254780899

254780899

methionine aminopeptidase

GeneID in NCBI database:8209919Locus tag:CLIBASIA_03990
Protein GI in NCBI database:254780899Protein Accession:YP_003065312.1
Gene range:-(875572, 876393)Protein Length:273aa
Gene description:methionine aminopeptidase
COG prediction:[J] Methionine aminopeptidase
KEGG prediction:map; methionine aminopeptidase (EC:3.4.11.18); K01265 methionyl aminopeptidase [EC:3.4.11.18]
SEED prediction:Methionine aminopeptidase (EC 3.4.11.18)
Pathway involved in KEGG:not defined
Subsystem involved in SEED:Translation termination factors bacterial;
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MLSSSSRESGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ
ccccHHHHcccEEEccHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccccccccccEEccccccccccccccccccccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEccccEEEEcccEEccccccEEcccccEEEEcccccEEEEEEEEEEcccccEEccccccccccccccccc
cccHHHcccccEEEccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHccccEEccccHHHcccccEEEEccEEEcccccccEcccccEEEEEEEEEEccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHHHHccccccEHHHHHHHHHHHHHHcccEEcccccEEEccccccEEEEEccccccccccccEEccccEEEEccEEEcccccEEEccccccEEEcccccEEEcEEEEEEcccEEEEccccccccccccccccc
mlssssresgsiniytpeeLENIRSACNVVARCLdsltpiikpgtttEEIDDFVLKFgmennaipatlnyrgykkscctsinhvichgipsnkqlregdivNVDVTYVVngwhgdssrmypvgKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCghgigksfhekpeilhfydplypsvgtfqegmvftiepmlnvggssakvlsdgwtavtrdrslsaqYEHTIGITKAGCeiftlspnnlgqpgispiq
mlssssresgsiniytpeeLENIRSACNVVARCLDSltpiikpgtttEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGipsnkqlregdIVNVDVTYVVngwhgdssrmypvGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLspnnlgqpgispiq
MLssssresgsINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ
**************YTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQ*******
**********SINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ
MLS**SRESGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGI****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLSSSSRESGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ
MLSSSSRESGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ
MLSSSSRESGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGITKAGCEIFTLSPNNLGQPGISPIQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target273 methionine aminopeptidase [Candidatus Liberibacter asia
315122682274 methionine aminopeptidase [Candidatus Liberibacter sola 1 1e-130
15888919278 methionine aminopeptidase [Agrobacterium tumefaciens st 1 1e-100
227821959279 methionine aminopeptidase [Sinorhizobium fredii NGR234] 1 1e-100
222148675278 methionine aminopeptidase [Agrobacterium vitis S4] Leng 1 1e-99
86357476278 methionine aminopeptidase [Rhizobium etli CFN 42] Lengt 1 4e-99
325292996278 methionine aminopeptidase [Agrobacterium sp. H13-3] Len 1 4e-99
17987002276 methionine aminopeptidase [Brucella melitensis bv. 1 st 1 4e-99
163843545275 methionine aminopeptidase [Brucella suis ATCC 23445] Le 1 4e-99
23502158275 methionine aminopeptidase [Brucella suis 1330] Length = 1 4e-99
306840254275 methionine aminopeptidase, type I [Brucella sp. BO2] Le 1 5e-99
>gi|315122682|ref|YP_004063171.1| methionine aminopeptidase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 274 Back     alignment and organism information
 Score =  467 bits (1201), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 217/264 (82%), Positives = 244/264 (92%), Gaps = 1/264 (0%)

Query: 11  SINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNY 70
           +INIYT EELE IR+AC+VVARCLDSLT +I+P  TTEEI+DFV +FG++NNAIPATLNY
Sbjct: 11  TINIYTSEELEGIRNACSVVARCLDSLTSMIQPKITTEEINDFVYQFGIKNNAIPATLNY 70

Query: 71  RGYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAE 130
           RGY+KSCCTS+NHV+CHGIPSNK+LR+GDI+NVDVTY+V+GWHGDSSRMYPVGKIKR+AE
Sbjct: 71  RGYRKSCCTSVNHVVCHGIPSNKELRDGDIINVDVTYIVDGWHGDSSRMYPVGKIKRSAE 130

Query: 131 RILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEI 190
           R+LQVTYE+LYKGIAAVKLN NI DIGKAIQ+YAHSE YS+VEVFCGHGIG+ FHE PEI
Sbjct: 131 RLLQVTYEALYKGIAAVKLNGNITDIGKAIQQYAHSENYSIVEVFCGHGIGRCFHENPEI 190

Query: 191 LHFYDPLYPSVG-TFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTIGI 249
           LHFYDPLYPS    FQEGMVFTIEPMLN+G +S KVLSDGWTAVTRD+SLSAQYEHTI I
Sbjct: 191 LHFYDPLYPSDEIKFQEGMVFTIEPMLNLGSASVKVLSDGWTAVTRDQSLSAQYEHTIAI 250

