254780898

254780898

hypothetical protein CLIBASIA_03975

GeneID in NCBI database:8209918Locus tag:CLIBASIA_03975
Protein GI in NCBI database:254780898Protein Accession:YP_003065311.1
Gene range:-(874230, 874853)Protein Length:207aa
Gene description:hypothetical protein
COG prediction:[T] Protein tyrosine/serine phosphatase
KEGG prediction:hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM1 TM-Helix
TOPPRED1 TM-Helix
HMMTOP1 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMyes
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT
ccEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHEEcccccccEEEccccEEEcccccHHHHHHHHHHccccEEEEccccccccccHHHHHHHHHcccEEEEEEccccccccHHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHHHHHHccccccccccHHHHHHHHHHHccccccccccccccccc
ccEEcccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcccccccEcccccccHHHHHHHHHHcccEEEEEEcccccccccHHHHHHHHHcccEEEEEcccccccccHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHccccHHHHHHHccccEEEccccccHHHHHHHHHHHHHccccccccccccccccc
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTqnfhavvpheiyrsaqpngtFIEYLKKEYGIKSILNlrgklpeswHKEEEKAANDLGIQLinfplsatreLNDEQIKQLISILktapkpllihcksgadrtgLASAVYLYIVAHYPKEEAHRQLSMLyghfpvlktITMDITFEKITqlypnnvskgdteqpmnat
mikikkprkNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQlypnnvskgdteqpmnat
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT
********KN*LIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPM***
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSK**********
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVS***********
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT
MIKIKKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFEKITQLYPNNVSKGDTEQPMNAT

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
315122684207 hypothetical protein CKC_04680 [Candidatus Liberibacter 1 5e-59
206890973190 hypothetical protein THEYE_A0750 [Thermodesulfovibrio y 1 2e-36
222085806198 hypothetical protein Arad_2152 [Agrobacterium radiobact 1 1e-34
15888562195 hypothetical protein Atu8150 [Agrobacterium tumefaciens 1 1e-33
325293519186 tyrosine/serine protein phosphatase [Agrobacterium sp. 1 1e-32
325292592180 tyrosine/serine protein phosphatase [Agrobacterium sp. 1 3e-32
15889438186 tyrosine/serine protein phosphatase [Agrobacterium tume 1 4e-32
222147302191 tyrosine/serine protein phosphatase [Agrobacterium viti 1 3e-31
260576858191 protein tyrosine/serine phosphatase [Rhodobacter sp. SW 1 4e-31
260424450483 hypothetical protein Ctu_1p00750 [Cronobacter turicensi 1 1e-30
>gi|315122684|ref|YP_004063173.1| hypothetical protein CKC_04680 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 207 Back     alignment and organism information
 Score =  231 bits (588), Expect = 5e-59,   Method: Compositional matrix adjust.
 Identities = 108/201 (53%), Positives = 153/201 (76%)

Query: 5   KKPRKNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRSAQPNGTFIE 64
           KK ++N+ + +   LLG+ V+  + LGL+   +T++TQNFH +VP+E+YRSAQP G FIE
Sbjct: 5   KKLKQNIFLSFKISLLGLFVIFPIVLGLFCFILTSYTQNFHVIVPNELYRSAQPTGQFIE 64

Query: 65  YLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLISIL 124
            + +++GIKSILNLRG+  E W++EEE    +LGIQLINFP+ A++ELN+ +IK+LI IL
Sbjct: 65  TIWEKHGIKSILNLRGENNEPWYREEEMTIRNLGIQLINFPIPASKELNNAEIKKLIDIL 124

Query: 125 KTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITF 184
           + APKPLLIHCK+GADRTGLASA+YLY ++HYPK +A  QLS+ YGH P+    +MDITF
Sbjct: 125 RKAPKPLLIHCKAGADRTGLASALYLYSISHYPKYKASGQLSIFYGHIPLFGARSMDITF 184

