVKRQILDYISNKYTFDVPESLVENEYNGILQK 324
                 S      S    + +  +++  +    ++ I   + F++ E+ ++N   G+ + 
Sbjct: 62  RQRILASFKDAKESALYHELTHIVIKDNLFSCAMNAIVGYFEFNIDEAELKNVMEGLKRD 121

Query: 325 VRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIVLGTIGEKNNIEVTEEEMQSAL 384
           V         ++                 A++ +   +V   + ++  +E+T+E +++ +
Sbjct: 122 VIQGAEDNTVQAI----------------AEKIIKKALVFNHLQKEWKVEITDEVVKNVI 165

Query: 385 YQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKV 436
                +      + +  +         +R  + E++++   +   +      
Sbjct: 166 SLYYEKT----NQSVREYLDDKQKFEGVRTALLEERMVLETINHFKFHFNLT 213


>2nsa_A (A:) Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima}Length = 170 Back     alignment and structure
>1t11_A (A:121-151,A:258-392) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae}Length = 166 Back     alignment and structure
>1t11_A (A:1-120) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae}Length = 120 Back     alignment and structure
>1p9y_A (A:) Trigger factor, TF; alpha-beta protein, isomerase; 2.15A {Escherichia coli}Length = 121 Back     alignment and structure
>1w26_A (A:1-117) Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli}Length = 117 Back     alignment and structure
>3gty_X (X:1-108) Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_ALength = 108 Back     alignment and structure
>2d3o_1 (1:) Trigger factor, TF; ribosome, nascent chain, protein folding, SRP; 3.35A {Deinococcus radiodurans} PDB: 2aar_7Length = 112 Back     alignment and structure
>2nsc_A (A:21-109) Trigger factor, TF; chaperone; 2.20A {Thermotoga maritima} PDB: 2nsb_ALength = 89 Back     alignment and structure
>1w26_A (A:133-254) Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli}Length = 122 Back     alignment and structure
>1t11_A (A:152-257) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae}Length = 106 Back     alignment and structure
>3gty_X (X:146-239) Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_ALength = 94 Back     alignment and structure
>1hxv_A (A:) Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium}Length = 113 Back     alignment and structure
>1p5q_A (A:1-136) FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens}Length = 136 Back     alignment and structure
>2kfw_A (A:1-70,A:125-196) FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli}Length = 142 Back     alignment and structure
>3cgm_A (A:1-64,A:121-158) SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain protein, rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_ALength = 102 Back     alignment and structure
>2k8i_A (A:1-69,A:125-171) SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli}Length = 116 Back     alignment and structure
>1ix5_A (A:1-82,A:135-151) FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus}Length = 99 Back     alignment and structure
>1w26_A (A:118-132,A:255-301,A:415-432) Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli}Length = 80 Back     alignment and structure

Homologous Domains in MMDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target473 trigger factor [Candidatus Liberibacter asiaticus str.
1zxj_A_218 MPN555, hypothetical protein Mg377 homolog; mostly 99.97
1t11_A_1-120120 Trigger factor, TF; helix-turn-helix, four-helix-b 99.91
1p9y_A_121 Trigger factor, TF; alpha-beta protein, isomerase; 99.91
1w26_A_1-117117 Trigger factor, TF; chaperone, protein folding, ri 99.88
3gty_X_1-108108 Trigger factor, TF; chaperone-client complex, cell 99.79
2d3o_1_112 Trigger factor, TF; ribosome, nascent chain, prote 99.78
2nsc_A_21-10989 Trigger factor, TF; chaperone; 2.20A {Thermotoga m 99.64
2nsa_A_170 Trigger factor, TF; chaperone; 1.70A {Thermotoga m 99.84
1w26_A_133-254122 Trigger factor, TF; chaperone, protein folding, ri 99.82
3gty_X_146-23994 Trigger factor, TF; chaperone-client complex, cell 99.66
1hxv_A_113 Trigger factor; FKBP fold, ppiase, chaperone; NMR 99.64
1t11_A_152-257106 Trigger factor, TF; helix-turn-helix, four-helix-b 99.62
3cgm_A_1-64_121-158102 SLYD, peptidyl-prolyl CIS-trans isomerase; chapero 99.48
2kfw_A_1-70_125-196142 FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD 99.4
2k8i_A_1-69_125-171116 SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, 99.37
1p5q_A_1-136136 FKBP52, FK506-binding protein 4; isomerase; 2.80A 98.88
1ix5_A_1-82_135-15199 FKBP; ppiase, isomerase; NMR {Methanothermococcust 98.64
2pbc_A_102 FK506-binding protein 2; endoplasmic reticulum, is 98.5
2d9f_A_135 FK506-binding protein 8 variant; FKBP, rapamycin, 98.23
2vn1_A_129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 98.08
1jvw_A_167 Macrophage infectivity potentiator; chagas disease 98.08
1yat_A_113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 98.02
2ppn_A_107 FK506-binding protein 1A; high resolution protein 97.96
1fd9_A_52-213162 Protein (macrophage infectivity potentiator protei 97.96
1q6h_A_67-224158 FKBP-type peptidyl-prolyl CIS-trans isomerase FKPA 97.92
1r9h_A_135 FKB-6, FK506 binding protein family; structural ge 97.84
2awg_A_118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 97.79
2ke0_A_117 Peptidyl-prolyl CIS-trans isomerase; bupsa.00130.A 97.71
2jwx_A_157 FKBP38NTD, FK506-binding protein 8 variant; apopto 97.65
1pbk_A_116 FKBP25, EC 5.2.1.8; FKBP12 homologous domain of HF 97.61
2f4e_A_180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 97.56
3b7x_A_134 FK506-binding protein 6; isomerase, repeat, rotama 97.39
2if4_A_1-166166 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.38
1kt0_A_1-257257 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.35
1u79_A_129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 96.99
1kt0_A_1-257257 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 96.48
1t11_A_121-151_258-392166 Trigger factor, TF; helix-turn-helix, four-helix-b 99.65
1q1c_A_280 FK506-binding protein 4; rotamase, TPR repeat, nuc 99.22
1w26_A_118-132_255-301_415-43280 Trigger factor, TF; chaperone, protein folding, ri 98.1
1w26_A_362-41453 Trigger factor, TF; chaperone, protein folding, ri 97.51
3gty_X_351-40353 Trigger factor, TF; chaperone-client complex, cell 92.88
1m5y_A_71-132_370-40093 SurviVal protein, surviVal protein SURA; surviVal 91.57
1q1c_A_280 FK506-binding protein 4; rotamase, TPR repeat, nuc 93.88
>1zxj_A (A:) MPN555, hypothetical protein Mg377 homolog; mostly alpha helical protein, TRI-lobal structure, structural genomics, PSI; 2.80A {Mycoplasma pneumoniae} Back     alignment and structure
Probab=99.97  E-value=1.7e-30  Score=262.64  Aligned_cols=206  Identities=9%  Similarity=0.066  Sum_probs=187.8