Query: 250 TKAGCEIFTLSPNNLGQPGISPIQ 273
           TK GCEIFTLSPNNLG+PGI PIQ
Sbjct: 251 TKKGCEIFTLSPNNLGRPGIPPIQ 274


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|15888919|ref|NP_354600.1| methionine aminopeptidase [Agrobacterium tumefaciens str. C58] Length = 278 Back     alignment and organism information
>gi|227821959|ref|YP_002825930.1| methionine aminopeptidase [Sinorhizobium fredii NGR234] Length = 279 Back     alignment and organism information
>gi|222148675|ref|YP_002549632.1| methionine aminopeptidase [Agrobacterium vitis S4] Length = 278 Back     alignment and organism information
>gi|86357476|ref|YP_469368.1| methionine aminopeptidase [Rhizobium etli CFN 42] Length = 278 Back     alignment and organism information
>gi|325292996|ref|YP_004278860.1| methionine aminopeptidase [Agrobacterium sp. H13-3] Length = 278 Back     alignment and organism information
>gi|17987002|ref|NP_539636.1| methionine aminopeptidase [Brucella melitensis bv. 1 str. 16M] Length = 276 Back     alignment and organism information
>gi|163843545|ref|YP_001627949.1| methionine aminopeptidase [Brucella suis ATCC 23445] Length = 275 Back     alignment and organism information
>gi|23502158|ref|NP_698285.1| methionine aminopeptidase [Brucella suis 1330] Length = 275 Back     alignment and organism information
>gi|306840254|ref|ZP_07473028.1| methionine aminopeptidase, type I [Brucella sp. BO2] Length = 275 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target273 methionine aminopeptidase [Candidatus Liberibacter asia
PRK05716252 PRK05716, PRK05716, methionine aminopeptidase; Validate 1e-111
COG0024255 COG0024, Map, Methionine aminopeptidase [Translation, r 3e-84
PRK12896255 PRK12896, PRK12896, methionine aminopeptidase; Reviewed 4e-83
TIGR00500247 TIGR00500, met_pdase_I, methionine aminopeptidase, type 7e-81
KOG2738369 KOG2738, KOG2738, KOG2738, Putative methionine aminopep 3e-76
PLN03158396 PLN03158, PLN03158, methionine aminopeptidase; Provisio 2e-70
PRK12318291 PRK12318, PRK12318, methionine aminopeptidase; Provisio 8e-66
PRK12897248 PRK12897, PRK12897, methionine aminopeptidase; Reviewed 2e-52
pfam00557207 pfam00557, Peptidase_M24, Metallopeptidase family M24 2e-43
PRK07281286 PRK07281, PRK07281, methionine aminopeptidase; Reviewed 2e-37
cd01066207 cd01066, APP_MetAP, A family including aminopeptidase P 3e-28
COG0006384 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid trans 1e-27
KOG2414488 KOG2414, KOG2414, KOG2414, Putative Xaa-Pro aminopeptid 2e-08
KOG2737492 KOG2737, KOG2737, KOG2737, Putative metallopeptidase [G 5e-04
TIGR00495 389 TIGR00495, crvDNA_42K, 42K curved DNA binding protein 0.003
cd01086238 cd01086, MetAP1, Methionine Aminopeptidase 1 5e-91
cd01092208 cd01092, APP-like, Similar to Prolidase and Aminopeptid 3e-22
cd01088291 cd01088, MetAP2, Methionine Aminopeptidase 2 1e-15
PRK08671291 PRK08671, PRK08671, methionine aminopeptidase; Provisio 2e-14
TIGR00501295 TIGR00501, met_pdase_II, methionine aminopeptidase, typ 7e-14
cd01087243 cd01087, Prolidase, Prolidase 8e-11
PRK09795361 PRK09795, PRK09795, aminopeptidase; Provisional 3e-09
PRK10879438 PRK10879, PRK10879, proline aminopeptidase P II; Provis 5e-05
KOG2776 398 KOG2776, KOG2776, KOG2776, Metallopeptidase [General fu 8e-05
KOG2775397 KOG2775, KOG2775, KOG2775, Metallopeptidase [General fu 4e-04
cd01089228 cd01089, PA2G4-like, Related to aminopepdidase M, this 0.003
PTZ00053470 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provis 0.001
>gnl|CDD|180219 PRK05716, PRK05716, methionine aminopeptidase; Validated Back     alignment and domain information
>gnl|CDD|30374 COG0024, Map, Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183819 PRK12896, PRK12896, methionine aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|129591 TIGR00500, met_pdase_I, methionine aminopeptidase, type I Back     alignment and domain information
>gnl|CDD|37949 KOG2738, KOG2738, KOG2738, Putative methionine aminopeptidase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|178703 PLN03158, PLN03158, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|183434 PRK12318, PRK12318, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|171806 PRK12897, PRK12897, methionine aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|144226 pfam00557, Peptidase_M24, Metallopeptidase family M24 Back     alignment and domain information
>gnl|CDD|180918 PRK07281, PRK07281, methionine aminopeptidase; Reviewed Back     alignment and domain information
>gnl|CDD|29969 cd01066, APP_MetAP, A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>gnl|CDD|30356 COG0006, PepP, Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|37625 KOG2414, KOG2414, KOG2414, Putative Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|37948 KOG2737, KOG2737, KOG2737, Putative metallopeptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|129586 TIGR00495, crvDNA_42K, 42K curved DNA binding protein Back     alignment and domain information
>gnl|CDD|29971 cd01086, MetAP1, Methionine Aminopeptidase 1 Back     alignment and domain information
>gnl|CDD|29977 cd01092, APP-like, Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>gnl|CDD|29973 cd01088, MetAP2, Methionine Aminopeptidase 2 Back     alignment and domain information
>gnl|CDD|181534 PRK08671, PRK08671, methionine aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|129592 TIGR00501, met_pdase_II, methionine aminopeptidase, type II Back     alignment and domain information
>gnl|CDD|29972 cd01087, Prolidase, Prolidase Back     alignment and domain information
>gnl|CDD|182080 PRK09795, PRK09795, aminopeptidase; Provisional Back     alignment and domain information
>gnl|CDD|182804 PRK10879, PRK10879, proline aminopeptidase P II; Provisional Back     alignment and domain information
>gnl|CDD|37987 KOG2776, KOG2776, KOG2776, Metallopeptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|37986 KOG2775, KOG2775, KOG2775, Metallopeptidase [General function prediction only] Back     alignment and domain information
>gnl|CDD|73244 cd01089, PA2G4-like, Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>gnl|CDD|185417 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 273 methionine aminopeptidase [Candidatus Liberibacter asia