Query: 185 EKITQLYPNNVSKGDTEQPMN 205
           EK T+ + N++   + +  +N
Sbjct: 185 EKYTKEFSNDLYIENAKHFLN 205


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|206890973|ref|YP_002248592.1| hypothetical protein THEYE_A0750 [Thermodesulfovibrio yellowstonii DSM 11347] Length = 190 Back     alignment and organism information
>gi|222085806|ref|YP_002544336.1| hypothetical protein Arad_2152 [Agrobacterium radiobacter K84] Length = 198 Back     alignment and organism information
>gi|15888562|ref|NP_354243.1| hypothetical protein Atu8150 [Agrobacterium tumefaciens str. C58] Length = 195 Back     alignment and organism information
>gi|325293519|ref|YP_004279383.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3] Length = 186 Back     alignment and organism information
>gi|325292592|ref|YP_004278456.1| tyrosine/serine protein phosphatase [Agrobacterium sp. H13-3] Length = 180 Back     alignment and organism information
>gi|15889438|ref|NP_355119.1| tyrosine/serine protein phosphatase [Agrobacterium tumefaciens str. C58] Length = 186 Back     alignment and organism information
>gi|222147302|ref|YP_002548259.1| tyrosine/serine protein phosphatase [Agrobacterium vitis S4] Length = 191 Back     alignment and organism information
>gi|260576858|ref|ZP_05844841.1| protein tyrosine/serine phosphatase [Rhodobacter sp. SW2] Length = 191 Back     alignment and organism information
>gi|260424450|ref|YP_003212651.1| hypothetical protein Ctu_1p00750 [Cronobacter turicensis z3032] Length = 483 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
KOG1572249 KOG1572, KOG1572, KOG1572, Predicted protein tyrosine p 8e-07
pfam03162150 pfam03162, Y_phosphatase2, Tyrosine phosphatase family 1e-05
KOG1720225 KOG1720, KOG1720, KOG1720, Protein tyrosine phosphatase 4e-04
COG3453130 COG3453, COG3453, Uncharacterized protein conserved in 0.001
COG2365249 COG2365, COG2365, Protein tyrosine/serine phosphatase [ 8e-14
PLN02727 986 PLN02727, PLN02727, NAD kinase 6e-05
>gnl|CDD|36785 KOG1572, KOG1572, KOG1572, Predicted protein tyrosine phosphatase [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|111998 pfam03162, Y_phosphatase2, Tyrosine phosphatase family Back     alignment and domain information
>gnl|CDD|36932 KOG1720, KOG1720, KOG1720, Protein tyrosine phosphatase CDC14 [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|33256 COG3453, COG3453, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|32512 COG2365, COG2365, Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|178328 PLN02727, PLN02727, NAD kinase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
pfam03162150 Y_phosphatase2 Tyrosine phosphatase family. This family 99.96
KOG1572249 consensus 99.84
COG2365249 Protein tyrosine/serine phosphatase [Signal transductio 99.78
COG3453130 Uncharacterized protein conserved in bacteria [Function 99.71
cd00127139 DSPc Dual specificity phosphatases (DSP); Ser/Thr and T 99.69
smart00195138 DSPc Dual specificity phosphatase, catalytic domain. 99.63
TIGR01244136 TIGR01244 conserved hypothetical protein TIGR01244; Int 99.62
PTZ00242172 protein tyrosine phosphatase; Provisional 99.62
pfam00782131 DSPc Dual specificity phosphatase, catalytic domain. Se 99.61
KOG1719183 consensus 99.56
PRK12361 546 hypothetical protein; Provisional 99.47
KOG1716285 consensus 99.39
pfam05706207 CDKN3 Cyclin-dependent kinase inhibitor 3 (CDKN3). This 99.32
KOG1718198 consensus 99.21
KOG1717343 consensus 99.13
KOG2836173 consensus 98.81
KOG2283 434 consensus 98.7
pfam00102234 Y_phosphatase Protein-tyrosine phosphatase. 98.66
smart00194258 PTPc Protein tyrosine phosphatase, catalytic domain. 98.65
cd00047231 PTPc Protein tyrosine phosphatases (PTP) catalyze the d 98.54
KOG2386 393 consensus 98.21
COG5350172 Predicted protein tyrosine phosphatase [General functio 97.75
KOG0791374 consensus 97.71
KOG07921144 consensus 97.65
KOG0789415 consensus 97.57
KOG42281087 consensus 97.17
TIGR02090371 LEU1_arch isopropylmalate/citramalate/homocitrate synth 92.94
KOG1720225 consensus 99.87
pfam04273110 DUF442 Putative phosphatase (DUF442). Although this dom 99.85
KOG07931004 consensus 96.96
cd01522117 RHOD_1 Member of the Rhodanese Homology Domain superfam 96.46
cd01518101 RHOD_YceA Member of the Rhodanese Homology Domain super 96.25
cd01533109 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain 96.22
cd01447103 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanes 95.77
cd0152799 RHOD_YgaP Member of the Rhodanese Homology Domain super 95.4
cd0144496 GlpE_ST GlpE sulfurtransferase (ST) and homologs are me 95.31
cd01528101 RHOD_2 Member of the Rhodanese Homology Domain superfam 95.22
PRK08762 379 molybdopterin biosynthesis protein MoeB; Validated 94.98
cd01526122 RHOD_ThiF Member of the Rhodanese Homology Domain super 94.97
PRK00162104 glpE thiosulfate sulfurtransferase; Validated 94.83
PRK08057241 cobalt-precorrin-6x reductase; Reviewed 94.58
cd01523100 RHOD_Lact_B Member of the Rhodanese Homology Domain sup 94.55
pfam02571246 CbiJ Precorrin-6x reductase CbiJ/CobK. This family cons 93.77
cd01449118 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-ter 93.38
cd01519106 RHOD_HSP67B2 Member of the Rhodanese Homology Domain su 93.31
cd0153495 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain 93.29
PRK07878392 molybdopterin biosynthesis-like protein MoeZ; Validated 92.04
cd0152490 RHOD_Pyr_redox Member of the Rhodanese Homology Domain 91.89
pfam00581106 Rhodanese Rhodanese-like domain. Rhodanese has an inter 91.62
PRK07411390 hypothetical protein; Validated 90.18
KOG1530136 consensus 90.07
COG2453180 CDC14 Predicted protein-tyrosine phosphatase [Signal tr 99.17
smart00404105 PTPc_motif Protein tyrosine phosphatase, catalytic doma 98.24
smart00012105 PTPc_DSPc Protein tyrosine phosphatase, catalytic domai 98.24
COG5599302 PTP2 Protein tyrosine phosphatase [Signal transduction 98.01
KOG4228 1087 consensus 97.58
KOG0790600 consensus 97.35
PRK10287104 thiosulfate:cyanide sulfurtransferase; Provisional 95.31
COG5016 472 Pyruvate/oxaloacetate carboxyltransferase [Energy produ 92.57
KOG4471 717 consensus 96.21
KOG1089 573 consensus 93.65
PRK05597355 molybdopterin biosynthesis protein MoeB; Validated 90.53
>pfam03162 Y_phosphatase2 Tyrosine phosphatase family Back     alignment and domain information
>KOG1572 consensus Back     alignment and domain information
>COG2365 Protein tyrosine/serine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>COG3453 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>cd00127 DSPc Dual specificity phosphatases (DSP); Ser/Thr and Tyr protein phosphatases Back     alignment and domain information
>smart00195 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>TIGR01244 TIGR01244 conserved hypothetical protein TIGR01244; InterPro: IPR005939 This is a family of largely hypothetical proteins of unknown function Back     alignment and domain information
>PTZ00242 protein tyrosine phosphatase; Provisional Back     alignment and domain information
>pfam00782 DSPc Dual specificity phosphatase, catalytic domain Back     alignment and domain information
>KOG1719 consensus Back     alignment and domain information
>PRK12361 hypothetical protein; Provisional Back     alignment and domain information
>KOG1716 consensus Back     alignment and domain information