Q ss_pred             HCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEEEEEEHHHHHCCCCCCCCHHHHHHHC-CCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             206887887543323444444410003873046761011002467776747887502-3655789999998878999977
Q gi|254780897|r  210 ILVGLKTGDQKEIERFFPEDHSIKDLAGKKVRLNFSIKEVFSPLPVVVNNDLAVRLG-FESESAMRGLCSQKIKQHSEFL  288 (473)
Q Consensus       210 ~liG~k~Gd~~~~~~~~P~d~~~~~laGk~v~f~v~v~~I~~~~~pel~def~k~~~-~~t~~elk~~ik~~l~~~~~~~  288 (473)
                      +|+|||+||+++|+ +||+||+.+++|||++.|+|+|++|+++.+|++||+||++++ ++|+++||+.+++.|..++...
T Consensus         2 gLiG~k~Ge~~~~~-~~p~dy~~~~lagk~~~f~v~v~~I~~~~~pel~de~~~~~~~~~tv~e~k~~~~~~l~~~~~~~   80 (218)
T 1zxj_A            2 GSSHHHHHHDYDIP-TTENLYFQGHMATNLKSTAKLVKPIQYDEVIEVERIFADPAFIEQHRQRILASFKDAKESALYHE   80 (218)
T ss_dssp             ---------CCCC--------CCSSCC-CCSCEEEECSCCCTTSCEEECCSCCCHHHHHHHHHHHHTTCTTCCHHHHHHH
T ss_pred             CCCCCCCCCCCCCC-CCCCCCCCCCCHHHHCCCCEEEEEECCCCCCCCCHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             97644555678865-52346856310233157700210004566677788999872545568999999999999999999


Q ss_pred             H-----HHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             7-----77669999999986400347999999997767899999975348640011000134567789999999999999
Q gi|254780897|r  289 V-----RQKVKRQILDYISNKYTFDVPESLVENEYNGILQKVRFEMSSANQKSQNVDSIDEEDLQYYHMLAKRRVLTGIV  363 (473)
Q Consensus       289 ~-----~~~~~~~i~~~L~~~~~~~lPe~lv~~e~~~~~~~~~~~l~~~~~~~~~~~~~~e~~~~~~~~~Aek~vk~~li  363 (473)
                      .     ...+++++++.|++.++|++|+++|+++++++++++..+                ..++.++..|++++|++||
T Consensus        81 ~~~~~~~~~~~~~i~~~l~~~~~~~lpe~~i~~e~~~~~~~~~~~----------------~~~e~~~~~aek~lk~~li  144 (218)
T 1zxj_A           81 LTHIVIKDNLFSCAMNAIVGYFEFNIDEAELKNVMEGLKRDVIQG----------------AEDNTVQAIAEKIIKKALV  144 (218)
T ss_dssp             HHHHHHHHHHHHHHHHHHGGGEEEECCHHHHHHHHHHHHHC---------------------CCHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHH----------------HHHHHHHHHHHHHHHHHHH
T ss_conf             999999999999999999874888899999999999988999865----------------0136789999999999999