PRK12318291 methionine aminopeptidase; Provisional 100.0
TIGR00500265 met_pdase_I methionine aminopeptidase, type I; InterPro 100.0
PRK05716252 methionine aminopeptidase; Validated 100.0
PRK07281286 methionine aminopeptidase; Reviewed 100.0
PRK12897248 methionine aminopeptidase; Reviewed 100.0
PRK12896254 methionine aminopeptidase; Reviewed 100.0
cd01086238 MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18. Als 100.0
COG0024255 Map Methionine aminopeptidase [Translation, ribosomal s 100.0
KOG2738369 consensus 100.0
PRK09795361 aminopeptidase; Provisional 100.0
PRK10879436 proline aminopeptidase P II; Provisional 100.0
COG0006384 PepP Xaa-Pro aminopeptidase [Amino acid transport and m 100.0
cd01087243 Prolidase Prolidase. E.C. 3.4.13.9. Also known as Xaa-P 100.0
cd01090228 Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. Hydr 100.0
cd01092208 APP-like Similar to Prolidase and Aminopeptidase P. The 100.0
PRK08671293 methionine aminopeptidase; Provisional 100.0
PRK13607442 proline dipeptidase; Provisional 100.0
cd01088291 MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18. Als 100.0
cd01089228 PA2G4-like Related to aminopepdidase M, this family con 100.0
pfam00557207 Peptidase_M24 Metallopeptidase family M24. This family 100.0
cd01066207 APP_MetAP A family including aminopeptidase P, aminopep 100.0
cd01085224 APP X-Prolyl Aminopeptidase 2. E.C. 3.4.11.9. Also know 100.0
KOG2414488 consensus 100.0
KOG2737492 consensus 100.0
TIGR00501327 met_pdase_II methionine aminopeptidase, type II; InterP 100.0
cd01091243 CDC68-like Related to aminopeptidase P and aminopeptida 100.0
PTZ00053435 methionine aminopeptidase II; Provisional 100.0
TIGR00495407 crvDNA_42K DNA-binding protein, 42 kDa; InterPro: IPR00 99.96
TIGR02993391 ectoine_eutD ectoine utilization protein EutD; InterPro 99.96
KOG2413606 consensus 99.95
KOG2776398 consensus 99.9
KOG1189 960 consensus 99.89
KOG2775397 consensus 99.87
COG5406 1001 Nucleosome binding factor SPN, SPT16 subunit [Transcrip 99.59
cd01088291 MetAP2 Methionine Aminopeptidase 2. E.C. 3.4.11.18. Als 97.01
PRK08671293 methionine aminopeptidase; Provisional 96.85
cd01086238 MetAP1 Methionine Aminopeptidase 1. E.C. 3.4.11.18. Als 96.33
PRK05716252 methionine aminopeptidase; Validated 96.03
pfam00557207 Peptidase_M24 Metallopeptidase family M24. This family 96.0
cd01066207 APP_MetAP A family including aminopeptidase P, aminopep 95.94
cd01087243 Prolidase Prolidase. E.C. 3.4.13.9. Also known as Xaa-P 95.3
cd01091243 CDC68-like Related to aminopeptidase P and aminopeptida 93.95
TIGR00501327 met_pdase_II methionine aminopeptidase, type II; InterP 92.09
cd01089228 PA2G4-like Related to aminopepdidase M, this family con 96.94
COG0024255 Map Methionine aminopeptidase [Translation, ribosomal s 96.8
PRK09795361 aminopeptidase; Provisional 96.52
PRK12318291 methionine aminopeptidase; Provisional 96.42
KOG2738 369 consensus 96.14
TIGR00500 265 met_pdase_I methionine aminopeptidase, type I; InterPro 96.07
COG0006384 PepP Xaa-Pro aminopeptidase [Amino acid transport and m 95.34
PRK12897248 methionine aminopeptidase; Reviewed 94.53
PRK10879 436 proline aminopeptidase P II; Provisional 93.9
PTZ00053 435 methionine aminopeptidase II; Provisional 92.66
PRK07281 286 methionine aminopeptidase; Reviewed 96.24
cd01092208 APP-like Similar to Prolidase and Aminopeptidase P. The 96.03
cd01090228 Creatinase Creatine amidinohydrolase. E.C.3.5.3.3. Hydr 96.02
PRK12896254 methionine aminopeptidase; Reviewed 95.47
>PRK12318 methionine aminopeptidase; Provisional Back     alignment and domain information
>TIGR00500 met_pdase_I methionine aminopeptidase, type I; InterPro: IPR002467 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>PRK05716 methionine aminopeptidase; Validated Back     alignment and domain information
>PRK07281 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK12897 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK12896 methionine aminopeptidase; Reviewed Back     alignment and domain information
>cd01086 MetAP1 Methionine Aminopeptidase 1 Back     alignment and domain information
>COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2738 consensus Back     alignment and domain information
>PRK09795 aminopeptidase; Provisional Back     alignment and domain information
>PRK10879 proline aminopeptidase P II; Provisional Back     alignment and domain information
>COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01087 Prolidase Prolidase Back     alignment and domain information
>cd01090 Creatinase Creatine amidinohydrolase Back     alignment and domain information
>cd01092 APP-like Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>PRK08671 methionine aminopeptidase; Provisional Back     alignment and domain information
>PRK13607 proline dipeptidase; Provisional Back     alignment and domain information
>cd01088 MetAP2 Methionine Aminopeptidase 2 Back     alignment and domain information
>cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>pfam00557 Peptidase_M24 Metallopeptidase family M24 Back     alignment and domain information
>cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>cd01085 APP X-Prolyl Aminopeptidase 2 Back     alignment and domain information
>KOG2414 consensus Back     alignment and domain information
>KOG2737 consensus Back     alignment and domain information
>TIGR00501 met_pdase_II methionine aminopeptidase, type II; InterPro: IPR002468 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor Back     alignment and domain information
>PTZ00053 methionine aminopeptidase II; Provisional Back     alignment and domain information
>TIGR00495 crvDNA_42K DNA-binding protein, 42 kDa; InterPro: IPR004545 Proteins of this family have been identified in a number of species as a nuclear (but not nucleolar) protein with a cell cycle dependence Back     alignment and domain information
>TIGR02993 ectoine_eutD ectoine utilization protein EutD; InterPro: IPR014335 Members of this entry are putative peptidases, or non-peptidase homologues that belong to the MEROPS peptidase family M24 (clan MG) or hydrolases similar to Xaa-Pro aminopeptidase Back     alignment and domain information
>KOG2413 consensus Back     alignment and domain information
>KOG2776 consensus Back     alignment and domain information