>pfam05706 CDKN3 Cyclin-dependent kinase inhibitor 3 (CDKN3) Back     alignment and domain information
>KOG1718 consensus Back     alignment and domain information
>KOG1717 consensus Back     alignment and domain information
>KOG2836 consensus Back     alignment and domain information
>KOG2283 consensus Back     alignment and domain information
>pfam00102 Y_phosphatase Protein-tyrosine phosphatase Back     alignment and domain information
>smart00194 PTPc Protein tyrosine phosphatase, catalytic domain Back     alignment and domain information
>cd00047 PTPc Protein tyrosine phosphatases (PTP) catalyze the dephosphorylation of phosphotyrosine peptides; they regulate phosphotyrosine levels in signal transduction pathways Back     alignment and domain information
>KOG2386 consensus Back     alignment and domain information
>COG5350 Predicted protein tyrosine phosphatase [General function prediction only] Back     alignment and domain information
>KOG0791 consensus Back     alignment and domain information
>KOG0792 consensus Back     alignment and domain information
>KOG0789 consensus Back     alignment and domain information
>KOG4228 consensus Back     alignment and domain information
>TIGR02090 LEU1_arch isopropylmalate/citramalate/homocitrate synthases; InterPro: IPR011830 Methanogenic archaea contain three closely related homologs of the 2-isopropylmalate synthases (LeuA) represented by IPR005671 from INTERPRO Back     alignment and domain information
>KOG1720 consensus Back     alignment and domain information
>pfam04273 DUF442 Putative phosphatase (DUF442) Back     alignment and domain information
>KOG0793 consensus Back     alignment and domain information
>cd01522 RHOD_1 Member of the Rhodanese Homology Domain superfamily, subgroup 1 Back     alignment and domain information
>cd01518 RHOD_YceA Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01533 4RHOD_Repeat_2 Member of the Rhodanese Homology Domain superfamily, repeat 2 Back     alignment and domain information
>cd01447 Polysulfide_ST Polysulfide-sulfurtransferase - Rhodanese Homology Domain Back     alignment and domain information
>cd01527 RHOD_YgaP Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01444 GlpE_ST GlpE sulfurtransferase (ST) and homologs are members of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01528 RHOD_2 Member of the Rhodanese Homology Domain superfamily, subgroup 2 Back     alignment and domain information
>PRK08762 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information
>cd01526 RHOD_ThiF Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>PRK00162 glpE thiosulfate sulfurtransferase; Validated Back     alignment and domain information
>PRK08057 cobalt-precorrin-6x reductase; Reviewed Back     alignment and domain information
>cd01523 RHOD_Lact_B Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>pfam02571 CbiJ Precorrin-6x reductase CbiJ/CobK Back     alignment and domain information
>cd01449 TST_Repeat_2 Thiosulfate sulfurtransferase (TST), C-terminal, catalytic domain Back     alignment and domain information
>cd01519 RHOD_HSP67B2 Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>cd01534 4RHOD_Repeat_3 Member of the Rhodanese Homology Domain superfamily, repeat 3 Back     alignment and domain information
>PRK07878 molybdopterin biosynthesis-like protein MoeZ; Validated Back     alignment and domain information
>cd01524 RHOD_Pyr_redox Member of the Rhodanese Homology Domain superfamily Back     alignment and domain information
>pfam00581 Rhodanese Rhodanese-like domain Back     alignment and domain information
>PRK07411 hypothetical protein; Validated Back     alignment and domain information
>KOG1530 consensus Back     alignment and domain information
>COG2453 CDC14 Predicted protein-tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>smart00404 PTPc_motif Protein tyrosine phosphatase, catalytic domain motif Back     alignment and domain information
>smart00012 PTPc_DSPc Protein tyrosine phosphatase, catalytic domain, undefined specificity Back     alignment and domain information
>COG5599 PTP2 Protein tyrosine phosphatase [Signal transduction mechanisms] Back     alignment and domain information
>KOG4228 consensus Back     alignment and domain information
>KOG0790 consensus Back     alignment and domain information
>PRK10287 thiosulfate:cyanide sulfurtransferase; Provisional Back     alignment and domain information
>COG5016 Pyruvate/oxaloacetate carboxyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG4471 consensus Back     alignment and domain information
>KOG1089 consensus Back     alignment and domain information
>PRK05597 molybdopterin biosynthesis protein MoeB; Validated Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
1ohc_A348 Structure Of The Proline Directed Phosphatase Cdc14 1e-26
1ohe_A348 Structure Of Cdc14b Phosphatase With A Peptide Liga 2e-25
3nme_A 294 Structure Of A Plant Phosphatase Length = 294 6e-07
1d5r_A 324 Crystal Structure Of The Pten Tumor Suppressor Leng 2e-04
2rf6_A176 Crystal Structure Of The Vaccinia Virus Dual-Specif 0.004
1xri_A151 X-Ray Structure Of A Putative Phosphoprotein Phosph 4e-20
2img_A151 Crystal Structure Of Dual Specificity Protein Phosp 8e-12
2i6i_A161 Crystal Structures Of The Archaeal Sulfolobus Ptp-F 4e-11
2dxp_A161 Crystal Structure Of The Complex Of The Archaeal Su 5e-10
2f46_A156 Crystal Structure Of A Putative Phosphatase (Nma198 7e-10
3f81_A183 Interaction Of Vhr With Sa3 Length = 183 4e-07
1vhr_A184 Human Vh1-Related Dual-Specificity Phosphatase Leng 4e-07
2e0t_A151 Crystal Structure Of Catalytic Domain Of Dual Speci 1e-06
1j4x_A184 Human Vh1-Related Dual-Specificity Phosphatase C124 6e-06
1yn9_A169 Crystal Structure Of Baculovirus Rna 5'-Phosphatase 1e-05
2wgp_A190 Crystal Structure Of Human Dual Specificity Phospha 1e-05
2y96_A219 Structure Of Human Dual-Specificity Phosphatase 27 1e-05
1i9s_A210 Crystal Structure Of The Rna Triphosphatase Domain 1e-04
2c46_A241 Crystal Structure Of The Human Rna Guanylyltransfer 2e-04
2pq5_A205 Crystal Structure Of Dual Specificity Protein Phosp 2e-04
2gwo_A198 Crystal Structure Of Tmdp Length = 198 4e-04
1x24_A180 Prl-1 (Ptp4a) Length = 180 7e-04
3lj8_A146 Crystal Structure Of Mkp-4 Length = 146 7e-04
2esb_A188 Crystal Structure Of Human Dusp18 Length = 188 9e-04
1zck_A154 Native Structure Prl-1 (Ptp4a1) Length = 154 0.001
1rxd_A159 Crystal Structure Of Human Protein Tyrosine Phospha 0.002
2g6z_A211 Crystal Structure Of Human Dusp5 Length = 211 0.002
1fpz_A212 Crystal Structure Analysis Of Kinase Associated Pho 0.002
1v3a_A173 Structure Of Human Prl-3, The Phosphatase Associate 0.003
2q05_A195 Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FRO 0.003
1r6h_A172 Solution Structure Of Human Prl-3 Length = 172 0.003
2r0b_A154 Crystal Structure Of Human Tyrosine Phosphatase-Lik 0.004
2p4d_A172 Structure-Assisted Discovery Of Variola Major H1 Ph 0.004
1i9t_A210 Crystal Structure Of The Oxidized Rna Triphosphatas 0.004
>gi|34811073|pdb|1OHC|A Chain A, Structure Of The Proline Directed Phosphatase Cdc14 Length = 348 Back     alignment and structure
 Score =  123 bits (309), Expect = 1e-26,   Method: Composition-based stats.
 Identities = 27/186 (14%), Positives = 56/186 (30%), Gaps = 20/186 (10%)