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHCEEEEEEE
Q ss_conf             9999864387428999999999999863999899999987099989999999999999999988535665531
Q gi|254780897|r  364 LGTIGEKNNIEVTEEEMQSALYQQLGRFPGHEKKMLDHFQKYPNALAELRAPIFEDKVIDHILKSVQIVDRKV  436 (473)
Q Consensus       364 l~~Ia~~e~I~vs~~Ei~~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~ile~Kv~d~l~~~a~i~ek~~  436 (473)
                      +++||+.++|+||++|+.+++.+++.+|+.++...    .++++.+.++++.++++|+++||+++|+++++..
T Consensus       145 l~~ia~~e~i~vt~eei~~~i~~~a~~~~~~~~~~----~~~~~~~~~i~~~l~~~Kv~~~l~~~a~v~~~~~  213 (218)
T 1zxj_A          145 FNHLQKEWKVEITDEVVKNVISLYYEKTNQSVREY----LDDKQKFEGVRTALLEERMVLETINHFKFHFNLT  213 (218)
T ss_dssp             HHHHHHHHTCCCCHHHHHHHHHHHHHHSCSCCHHH----HSCHHHHHHHHHHHHHHHHHHHHHHTCCEEECSS
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHH----HHCHHHHHHHHHHHHHHHHHHHHHHHHEEEECCC
T ss_conf             99999980899999999999999883378999999----9699999999999999999999998411400455



>1t11_A (A:1-120) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} Back     alignment and structure
>1p9y_A (A:) Trigger factor, TF; alpha-beta protein, isomerase; 2.15A {Escherichia coli} Back     alignment and structure
>1w26_A (A:1-117) Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} Back     alignment and structure
>3gty_X (X:1-108) Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>2d3o_1 (1:) Trigger factor, TF; ribosome, nascent chain, protein folding, SRP; 3.35A {Deinococcus radiodurans} PDB: 2aar_7 Back     alignment and structure
>2nsc_A (A:21-109) Trigger factor, TF; chaperone; 2.20A {Thermotoga maritima} PDB: 2nsb_A Back     alignment and structure
>2nsa_A (A:) Trigger factor, TF; chaperone; 1.70A {Thermotoga maritima} Back     alignment and structure
>1w26_A (A:133-254) Trigger factor, TF; chaperone, protein folding, ribosome associated protein, nascent chain, cell division, isomerase; 2.7A {Escherichia coli} Back     alignment and structure
>3gty_X (X:146-239) Trigger factor, TF; chaperone-client complex, cell cycle, cell division, chaperone, isomerase, rotamase, ribonucleoprotein; 3.40A {Thermotoga maritima} PDB: 3gu0_A Back     alignment and structure
>1hxv_A (A:) Trigger factor; FKBP fold, ppiase, chaperone; NMR {Mycoplasma genitalium} Back     alignment and structure
>1t11_A (A:152-257) Trigger factor, TF; helix-turn-helix, four-helix-bundle, ppiase, chaperone; 2.50A {Vibrio cholerae} Back     alignment and structure
>3cgm_A (A:1-64,A:121-158) SLYD, peptidyl-prolyl CIS-trans isomerase; chaperone function, two domain protein, rotamase; 2.41A {Thermus thermophilus} PDB: 3cgn_A Back     alignment and structure
>2kfw_A (A:1-70,A:125-196) FKBP-type peptidyl-prolyl CIS-trans isomerase SLYD; protein, cobalt, copper, cytoplasm, metal- binding, nickel, rotamase, zinc; NMR {Escherichia coli} Back     alignment and structure
>2k8i_A (A:1-69,A:125-171) SLYD, peptidyl-prolyl CIS-trans isomerase; ppiase, chaperone, rotamase; NMR {Escherichia coli} Back     alignment and structure
>1p5q_A (A:1-136) FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} Back     alignment and structure
>1ix5_A (A:1-82,A:135-151) FKBP; ppiase, isomerase; NMR {Methanothermococcusthermolithotrophicus} Back     alignment and structure
>2pbc_A (A:) FK506-binding protein 2; endoplasmic reticulum, isomerase, polymorphism, rotamase, structural genomics, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>2d9f_A (A:) FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vn1_A (A:) 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A Back     alignment and structure
>1jvw_A (A:) Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} Back     alignment and structure
>1yat_A (A:) FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2ppn_A (A:) FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} Back     alignment and structure
>1fd9_A (A:52-213) Protein (macrophage infectivity potentiator protein); FKBP domain, long alpha helix, dimerisation VIA helical interactions, isomerase; 2.41A {Legionella pneumophila} Back     alignment and structure
>1q6h_A (A:67-224) FKBP-type peptidyl-prolyl CIS-trans isomerase FKPA; chaperone, peptidyl-prolyl isomerase, heat shock protein, periplasm, FKBP family; HET: MSE; 1.97A {Escherichia coli} Back     alignment and structure
>1r9h_A (A:) FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} Back     alignment and structure
>2awg_A (A:) 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back