>KOG1189 consensus Back     alignment and domain information
>KOG2775 consensus Back     alignment and domain information
>COG5406 Nucleosome binding factor SPN, SPT16 subunit [Transcription / DNA replication, recombination, and repair / Chromatin structure and dynamics] Back     alignment and domain information
>cd01088 MetAP2 Methionine Aminopeptidase 2 Back     alignment and domain information
>PRK08671 methionine aminopeptidase; Provisional Back     alignment and domain information
>cd01086 MetAP1 Methionine Aminopeptidase 1 Back     alignment and domain information
>PRK05716 methionine aminopeptidase; Validated Back     alignment and domain information
>pfam00557 Peptidase_M24 Metallopeptidase family M24 Back     alignment and domain information
>cd01066 APP_MetAP A family including aminopeptidase P, aminopeptidase M, and prolidase Back     alignment and domain information
>cd01087 Prolidase Prolidase Back     alignment and domain information
>cd01091 CDC68-like Related to aminopeptidase P and aminopeptidase M, a member of this domain family is present in cell division control protein 68, a transcription factor Back     alignment and domain information
>TIGR00501 met_pdase_II methionine aminopeptidase, type II; InterPro: IPR002468 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>cd01089 PA2G4-like Related to aminopepdidase M, this family contains proliferation-associated protein 2G4 Back     alignment and domain information
>COG0024 Map Methionine aminopeptidase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK09795 aminopeptidase; Provisional Back     alignment and domain information
>PRK12318 methionine aminopeptidase; Provisional Back     alignment and domain information
>KOG2738 consensus Back     alignment and domain information
>TIGR00500 met_pdase_I methionine aminopeptidase, type I; InterPro: IPR002467 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG0006 PepP Xaa-Pro aminopeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12897 methionine aminopeptidase; Reviewed Back     alignment and domain information
>PRK10879 proline aminopeptidase P II; Provisional Back     alignment and domain information
>PTZ00053 methionine aminopeptidase II; Provisional Back     alignment and domain information
>PRK07281 methionine aminopeptidase; Reviewed Back     alignment and domain information
>cd01092 APP-like Similar to Prolidase and Aminopeptidase P Back     alignment and domain information
>cd01090 Creatinase Creatine amidinohydrolase Back     alignment and domain information
>PRK12896 methionine aminopeptidase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target273 methionine aminopeptidase [Candidatus Liberibacter asia
4mat_A278 E.Coli Methionine Aminopeptidase His79ala Mutant Le 2e-43
1c27_A263 E. Coli Methionine Aminopeptidase:norleucine Phosph 4e-43
2p98_A262 E. Coli Methionine Aminopeptidase Monometalated Wit 4e-43
2p99_A261 E. Coli Methionine Aminopeptidase Monometalated Wit 4e-43
3mat_A265 E.Coli Methionine Aminopeptidase Transition-State I 5e-43
2gg0_A263 Novel Bacterial Methionine Aminopeptidase Inhibitor 5e-43
2mat_A264 E.Coli Methionine Aminopeptidase At 1.9 Angstrom Re 7e-43
1xnz_A264 Crystal Structure Of Mn(Ii) Form Of E. Coli. Methio 9e-43
2gu4_A263 E. Coli Methionine Aminopeptidase In Complex With N 4e-42
2gtx_A261 Structural Basis Of Catalysis By Mononuclear Methio 6e-42
1y1n_A291 Identification Of Sh3 Motif In M. Tuberculosis Meth 4e-41
3pka_A285 M. Tuberculosis Metap With Bengamide Analog Y02, In 4e-41
3iu7_A288 M. Tuberculosis Methionine Aminopeptidase With Mn I 5e-41
3mx6_A262 Crystal Structure Of Methionine Aminopeptidase From 7e-41
2g6p_A304 Crystal Structure Of Truncated (Delta 1-89) Human M 9e-40
2b3h_A329 Crystal Structure Of Human Methionine Aminopeptidas 9e-40
1o0x_A262 Crystal Structure Of Methionine Aminopeptidase (Tm1 3e-37
3mr1_A252 Crystal Structure Of Methionine Aminopeptidase From 5e-37
3q6d_A356 Xaa-Pro Dipeptidase From Bacillus Anthracis. Length 2e-27
1qxw_A252 Crystal Structure Of Staphyloccocus Aureus In Compl 2e-27
2bww_A440 His350ala Escherichia Coli Aminopeptidase P Length 5e-27
1m35_A440 Aminopeptidase P From Escherichia Coli Length = 440 1e-26
2bwt_A440 Asp260ala Escherichia Coli Aminopeptidase P Length 1e-26
2bwu_A440 Asp271ala Escherichia Coli Aminopeptidase P Length 1e-26
1jaw_A440 Aminopeptidase P From E. Coli Low Ph Form Length = 1e-26
1wl9_A440 Structure Of Aminopeptidase P From E. Coli Length = 2e-26
2bwv_A440 His361ala Escherichia Coli Aminopeptidase P Length 3e-26
2bwy_A440 Glu383ala Escherichia Coli Aminopeptidase P Length 1e-25
2bwx_A441 His354ala Escherichia Coli Aminopeptidase P Length 1e-25
1pv9_A348 Prolidase From Pyrococcus Furiosus Length = 348 1e-25
2v3z_A440 Glu383ala Escherichia Coli Aminopeptidase P In Comp 2e-25
2bws_A440 His243ala Escherichia Coli Aminopeptidase P Length 3e-25
2zsg_A359 Crystal Structure Of X-Pro Aminopeptidase From Ther 1e-23
1wy2_A351 Crystal Structure Of The Prolidase From Pyrococcus 1e-23
2iw2_A494 Crystal Structure Of Human Prolidase Length = 494 4e-22
1wn1_A356 Crystal Structure Of Dipeptiase From Pyrococcus Hor 1e-18
1chm_B401 Enzymatic Mechanism Of Creatine Amidinohydrolase As 1e-13
1chm_A401 Enzymatic Mechanism Of Creatine Amidinohydrolase As 2e-13
3l24_A517 Crystal Structure Of The Nerve Agent Degrading Orga 9e-11
3ig4_A427 Structure Of A Putative Aminopeptidase P From Bacil 3e-10
1kp0_A402 The Crystal Structure Analysis Of Creatine Amidinoh 1e-06
3ctz_A623 Structure Of Human Cytosolic X-Prolyl Aminopeptidas 4e-05
2dfi_A301 Crystal Structure Of Pf-Map(1-292)-C Length = 301 2e-06
1xgs_A295 Methionine Aminopeptidase From Hyperthermophile Pyr 2e-06
1b6a_A478 Human Methionine Aminopeptidase 2 Complexed With Tn 7e-04
1qzy_A478 Human Methionine Aminopeptidase In Complex With Ben 8e-04
1b59_A370 Complex Of Human Methionine Aminopeptidase-2 Comple 0.002
1r58_A369 Crystal Structure Of Metap2 Complexed With A357300 0.002
>gi|9257170|pdb|4MAT|A Chain A, E.Coli Methionine Aminopeptidase His79ala Mutant Length = 278 Back     alignment and structure
 Score =  180 bits (456), Expect = 2e-43,   Method: Composition-based stats.
 Identities = 121/263 (46%), Positives = 172/263 (65%), Gaps = 4/263 (1%)