Query: 9   KNLLIFYIKILLGVLVLCAVSLGLYFLTITTFTQNFHAVVPHEIYRS------------- 55
                    +  G L   + +L  Y         + + ++P                   
Sbjct: 143 DCFHAVKKAMQYGFLNFNSFNLDEYEHYEKAENGDLNWIIPDRFIAFCGPHSRARLESGY 202

Query: 56  AQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDE 115
            Q +        K + + +I+ L  ++       + K   D G    +   +      D 
Sbjct: 203 HQHSPETYIQYFKNHNVTTIIRLNKRM------YDAKRFTDAGFDHHDLFFADGSTPTDA 256

Query: 116 QIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM-LYGHFPV 174
            +K+ + I + A   + +HCK+G  RTG   A Y+         E    + +   G    
Sbjct: 257 IVKEFLDICENAEGAIAVHCKAGLGRTGTLIACYIMKHYRMTAAETIAWVRICRPGSVIG 316

Query: 175 LKTITM 180
            +   +
Sbjct: 317 PQQQFL 322


>gi|34811075|pdb|1OHE|A Chain A, Structure Of Cdc14b Phosphatase With A Peptide Ligand Length = 348 Back     alignment and structure
>gi|302566226|pdb|3NME|A Chain A, Structure Of A Plant Phosphatase Length = 294 Back     alignment and structure
>gi|6573673|pdb|1D5R|A Chain A, Crystal Structure Of The Pten Tumor Suppressor Length = 324 Back     alignment and structure
>gi|208435537|pdb|2RF6|A Chain A, Crystal Structure Of The Vaccinia Virus Dual-Specificity Phosphatase Vh1 Length = 176 Back     alignment and structure
>gi|56554689|pdb|1XRI|A Chain A, X-Ray Structure Of A Putative Phosphoprotein Phosphatase From Arabidopsis Thaliana Gene At1g05000 Length = 151 Back     alignment and structure
>gi|118138468|pdb|2IMG|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 23 From Homo Sapiens In Complex With Ligand Malate Ion Length = 151 Back     alignment and structure
gi|145579561|pdb|2I6I|A Chain A, Crystal Structures Of The Archaeal Sulfolobus Ptp-Fold Phosphatase Length = 161 Back     alignment and structure
>gi|145579198|pdb|2DXP|A Chain A, Crystal Structure Of The Complex Of The Archaeal Sulfolobus Ptp-Fold Phosphatase With Phosphopeptides A-(P)y-R Length = 161 Back     alignment and structure
>gi|90109268|pdb|2F46|A Chain A, Crystal Structure Of A Putative Phosphatase (Nma1982) From Neisseria Meningitidis Z2491 At 1.41 A Resolution Length = 156 Back     alignment and structure
>gi|266618532|pdb|3F81|A Chain A, Interaction Of Vhr With Sa3 Length = 183 Back     alignment and structure
>gi|1633321|pdb|1VHR|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase Length = 184 Back     alignment and structure
>gi|158428219|pdb|2E0T|A Chain A, Crystal Structure Of Catalytic Domain Of Dual Specificity Phosphatase 26, Ms0830 From Homo Sapiens Length = 151 Back     alignment and structure
>gi|18158941|pdb|1J4X|A Chain A, Human Vh1-Related Dual-Specificity Phosphatase C124s Mutant- Peptide Complex Length = 184 Back     alignment and structure
>gi|61680736|pdb|1YN9|A Chain A, Crystal Structure Of Baculovirus Rna 5'-Phosphatase Complexed With Phosphate Length = 169 Back     alignment and structure
>gi|260656120|pdb|2WGP|A Chain A, Crystal Structure Of Human Dual Specificity Phosphatase 14 Length = 190 Back     alignment and structure
>gi|330689320|pdb|2Y96|A Chain A, Structure Of Human Dual-Specificity Phosphatase 27 Length = 219 Back     alignment and structure
>gi|14488778|pdb|1I9S|A Chain A, Crystal Structure Of The Rna Triphosphatase Domain Of Mouse Mrna Capping Enzyme Length = 210 Back     alignment and structure
>gi|83754630|pdb|2C46|A Chain A, Crystal Structure Of The Human Rna Guanylyltransferase And 5'-Phosphatase Length = 241 Back     alignment and structure
>gi|149243333|pdb|2PQ5|A Chain A, Crystal Structure Of Dual Specificity Protein Phosphatase 13 (Dusp13) Length = 205 Back     alignment and structure
gi|145579467|pdb|2GWO|A Chain A, Crystal Structure Of Tmdp Length = 198 Back     alignment and structure
>gi|82407409|pdb|1X24|A Chain A, Prl-1 (Ptp4a) Length = 180 Back     alignment and structure
>gi|315583477|pdb|3LJ8|A Chain A, Crystal Structure Of Mkp-4 Length = 146 Back     alignment and structure
gi|109157500|pdb|2ESB|A Chain A, Crystal Structure Of Human Dusp18 Length = 188 Back     alignment and structure
>gi|78101048|pdb|1ZCK|A Chain A, Native Structure Prl-1 (Ptp4a1) Length = 154 Back     alignment and structure
>gi|58176681|pdb|1RXD|A Chain A, Crystal Structure Of Human Protein Tyrosine Phosphatase 4a1 Length = 159 Back     alignment and structure
>gi|126030527|pdb|2G6Z|A Chain A, Crystal Structure Of Human Dusp5 Length = 211 Back     alignment and structure
>gi|14277889|pdb|1FPZ|A Chain A, Crystal Structure Analysis Of Kinase Associated Phosphatase (Kap) With A Substitution Of The Catalytic Site Cysteine (Cys140) To A Serine Length = 212 Back     alignment and structure
gi|56554252|pdb|1V3A|A Chain A, Structure Of Human Prl-3, The Phosphatase Associated With Cancer Metastasis Length = 173 Back     alignment and structure
>gi|150261421|pdb|2Q05|A Chain A, Crystal Structure Of TyrSER PROTEIN PHOSPHATASE FROM Vaccinia Virus Wr Length = 195 Back     alignment and structure
>gi|253723087|pdb|1R6H|A Chain A, Solution Structure Of Human Prl-3 Length = 172 Back     alignment and structure
>gi|158430537|pdb|2R0B|A Chain A, Crystal Structure Of Human Tyrosine Phosphatase-Like SerineTHREONINETYROSINE-Interacting Protein Length = 154 Back     alignment and structure
>gi|149242877|pdb|2P4D|A Chain A, Structure-Assisted Discovery Of Variola Major H1 Phosphatase Inhibitors Length = 172 Back     alignment and structure
>gi|14488779|pdb|1I9T|A Chain A, Crystal Structure Of The Oxidized Rna Triphosphatase Domain Of Mouse Mrna Capping Enzyme Length = 210 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual specific 7e-15
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, structur 1e-14
1xri_A151 AT1G05000; structural genomics, protein structure initi 1e-12
2f46_A156 Hypothetical protein; 7380613, DUF442, structural genom 8e-12
2img_A151 Dual specificity protein phosphatase 23; DUSP23, VHZ, L 6e-10
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine phosph 3e-08
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sandwic 8e-08
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, cell 1e-07
1zcl_A180 Protein tyrosine phosphatase 4A1; PRL-1 PTP4A dual spec 9e-07
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, prot 4e-06
2e0t_A151 Dual specificity phosphatase 26; conserved hypothetical 1e-05
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; protei 8e-05
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four stranded 9e-05
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase, dua 1e-04
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUSP14, 3e-04
2r0b_A154 Serine/threonine/tyrosine-interacting protein; structur 4e-04
2hxp_A155 Dual specificity protein phosphatase 9; human phosphata 7e-04
2c46_A241 MRNA capping enzyme; guanylyltransferase, phosphatase, 8e-04
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta, hyd 0.001
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/beta hyd 0.002
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydrolase, 0.002
2pt0_A340 MYO-inositol hexaphosphate phosphohydrolase; PTP, prote 2e-08
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphatase, i 4e-04
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphatase, i 0.002
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Length = 294 Back     alignment and structure
 Score = 75.7 bits (186), Expect = 7e-15
 Identities = 25/134 (18%), Positives = 46/134 (34%), Gaps = 13/134 (9%)

Query: 43  NFHAVVPHEIYRSAQP-NGTFIEYLKKEYGIKSILNLRGKLPES-----WHKEEEKAAND 96
           N++ + P  +   +       ++ L+K  G+K+I  L+               +  A   
Sbjct: 12  NYNFIRPD-LIVGSCLQTPEDVDKLRK-IGVKTIFCLQQDPDLEYFGVDISSIQAYAKKY 69

Query: 97  LGIQLINFPLSAT-----RELNDEQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYLY 151
             IQ I   +        R      +  L   +K       +H  +G  R    +  Y++
Sbjct: 70  SDIQHIRCEIRDFDAFDLRMRLPAVVGTLYKAVKRNGGVTYVHSTAGMGRAPAVALTYMF 129