Query: 10  GSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGM-ENNAIPATL 68
            +I+I TPE++E +R A  + A  L+ + P +KPG +T E+D     + + E +A+ A L
Sbjct: 1   MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL 60

Query: 69  NYRGYKKSCCTSINHVICHGIPSNKQL-REGDIVNVDVTYVVNGWHGDSSRMYPVGKIKR 127
            Y GY KS C SIN V+CHGIP + +L ++GDIVN+DVT + +G+HGD+S+M+ VGK   
Sbjct: 61  GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI 120

Query: 128 AAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEK 187
             ER+ ++T ESLY  +  VK   N+ +IG AIQ++  +E +SVV  +CGHGIG+ FHE+
Sbjct: 121 MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGQGFHEE 180

Query: 188 PEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVLSDGWTAVTRDRSLSAQYEHTI 247
           P++LH+           + GM FTIEPM+N G    + + DGWT  T+DRSLSAQYEHTI
Sbjct: 181 PQVLHYDSRETN--VVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTI 238

Query: 248 GITKAGCEIFTLSPNNLGQPGIS 270
            +T  GCEI TL  ++     IS
Sbjct: 239 VVTDNGCEILTLRKDDTIPAIIS 261


>gi|6573394|pdb|1C27|A Chain A, E. Coli Methionine Aminopeptidase:norleucine Phosphonate Complex Length = 263 Back     alignment and structure
>gi|160877712|pdb|2P98|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye7 Length = 262 Back     alignment and structure
>gi|160877713|pdb|2P99|A Chain A, E. Coli Methionine Aminopeptidase Monometalated With Inhibitor Ye6 Length = 261 Back     alignment and structure
>gi|9257169|pdb|3MAT|A Chain A, E.Coli Methionine Aminopeptidase Transition-State Inhibitor Complex Length = 265 Back     alignment and structure
>gi|110590267|pdb|2GG0|A Chain A, Novel Bacterial Methionine Aminopeptidase Inhibitors Length = 263 Back     alignment and structure
>gi|5542522|pdb|2MAT|A Chain A, E.Coli Methionine Aminopeptidase At 1.9 Angstrom Resolution Length = 264 Back     alignment and structure
gi|56554613|pdb|1XNZ|A Chain A, Crystal Structure Of Mn(Ii) Form Of E. Coli. Methionine Aminopeptidase In Complex With 5-(2-Chlorophenyl)furan-2- Carboxylic Acid Length = 264 Back     alignment and structure
>gi|110590415|pdb|2GU4|A Chain A, E. Coli Methionine Aminopeptidase In Complex With Nlep, 1: 0.5, Di-Metalated Length = 263 Back     alignment and structure
>gi|110590410|pdb|2GTX|A Chain A, Structural Basis Of Catalysis By Mononuclear Methionine Aminopeptidase Length = 261 Back     alignment and structure
>gi|67463881|pdb|1Y1N|A Chain A, Identification Of Sh3 Motif In M. Tuberculosis Methionine Aminopeptidase Suggests A Mode Of Interaction With The Ribosome Length = 291 Back     alignment and structure
gi|329666154|pdb|3PKA|A Chain A, M. Tuberculosis Metap With Bengamide Analog Y02, In Mn Form Length = 285 Back     alignment and structure
>gi|283807062|pdb|3IU7|A Chain A, M. Tuberculosis Methionine Aminopeptidase With Mn Inhibitor A02 Length = 288 Back     alignment and structure
>gi|296863717|pdb|3MX6|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Bound To Methionine Length = 262 Back     alignment and structure
>gi|110590199|pdb|2G6P|A Chain A, Crystal Structure Of Truncated (Delta 1-89) Human Methionine Aminopeptidase Type 1 In Complex With Pyridyl Pyrimidine Derivative Length = 304 Back     alignment and structure
>gi|83754210|pdb|2B3H|A Chain A, Crystal Structure Of Human Methionine Aminopeptidase Type I With A Third Cobalt In The Active Site Length = 329 Back     alignment and structure
>gi|24987887|pdb|1O0X|A Chain A, Crystal Structure Of Methionine Aminopeptidase (Tm1478) From Thermotoga Maritima At 1.90 A Resolution Length = 262 Back     alignment and structure
>gi|296863694|pdb|3MR1|A Chain A, Crystal Structure Of Methionine Aminopeptidase From Ricketts Prowazekii Length = 252 Back     alignment and structure
>gi|321160035|pdb|3Q6D|A Chain A, Xaa-Pro Dipeptidase From Bacillus Anthracis. Length = 356 Back     alignment and structure
gi|47168659|pdb|1QXW|A Chain A, Crystal Structure Of Staphyloccocus Aureus In Complex With An Aminoketone Inhibitor 54135. Length = 252 Back     alignment and structure
>gi|88192506|pdb|2BWW|A Chain A, His350ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|30749440|pdb|1M35|A Chain A, Aminopeptidase P From Escherichia Coli Length = 440 Back     alignment and structure
>gi|88192503|pdb|2BWT|A Chain A, Asp260ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|88192504|pdb|2BWU|A Chain A, Asp271ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|157831534|pdb|1JAW|A Chain A, Aminopeptidase P From E. Coli Low Ph Form Length = 440 Back     alignment and structure
>gi|75765331|pdb|1WL9|A Chain A, Structure Of Aminopeptidase P From E. Coli Length = 440 Back     alignment and structure
>gi|88192505|pdb|2BWV|A Chain A, His361ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
>gi|88192508|pdb|2BWY|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
gi|47168566|pdb|1PV9|A Chain A, Prolidase From Pyrococcus Furiosus Length = 348 Back     alignment and structure
>gi|160877823|pdb|2V3Z|A Chain A, Glu383ala Escherichia Coli Aminopeptidase P In Complex With Substrate Length = 440 Back     alignment and structure
>gi|88192502|pdb|2BWS|A Chain A, His243ala Escherichia Coli Aminopeptidase P Length = 440 Back     alignment and structure
gi|209447405|pdb|2ZSG|A Chain A, Crystal Structure Of X-Pro Aminopeptidase From Thermotoga Maritima Msb8 Length = 359 Back     alignment and structure
gi|61680285|pdb|1WY2|A Chain A, Crystal Structure Of The Prolidase From Pyrococcus Horikoshii Ot3 Length = 351 Back     alignment and structure
>gi|112491419|pdb|2IW2|A Chain A, Crystal Structure Of Human Prolidase Length = 494 Back     alignment and structure
gi|75765344|pdb|1WN1|A Chain A, Crystal Structure Of Dipeptiase From Pyrococcus Horikoshii Ot3 Length = 356 Back     alignment and structure
>gi|515103|pdb|1CHM|B Chain B, Enzymatic Mechanism Of Creatine Amidinohydrolase As Deduced From Crystal Structures Length = 401 Back     alignment and structure
>gi|809294|pdb|1CHM|A Chain A, Enzymatic Mechanism Of Creatine Amidinohydrolase As Deduced From Crystal Structures Length = 401 Back     alignment and structure
>gi|284794115|pdb|3L24|A Chain A, Crystal Structure Of The Nerve Agent Degrading Organophosphate AnhydrolasePROLIDASE IN COMPLEX WITH Inhibitors Length = 517 Back     alignment and structure
>gi|255312000|pdb|3IG4|A Chain A, Structure Of A Putative Aminopeptidase P From Bacillus Anthracis Length = 427 Back     alignment and structure
>gi|22219065|pdb|1KP0|A Chain A, The Crystal Structure Analysis Of Creatine Amidinohydrolase From Actinobacillus Length = 402 Back     alignment and structure
>gi|189096241|pdb|3CTZ|A Chain A, Structure Of Human Cytosolic X-Prolyl Aminopeptidase Length = 623 Back     alignment and structure
>gi|134104119|pdb|2DFI|A Chain A, Crystal Structure Of Pf-Map(1-292)-C Length = 301 Back     alignment and structure
gi|2392623|pdb|1XGS|A Chain A, Methionine Aminopeptidase From Hyperthermophile Pyrococcus Furiosus Length = 295 Back     alignment and structure
gi|157830181|pdb|1B6A|A Chain A, Human Methionine Aminopeptidase 2 Complexed With Tnp-470 Length = 478 Back     alignment and structure
>gi|39654787|pdb|1QZY|A Chain A, Human Methionine Aminopeptidase In Complex With Bengamide Inhibitor Laf153 And Cobalt Length = 478 Back     alignment and structure
>gi|6980558|pdb|1B59|A Chain A, Complex Of Human Methionine Aminopeptidase-2 Complexed With Ovalicin Length = 370 Back     alignment and structure
>gi|56553643|pdb|1R58|A Chain A, Crystal Structure Of Metap2 Complexed With A357300 Length = 369 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target273 methionine aminopeptidase [Candidatus Liberibacter asia
3mx6_A262 Methionine aminopeptidase; seattle structural genomics 7e-81
3iu7_A288 Methionine aminopeptidase; enzyme-inhibitor complex, co 1e-61
1o0x_A262 Methionine aminopeptidase; TM1478, structural genomics, 9e-60
1qxy_A252 Methionyl aminopeptidase; PITA bread fold, hydrolase; H 4e-56
2b3h_A329 Methionine aminopeptidase 1; hydrolase, metalloprotease 1e-53
2gg2_A263 Methionine aminopeptidase; PITA-bread fold, MAP inhibit 7e-53
1b6a_A478 Methionine aminopeptidase; angiogenesis inhibitor; HET: 6e-43
3cb6_A444 FACT complex subunit SPT16; peptidase homology domain, 4e-42
3ig4_A427 XAA-Pro aminopeptidase; csgid, hydrolase, structural ge 1e-40
2q8k_A 401 Proliferation-associated protein 2G4; EBP1, PA2G4, meth 4e-37
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sa 5e-32
2nw5_A360 Methionine aminopeptidase 2; metap2, structural genomic 8e-32
2v3z_A440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- s 3e-29
3l24_A517 XAA-Pro dipeptidase; PITA-bread, detoxification, hydrol 2e-28
3biq_A467 FACT complex subunit SPT16; PITA-bread, aminopeptidase, 4e-24
2iw2_A494 XAA-Pro dipeptidase; metallocarboxypeptidase, disease m 8e-22
1xgs_A295 Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyr 3e-21
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseudomon 1e-20
2q8k_A401 Proliferation-associated protein 2G4; EBP1, PA2G4, meth 7e-05
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidase, ri 6e-29
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 4e-24
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural genomics 6e-22
3ctz_A623 XAA-Pro aminopeptidase 1; PITA-bread fold, alternative 4e-28
>3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Length = 262 Back     alignment and structure
 Score =  295 bits (757), Expect = 7e-81
 Identities = 131/257 (50%), Positives = 176/257 (68%), Gaps = 3/257 (1%)