Query: 152 IVAHYPKEEAHRQL 165
            V  Y   EAH+ L
Sbjct: 130 WVQGYKLMEAHKLL 143


>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Length = 157 Back     alignment and structure
>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics, phosphoprotein phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Length = 151 Back     alignment and structure
>2f46_A Hypothetical protein; 7380613, DUF442, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Length = 156 Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Length = 151 Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 2i6o_A* 2dxp_A* 2i6p_A* Length = 161 Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Length = 212 Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Length = 348 Back     alignment and structure
>1zcl_A Protein tyrosine phosphatase 4A1; PRL-1 PTP4A dual specific phosphatase, hydrolase; 2.90A {Rattus norvegicus} PDB: 1x24_A Length = 180 Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Length = 183 Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA; 1.67A {Homo sapiens} Length = 151 Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Length = 159 Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Length = 296 Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Length = 205 Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specificity phosphatase; 1.88A {Homo sapiens} Length = 190 Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Length = 154 Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 1mkp_A Length = 155 Back     alignment and structure
>2c46_A MRNA capping enzyme; guanylyltransferase, phosphatase, transferase, alternative splicing, hydrolase, mRNA processing, multifunctional enzyme; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Length = 241 Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Length = 211 Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Length = 145 Back     alignment and structure
>2pt0_A MYO-inositol hexaphosphate phosphohydrolase; PTP, protein tyrosine phosphatase, phytase, P-loop, cysteine-sulfonic acid, oxidized thiol.; 1.70A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 2psz_A 3d1h_A 3d1o_A 3d1q_A 1u24_A 1u25_A* 1u26_A* 2b4o_A 2b4p_A 2b4u_A Length = 340 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Length = 629 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, structur 99.96
1xri_A151 AT1G05000; structural genomics, protein structure initi 99.95
2f46_A156 Hypothetical protein; 7380613, DUF442, structural genom 99.93
2i6j_A161 Ssoptp, sulfolobus solfataricus protein tyrosine phosph 99.92
2img_A151 Dual specificity protein phosphatase 23; DUSP23, VHZ, L 99.91
3f81_A183 Dual specificity protein phosphatase 3; hydrolase, prot 99.85
3nme_A 294 Ptpkis1 protein, SEX4 glucan phosphatase; dual specific 99.82
1zcl_A180 Protein tyrosine phosphatase 4A1; PRL-1 PTP4A dual spec 99.77
2c46_A241 MRNA capping enzyme; guanylyltransferase, phosphatase, 99.77
1ywf_A296 Phosphotyrosine protein phosphatase PTPB; four stranded 99.76
2hcm_A164 Dual specificity protein phosphatase; structural genomi 99.74
1rxd_A159 Protein tyrosine phosphatase type IVA, member 1; protei 99.73
2esb_A188 Dual specificity protein phosphatase 18; alpha/beta str 99.72
2oud_A177 Dual specificity protein phosphatase 10; A central five 99.72
1zzw_A149 Dual specificity protein phosphatase 10; MKP, PTP, hydr 99.71
1wrm_A165 Dual specificity phosphatase 22; DSP, JNK, hydrolase; H 99.7
1yz4_A160 DUSP15, dual specificity phosphatase-like 15 isoform A; 99.7
2r0b_A154 Serine/threonine/tyrosine-interacting protein; structur 99.7
3ezz_A144 Dual specificity protein phosphatase 4; alpha/beta, hyd 99.68
2hxp_A155 Dual specificity protein phosphatase 9; human phosphata 99.68
2nt2_A145 Protein phosphatase slingshot homolog 2; alpha/beta hyd 99.65
2g6z_A211 Dual specificity protein phosphatase 5; alpha/beta, hyd 99.64
2q05_A195 Late protein H1, dual specificity protein phosphatase; 99.63
3cm3_A176 Late protein H1, dual specificity protein phosphatase; 99.61
2j16_A182 SDP-1, tyrosine-protein phosphatase YIL113W; hydrolase, 99.53
1d5r_A 324 Phosphoinositide phosphotase PTEN; C2 domain, phosphoti 99.46
3n0a_A 361 Tyrosine-protein phosphatase auxilin; phosphatase-like 99.18
3f41_A 629 Phytase; tandem repeat, protein tyrosine phosphatase, i 99.16
1zc0_A309 Tyrosine-protein phosphatase, non-receptor type 7; hept 98.63
2oc3_A303 Tyrosine-protein phosphatase non-receptor type 18; prot 98.6
2hc1_A291 Receptor-type tyrosine-protein phosphatase beta; protei 98.58
3i36_A342 Vascular protein tyrosine phosphatase 1; PTP, hydrolase 98.57
3m4u_A306 Tyrosine specific protein phosphatase, putative; protei 98.57
2i75_A320 Tyrosine-protein phosphatase non-receptor type 4; PTPN4 98.56
1yfo_A302 D1, receptor protein tyrosine phosphatase alpha; hydrol 98.55
2gjt_A295 Receptor-type tyrosine-protein phosphatase PTPro; tyros 98.53
1lyv_A306 Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1. 98.53
1g4w_R383 Protein tyrosine phosphatase SPTP; virulence factor, GT 98.53
1wch_A315 Protein tyrosine phosphatase, non-receptor type 13; hyd 98.52
2b3o_A532 Tyrosine-protein phosphatase, non-receptor type 6; prot 98.51
1fpr_A284 Protein-tyrosine phosphatase 1C; protein tyrosine phosp 98.49
2p6x_A309 Tyrosine-protein phosphatase non-receptor type 22; tyro 98.49
2shp_A525 SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin sign 98.48
2cjz_A305 Human protein tyrosine phosphatase PTPN5; protein phosp 98.47
2b49_A287 Protein tyrosine phosphatase, non-receptor type 3; huma 98.45
3b7o_A316 Tyrosine-protein phosphatase non-receptor type 11; SHP2 98.45
2bzl_A325 Tyrosine-protein phosphatase, non-receptor type 14; PTP 98.4
2pa5_A314 Tyrosine-protein phosphatase non-receptor type 9; prote 98.38
2h4v_A320 Receptor-type tyrosine-protein phosphatase gamma; tyros 98.36
1lar_A575 Protein (LAR); tyrosine phosphatease, LAR protein, hydr 98.34
2jjd_A599 Receptor-type tyrosine-protein phosphatase epsilon; tra 98.33
1l8k_A314 T-cell protein-tyrosine phosphatase; hydrolase; 2.56A { 98.33
1ygr_A610 CD45 protein tyrosine phosphatase; protein tyrosine pho 98.32
1jln_A297 STEP-like ptpase, protein tyrosine phosphatase, recepto 98.3
2ooq_A286 Receptor-type tyrosine-protein phosphatase T; protein t 98.3
2cm2_A304 Tyrosine-protein phosphatase non-receptor type 1; polym 98.24
2jjd_A 599 Receptor-type tyrosine-protein phosphatase epsilon; tra 98.17
1lar_A 575 Protein (LAR); tyrosine phosphatease, LAR protein, hydr 98.16
1p15_A253 Protein-tyrosine phosphatase alpha; transmembrane, hydr 98.1
2i1y_A301 Receptor-type tyrosine-protein phosphatase; receptor-ty 98.04
2nlk_A 627 Protein tyrosine phosphatase, receptor type, G variant 98.0
3d1p_A139 Putative thiosulfate sulfurtransferase YOR285W; atomic 91.59
1ohe_A348 CDC14B, CDC14B2 phosphatase; protein phosphatase, cell 99.96
2e0t_A151 Dual specificity phosphatase 26; conserved hypothetical 99.79
1fpz_A212 Cyclin-dependent kinase inhibitor 3; alpha-beta sandwic 99.77
2pq5_A205 Dual specificity protein phosphatase 13; hydrolase, dua 99.75
3emu_A161 Leucine rich repeat and phosphatase domain containing p 99.7
2wgp_A190 Dual specificity protein phosphatase 14; MKP6, DUSP14, 99.68
2pt0_A340 MYO-inositol hexaphosphate phosphohydrolase; PTP, prote 99.57
1yn9_A169 BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, 99.68
3f41_A629 Phytase; tandem repeat, protein tyrosine phosphatase, i 99.32
1ygr_A 610 CD45 protein tyrosine phosphatase; protein tyrosine pho 98.48
1lw3_A 657 Myotubularin-related protein 2; protein-phosphate compl 94.97
1zsq_A 528 Myotubularin-related protein 2; protein-phospholipid co 94.67
2nlk_A627 Protein tyrosine phosphatase, receptor type, G variant 98.23
1ohe_A 348 CDC14B, CDC14B2 phosphatase; protein phosphatase, cell 96.17
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
Probab=99.96  E-value=8.3e-28  Score=194.04  Aligned_cols=123  Identities=18%  Similarity=0.307  Sum_probs=109.1

Q ss_pred             HHCCCCCCCCCCEEECCCCCHHHHHHHHHHCCCCEEEECCCCCCCCCCHHHHHHHHHCCCEEEEEECCCCCCCCHHHHHH
Q ss_conf             60787250289477138999899999999749938997378787654445799999669849987526888989899999
Q gi|254780898|r   40 FTQNFHAVVPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQ  119 (207)
Q Consensus        40 ~~~Nf~~V~~g~lyRS~qP~~~~~~~l~k~~GIktIInLr~~~~~~~~~~e~~~~~~~gi~~i~ip~~~~~~~~~~~i~~  119 (207)
                      -..||++|.|+ ||||+||+++++..+ +++|||||||||++.+.+.+..+.+.|++.||+++++|+ +...|+++++..
T Consensus        11 ~~~~~~~~~p~-l~~sgqP~~~dl~~L-~~~GiktVInLr~~~e~~~~~~e~~~~~~~Gi~~~~iPv-~~~~p~~e~v~~   87 (157)
T 3gxh_A           11 GIRALQQQAPQ-LLSSGLPNEQQFSLL-KQAGVDVVINLMPDSSKDAHPDEGKLVTQAGMDYVYIPV-DWQNPKVEDVEA   87 (157)
T ss_dssp             TSTTCEEEETT-EEEEBCCCHHHHHHH-HHTTCCEEEECSCTTSTTSCTTHHHHHHHTTCEEEECCC-CTTSCCHHHHHH
T ss_pred             CCCCHHHHCCC-CEECCCCCHHHHHHH-HHCCCCEEEECCCCCCCCCCCCHHHHHHHCCCCEEECCC-CCCCCCHHHHHH
T ss_conf             26008872844-212589899999999-986998999898766456652588999972970475788-667959999999


Q ss_pred             HHHHHHCCC-CCEEEECCCCCCHHHHHHHHHHHHHCCCCHHHHHHHHHH
Q ss_conf             999994279-949998289988899999999999839998999996100
Q gi|254780898|r  120 LISILKTAP-KPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSM  167 (207)
Q Consensus       120 ~~~il~~~~-~PVlVHC~aG~~RTG~~~alyli~~~g~~~~eA~~el~~  167 (207)
                      +.+++++.+ +||||||++|. |||++++||++. +|++.++|.....+
T Consensus        88 ~~~~i~~~~~~pVlVHC~sG~-R~g~~~~ly~~~-~g~~~~~a~~~~~~  134 (157)
T 3gxh_A           88 FFAAMDQHKGKDVLVHCLANY-RASAFAYLYQLK-QGQNPNMAQTMTPW  134 (157)
T ss_dssp             HHHHHHHTTTSCEEEECSBSH-HHHHHHHHHHHH-TTCCCCHHHHTGGG
T ss_pred             HHHHHHHCCCCCEEEECCCCC-HHHHHHHHHHHH-CCCCHHHHHHHHHH
T ss_conf             999998636994898879998-199999999998-29999999999870