Query: 12  INIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYR 71
           I I+T ++   +R+A  + A  LD +T  +KP  TT  ++D    F   +NAIPA LNY+
Sbjct: 6   IKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYK 65

Query: 72  GYKKSCCTSINHVICHGIPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAER 131
           G+ KS CTSINHV+CHGIP++K L+ GDIVN+DVT +++GW+GD+SRMY VG +    +R
Sbjct: 66  GFPKSICTSINHVVCHGIPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKR 125

Query: 132 ILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSERYSVVEVFCGHGIGKSFHEKPEIL 191
           ++QVTY+++ KGI  V+  A + DIG AIQ YA    YSVV  + GHGIG+ FH+KP IL
Sbjct: 126 LIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHNYSVVRDYTGHGIGRVFHDKPSIL 185

Query: 192 HFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKVL-SDGWTAVTRDRSLSAQYEHTIGIT 250
           ++      +  T +EGM FT+EPM+N G     +   DGWT  TRD+SLSAQ+EHTIG+T
Sbjct: 186 NYGRN--GTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTIGVT 243

Query: 251 KAGCEIFTLSPNNLGQP 267
           K G EIFTLSP  L  P
Sbjct: 244 KDGFEIFTLSPKKLDYP 260


>3iu7_A Methionine aminopeptidase; enzyme-inhibitor complex, cobalt, hydrolase, metal-binding, protease; HET: FCD; 1.40A {Mycobacterium tuberculosis} PDB: 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A Length = 288 Back     alignment and structure
>1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Length = 262 Back     alignment and structure
>1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Length = 252 Back     alignment and structure
>2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitabread fold; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Length = 329 Back     alignment and structure
>2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Length = 263 Back     alignment and structure
>1b6a_A Methionine aminopeptidase; angiogenesis inhibitor; HET: TN4; 1.60A {Homo sapiens} SCOP: a.4.5.25 d.127.1.1 PDB: 1qzy_A* 1boa_A* 1kq0_A 1kq9_A 1bn5_A* 1b59_A* 1yw9_A* 1r5g_A* 1r5h_A* 1r58_A* 1yw8_A* 1yw7_A* 2adu_A* 2ea2_A* 2ea4_A* 2ga2_A* 2oaz_A* Length = 478 Back     alignment and structure
>3cb6_A FACT complex subunit SPT16; peptidase homology domain, histone binding module, histone H3/H4 chaperone, PITA-bread fold; 1.84A {Schizosaccharomyces pombe} PDB: 3cb5_A Length = 444 Back     alignment and structure
>3ig4_A XAA-Pro aminopeptidase; csgid, hydrolase, structural genomics, center for structural genomics of infectious diseases; HET: SO4; 2.89A {Bacillus anthracis} Length = 427 Back     alignment and structure
>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcription; 1.60A {Homo sapiens} PDB: 2v6c_A Length = 401 Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Length = 402 Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidase P, manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Length = 440 Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} Length = 517 Back     alignment and structure
>3biq_A FACT complex subunit SPT16; PITA-bread, aminopeptidase, chromatin, replication, activator, chromosomal protein, coiled coil, DNA damage; 1.73A {Saccharomyces cerevisiae} PDB: 3bip_A 3bit_A* Length = 467 Back     alignment and structure
>2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, acetylation, peptidase D, polymorphism, collagen degradation, metalloaminopeptidase; 1.82A {Homo sapiens} PDB: 2okn_A Length = 494 Back     alignment and structure
>1xgs_A Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyrococcus furiosus} SCOP: a.4.5.25 d.127.1.1 PDB: 1xgm_A 1xgn_A 1xgo_A 1wkm_A 2dfi_A Length = 295 Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Length = 401 Back     alignment and structure
>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcription; 1.60A {Homo sapiens} PDB: 2v6c_A Length = 401 Back     alignment and structure
>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/proteomics initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii OT3} PDB: 1pv9_A Length = 351 Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Length = 359 Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii OT3} PDB: 2how_A Length = 356 Back     alignment and structure