>1xri_A AT1G05000; structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics, phosphoprotein phosphatase; 3.30A {Arabidopsis thaliana} SCOP: c.45.1.1 PDB: 2q47_A Back     alignment and structure
>2f46_A Hypothetical protein; 7380613, DUF442, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.41A {Neisseria meningitidis Z2491} Back     alignment and structure
>2i6j_A Ssoptp, sulfolobus solfataricus protein tyrosine phosphatase; PTP domain, hydrolase; 1.66A {Sulfolobus solfataricus} PDB: 2i6i_A 2i6m_A 2i6o_A* 2dxp_A* 2i6p_A* Back     alignment and structure
>2img_A Dual specificity protein phosphatase 23; DUSP23, VHZ, LDP-3, dual specicity protein phosphatase 23, DUS23_human, malate, structural genomics, PSI; 1.93A {Homo sapiens} Back     alignment and structure
>3f81_A Dual specificity protein phosphatase 3; hydrolase, protein dual-specificity phosphatase, inhibitor; HET: STT; 1.90A {Homo sapiens} PDB: 1vhr_A* 1j4x_A* Back     alignment and structure
>3nme_A Ptpkis1 protein, SEX4 glucan phosphatase; dual specificity phosphatase, carbohydrate BIND hydrolase; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>1zcl_A Protein tyrosine phosphatase 4A1; PRL-1 PTP4A dual specific phosphatase, hydrolase; 2.90A {Rattus norvegicus} PDB: 1x24_A Back     alignment and structure
>2c46_A MRNA capping enzyme; guanylyltransferase, phosphatase, transferase, alternative splicing, hydrolase, mRNA processing, multifunctional enzyme; 1.6A {Homo sapiens} PDB: 1i9s_A 1i9t_A Back     alignment and structure
>1ywf_A Phosphotyrosine protein phosphatase PTPB; four stranded parallel beta sheet with flanking helices, structural genomics, PSI; 1.71A {Mycobacterium tuberculosis} SCOP: c.45.1.5 PDB: 2oz5_A* Back     alignment and structure
>2hcm_A Dual specificity protein phosphatase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Mus musculus} Back     alignment and structure
>1rxd_A Protein tyrosine phosphatase type IVA, member 1; protein tyrosine phosphatase IVA1...; structural genomics, NYSGXRC, unknown function, PSI; 1.90A {Homo sapiens} SCOP: c.45.1.1 PDB: 1xm2_A 1zck_A 1r6h_A 1v3a_A Back     alignment and structure
>2esb_A Dual specificity protein phosphatase 18; alpha/beta structure, hydrolase; HET: EPE; 2.00A {Homo sapiens} Back     alignment and structure
>2oud_A Dual specificity protein phosphatase 10; A central five-stranded B-sheet, hydrolase; 2.80A {Homo sapiens} Back     alignment and structure
>1zzw_A Dual specificity protein phosphatase 10; MKP, PTP, hydrolase; 1.60A {Homo sapiens} Back     alignment and structure
>1wrm_A Dual specificity phosphatase 22; DSP, JNK, hydrolase; HET: MES; 1.50A {Homo sapiens} Back     alignment and structure
>1yz4_A DUSP15, dual specificity phosphatase-like 15 isoform A; hydrolase; HET: BOG; 2.40A {Homo sapiens} Back     alignment and structure
>2r0b_A Serine/threonine/tyrosine-interacting protein; structural genomics, phosphatase, PSI-2, protein structure initiative; 1.60A {Homo sapiens} Back     alignment and structure
>3ezz_A Dual specificity protein phosphatase 4; alpha/beta, hydrolase, nucleus; 2.90A {Homo sapiens} PDB: 1m3g_A Back     alignment and structure
>2hxp_A Dual specificity protein phosphatase 9; human phosphatase, structural genomics, PSI-2, protein structure initiative; 1.83A {Homo sapiens} PDB: 1mkp_A Back     alignment and structure
>2nt2_A Protein phosphatase slingshot homolog 2; alpha/beta hydrolase; 2.10A {Homo sapiens} Back     alignment and structure
>2g6z_A Dual specificity protein phosphatase 5; alpha/beta, hydrolase; 2.70A {Homo sapiens} Back     alignment and structure
>2q05_A Late protein H1, dual specificity protein phosphatase; structural genomics, APC7320, PSI-2, protein structure initiative; HET: MSE; 2.57A {Vaccinia virus WR} Back     alignment and structure
>3cm3_A Late protein H1, dual specificity protein phosphatase; dual-specificity phosphatase, VH1, hydrolase; 1.32A {Vaccinia virus} PDB: 2rf6_A 2p4d_A Back     alignment and structure
>1d5r_A Phosphoinositide phosphotase PTEN; C2 domain, phosphotidylinositol, hydrolase; HET: TLA; 2.10A {Homo sapiens} SCOP: b.7.1.1 c.45.1.1 Back     alignment and structure
>3n0a_A Tyrosine-protein phosphatase auxilin; phosphatase-like domain, C2 domain, hydrolase; 2.20A {Bos taurus} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1zc0_A Tyrosine-protein phosphatase, non-receptor type 7; heptp, human tyrosine phosphatase catalytic domain, LC-PTP, PTPN7, hydrolase; 1.85A {Homo sapiens} PDB: 2gp0_A 2qdc_A 2hvl_A 2qdp_A 2qdm_A 3d44_A* 3d42_A* 2a3k_A Back     alignment and structure
>2oc3_A Tyrosine-protein phosphatase non-receptor type 18; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; 1.50A {Homo sapiens} Back     alignment and structure
>2hc1_A Receptor-type tyrosine-protein phosphatase beta; protein tyrosine phosphatase, WPD-loop, sulfamic acid, inhibitor, drug design, hydrolase; 1.30A {Homo sapiens} PDB: 2h03_A 2hc2_A 2i4g_A* 2h04_A* 2h02_A 2i3u_A 2i3r_A 2i4e_A* 2i4h_A* 2i5x_A* 2ahs_A Back     alignment and structure
>3i36_A Vascular protein tyrosine phosphatase 1; PTP, hydrolase; 1.84A {Rattus norvegicus} PDB: 2nz6_A 2cfv_A Back     alignment and structure
>3m4u_A Tyrosine specific protein phosphatase, putative; protein tyrosine phosphatase, hydrolase; 2.39A {Trypanosoma brucei} Back     alignment and structure
>2i75_A Tyrosine-protein phosphatase non-receptor type 4; PTPN4, PTP, tyrosine phosphatase, MEG-1, structural genomics, structural genomics consortium, SGC; 2.45A {Homo sapiens} Back     alignment and structure
>1yfo_A D1, receptor protein tyrosine phosphatase alpha; hydrolase, signal transduction, glycoprotein, phosphorylation, signal; 2.25A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2gjt_A Receptor-type tyrosine-protein phosphatase PTPro; tyrosine phosphatase, glepp1, PTPU2, structural genomics, structural genomics consortium, SGC; 2.15A {Homo sapiens} PDB: 2g59_A 2pi7_A Back     alignment and structure
>1lyv_A Protein-tyrosine phosphatase YOPH; toxin, hydrolase; 1.36A {Yersinia enterocolitica} SCOP: c.45.1.2 PDB: 1qz0_A* 1ytn_A 1ytw_A 2i42_A 1xxp_A* 3blu_A* 1ypt_A* 3blt_A* 1xxv_A* 3f9b_A 3f9a_A 3f99_A 3bm8_A* 1pa9_A* 1yts_A Back     alignment and structure
>1g4w_R Protein tyrosine phosphatase SPTP; virulence factor, GTPase activating protein, 4-helix bundle, disorder, signaling protein; 2.20A {Salmonella typhimurium} SCOP: a.24.11.1 c.45.1.2 PDB: 1g4u_S Back     alignment and structure
>1wch_A Protein tyrosine phosphatase, non-receptor type 13; hydrolase, phosphate ION, colorectal cancer alternative splicing, coiled coil, cytoskeleton; 1.85A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>2b3o_A Tyrosine-protein phosphatase, non-receptor type 6; protein tyrosine phosphatase, SHP-1, signaling, hydrolase; 2.80A {Homo sapiens} PDB: 1x6c_A 2rmx_A* 2yu7_A* Back     alignment and structure
>1fpr_A Protein-tyrosine phosphatase 1C; protein tyrosine phosphatase, substrate specificity, residue shift, signaling protein; HET: PTR; 2.50A {Homo sapiens} SCOP: c.45.1.2 PDB: 1gwz_A Back     alignment and structure
>2p6x_A Tyrosine-protein phosphatase non-receptor type 22; tyrosine phosphatase, lymphoid phosphatase, PEP, LYP, structural genomics; 1.90A {Homo sapiens} PDB: 3h2x_A 3brh_A 2qct_A* 2qcj_A* Back     alignment and structure
>2shp_A SHP-2, SYP, SHPTP-2; tyrosine phosphatase, insulin signaling, SH2 protein; HET: CAT; 2.00A {Homo sapiens} SCOP: c.45.1.2 d.93.1.1 d.93.1.1 PDB: 1aya_A* 1ayb_A* 1ayc_A* 1ayd_A Back     alignment and structure
>2cjz_A Human protein tyrosine phosphatase PTPN5; protein phosphatase, STEP, hydrolase; HET: PTR; 1.7A {Homo sapiens} PDB: 2bij_A 2bv5_A* Back     alignment and structure
>2b49_A Protein tyrosine phosphatase, non-receptor type 3; human, structural genomics, structural genomics consortium, SGC, hydrolase; 1.54A {Homo sapiens} Back     alignment and structure
>3b7o_A Tyrosine-protein phosphatase non-receptor type 11; SHP2, PTPN11, tyrosine phosphatase, structural genomics, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 3jrl_A* 3o5x_A* Back     alignment and structure
>2bzl_A Tyrosine-protein phosphatase, non-receptor type 14; PTPN14, hydrolase; 1.65A {Homo sapiens} Back     alignment and structure
>2pa5_A Tyrosine-protein phosphatase non-receptor type 9; protein tyrosine phosphatase, MEG2, PTPN9, structural genomics, structural genomics consortium; 1.60A {Homo sapiens} Back     alignment and structure
>2h4v_A Receptor-type tyrosine-protein phosphatase gamma; tyrosine receptor phosphatase, human, structural genomics, structural genomics consortium, SGC; HET: FLC; 1.55A {Homo sapiens} PDB: 2pbn_A 2hy3_A Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilon; transmembrane, phosphoprotein, alternative splicing, consortium, structural, glycoprotein, SGC; 3.20A {Homo sapiens} Back     alignment and structure
>1l8k_A T-cell protein-tyrosine phosphatase; hydrolase; 2.56A {Homo sapiens} SCOP: c.45.1.2 Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1jln_A STEP-like ptpase, protein tyrosine phosphatase, receptor type, R; PTP-SL, PTPBR7, ERK2-MAP kinase regulation, hydrolase; 1.81A {Mus musculus} SCOP: c.45.1.2 PDB: 2a8b_A Back     alignment and structure
>2ooq_A Receptor-type tyrosine-protein phosphatase T; protein tyrosine phosphatase, human, structural genomics, structural genomics consortium, SGC; HET: B3P; 1.80A {Homo sapiens} PDB: 1rpm_A 2c7s_A Back     alignment and structure
>2cm2_A Tyrosine-protein phosphatase non-receptor type 1; polymorphism, phosphorylation, endoplasmic reticulum, oxidation, hydrolase, acetylation; 1.5A {Homo sapiens} SCOP: c.45.1.2 PDB: 2cm3_A 2cmb_A* 2cmc_A* 2cne_A* 3a5j_A 2cma_A 3a5k_A 3eu0_A 2azr_A* 2b07_A* 2h4g_A* 2h4k_A* 2hb1_A* 2qbp_A* 2qbq_A* 2qbr_A* 2qbs_A* 2zmm_A* 2zn7_A* 2f71_A* ... Back     alignment and structure
>2jjd_A Receptor-type tyrosine-protein phosphatase epsilon; transmembrane, phosphoprotein, alternative splicing, consortium, structural, glycoprotein, SGC; 3.20A {Homo sapiens} Back     alignment and structure
>1lar_A Protein (LAR); tyrosine phosphatease, LAR protein, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.2 c.45.1.2 PDB: 2fh7_A 2nv5_A Back     alignment and structure
>1p15_A Protein-tyrosine phosphatase alpha; transmembrane, hydrolase, phosphorylation; 2.00A {Mus musculus} SCOP: c.45.1.2 Back     alignment and structure
>2i1y_A Receptor-type tyrosine-protein phosphatase; receptor-type protein tyrosine phosphatase precursor, structural genomics, PSI; 2.23A {Homo sapiens} PDB: 2qep_A Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G variant (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1249, HPTPG, RPTPG; 2.40A {Homo sapiens} Back     alignment and structure
>3d1p_A Putative thiosulfate sulfurtransferase YOR285W; atomic structure, atomic resolution structure, PSI, MCSG; HET: MSE; 0.98A {Saccharomyces cerevisiae} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure
>2e0t_A Dual specificity phosphatase 26; conserved hypothetical protein, structural genomics, NPPSFA; 1.67A {Homo sapiens} Back     alignment and structure
>1fpz_A Cyclin-dependent kinase inhibitor 3; alpha-beta sandwich, hydrolase; 2.00A {Homo sapiens} SCOP: c.45.1.1 PDB: 1fq1_A* Back     alignment and structure
>2pq5_A Dual specificity protein phosphatase 13; hydrolase, dual specificity phosphatase, DUSP13, testis and skeletal muscle specific DSP; 2.30A {Homo sapiens} PDB: 2gwo_A Back     alignment and structure
>3emu_A Leucine rich repeat and phosphatase domain containing protein; structural genomics, hydrolase, PSI-2, protein structure initiative; 2.30A {Entamoeba histolytica} Back     alignment and structure
>2wgp_A Dual specificity protein phosphatase 14; MKP6, DUSP14, hydrolase, dual specificity phosphatase; 1.88A {Homo sapiens} Back     alignment and structure
>2pt0_A MYO-inositol hexaphosphate phosphohydrolase; PTP, protein tyrosine phosphatase, phytase, P-loop, cysteine-sulfonic acid, oxidized thiol.; 1.70A {Selenomonas ruminantium} SCOP: c.45.1.4 PDB: 2psz_A 3d1h_A 3d1o_A 3d1q_A 1u24_A 1u25_A* 1u26_A* 2b4o_A 2b4p_A 2b4u_A Back     alignment and structure
>1yn9_A BVP, polynucleotide 5'-phosphatase; RNA triphosphatase, cysteine phosphatase, P-loop, hydrolase; HET: PO4; 1.50A {Autographa californicanucleopolyhedrovirus} Back     alignment and structure
>3f41_A Phytase; tandem repeat, protein tyrosine phosphatase, inositol phosphatase, hydrolase; 2.30A {Mitsuokella multacida} Back     alignment and structure
>1ygr_A CD45 protein tyrosine phosphatase; protein tyrosine phosphatase, RPTP, LCA, lymphocyte activation, hydrolase; HET: PTR; 2.90A {Homo sapiens} PDB: 1ygu_A* Back     alignment and structure
>1lw3_A Myotubularin-related protein 2; protein-phosphate complex, hydrolase; 2.30A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1m7r_A Back     alignment and structure
>1zsq_A Myotubularin-related protein 2; protein-phospholipid complex, hydrolase; HET: PIB; 1.82A {Homo sapiens} SCOP: b.55.1.8 c.45.1.3 PDB: 1zvr_A* Back     alignment and structure
>2nlk_A Protein tyrosine phosphatase, receptor type, G variant (fragment); PTPRG, R-PTP gamma, protein tyrosine phosphatase gamma, D3S1249, HPTPG, RPTPG; 2.40A {Homo sapiens} Back     alignment and structure
>1ohe_A CDC14B, CDC14B2 phosphatase; protein phosphatase, cell cycle, hydrolase; HET: SEP; 2.20A {Homo sapiens} SCOP: c.45.1.1 c.45.1.1 PDB: 1ohc_A 1ohd_A Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 207 hypothetical protein CLIBASIA_03975 [Candidatus Liberib
d1xria_151 c.45.1.1 (A:) Putative phosphatase At1g05000 {Thale cre 5e-14
d2pt0a1313 c.45.1.4 (A:34-346) Myo-inositol hexaphosphate phosphoh 7e-08
d1vhra_178 c.45.1.1 (A:) VH1-related dual-specificity phosphatase, 5e-07
d1ohea2182 c.45.1.1 (A:199-380) Proline directed phosphatase CDC14 1e-06
d1m3ga_145 c.45.1.1 (A:) Mapk phosphatase {Human (Homo sapiens), p 0.002
d1ywfa1272 c.45.1.5 (A:4-275) Phosphotyrosine protein phosphatase 1e-04
d1fpza_