>3ctz_A XAA-Pro aminopeptidase 1; PITA-bread fold, alternative splicing, cytoplasm, hydrolase, manganese, metal-binding, metalloprotease, protease; HET: P6G; 1.60A {Homo sapiens} Length = 623 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target273 methionine aminopeptidase [Candidatus Liberibacter asia
3mx6_A262 Methionine aminopeptidase; seattle structural genomics 100.0
2b3h_A329 Methionine aminopeptidase 1; hydrolase, metalloprotease 100.0
2gg2_A263 Methionine aminopeptidase; PITA-bread fold, MAP inhibit 100.0
1qxy_A252 Methionyl aminopeptidase; PITA bread fold, hydrolase; H 100.0
3iu7_A288 Methionine aminopeptidase; enzyme-inhibitor complex, co 100.0
1o0x_A262 Methionine aminopeptidase; TM1478, structural genomics, 100.0
2v3z_A440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- s 100.0
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 100.0
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sa 100.0
2iw2_A494 XAA-Pro dipeptidase; metallocarboxypeptidase, disease m 100.0
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural genomics 100.0
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidase, ri 100.0
3l24_A517 XAA-Pro dipeptidase; PITA-bread, detoxification, hydrol 100.0
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseudomon 100.0
2q8k_A401 Proliferation-associated protein 2G4; EBP1, PA2G4, meth 100.0
3ig4_A427 XAA-Pro aminopeptidase; csgid, hydrolase, structural ge 100.0
3biq_A467 FACT complex subunit SPT16; PITA-bread, aminopeptidase, 100.0
3cb6_A444 FACT complex subunit SPT16; peptidase homology domain, 100.0
1xgs_A295 Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyr 100.0
2nw5_A360 Methionine aminopeptidase 2; metap2, structural genomic 100.0
1b6a_A478 Methionine aminopeptidase; angiogenesis inhibitor; HET: 100.0
3ctz_A623 XAA-Pro aminopeptidase 1; PITA-bread fold, alternative 100.0
2nw5_A360 Methionine aminopeptidase 2; metap2, structural genomic 97.15
2q8k_A401 Proliferation-associated protein 2G4; EBP1, PA2G4, meth 96.73
1xgs_A295 Methionine aminopeptidase; hyperthermophIle; 1.75A {Pyr 96.39
3mx6_A262 Methionine aminopeptidase; seattle structural genomics 95.48
2gg2_A263 Methionine aminopeptidase; PITA-bread fold, MAP inhibit 94.98
1b6a_A 478 Methionine aminopeptidase; angiogenesis inhibitor; HET: 96.66
2b3h_A 329 Methionine aminopeptidase 1; hydrolase, metalloprotease 96.49
1wn1_A356 Dipeptidase; prolidase, cobalt(II), structural genomics 96.15
1kp0_A402 Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sa 96.15
2zsg_A359 Aminopeptidase P, putative; hydrolase; 1.65A {Thermotog 96.14
1wy2_A351 XAA-Pro dipeptidase; structural genomics, prolidase, ri 95.83
1chm_A401 Creatine amidinohydrolase; creatinase; 1.90A {Pseudomon 95.62
3ig4_A 427 XAA-Pro aminopeptidase; csgid, hydrolase, structural ge 95.55
3biq_A 467 FACT complex subunit SPT16; PITA-bread, aminopeptidase, 94.75
2v3z_A 440 XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- s 94.48
3iu7_A288 Methionine aminopeptidase; enzyme-inhibitor complex, co 94.41
2iw2_A 494 XAA-Pro dipeptidase; metallocarboxypeptidase, disease m 91.47
3cb6_A444 FACT complex subunit SPT16; peptidase homology domain, 95.71
1o0x_A262 Methionine aminopeptidase; TM1478, structural genomics, 94.84
1qxy_A252 Methionyl aminopeptidase; PITA bread fold, hydrolase; H 93.11
>3mx6_A Methionine aminopeptidase; seattle structural genomics center for infectious disease, S aminopeptidase, protease, epidermic typhus; 1.70A {Rickettsia prowazekii} PDB: 3mr1_A Back     alignment and structure
Probab=100.00  E-value=0  Score=455.80  Aligned_cols=258  Identities=51%  Similarity=0.870  Sum_probs=243.5

Q ss_pred             CCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
Q ss_conf             39788539999999999999999999999997579988999999999999985983034433244455323446421112
Q gi|254780899|r    9 SGSINIYTPEELENIRSACNVVARCLDSLTPIIKPGTTTEEIDDFVLKFGMENNAIPATLNYRGYKKSCCTSINHVICHG   88 (273)
Q Consensus         9 ~~~~~IKs~~EI~~~R~A~~i~~~~~~~~~~~i~~G~se~el~~~~~~~~~~~g~~~~~~~~~~f~~~~~~s~N~~~~H~   88 (273)
                      .+.|+||||+||++||+|++|++++++++.+.++||+||.||++.+++++.++|+...+..+.+|+.+++++.|...+|+
T Consensus         3 ~~m~~IKs~~EI~~mR~A~~i~~~~~~~~~~~i~pG~te~el~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~h~   82 (262)
T 3mx6_A            3 GSMIKIHTEKDFIKMRAAGKLAAETLDFITDHVKPNVTTNSLNDLCHNFITSHNAIPAPLNYKGFPKSICTSINHVVCHG   82 (262)
T ss_dssp             ---CCCCCHHHHHHHHHHHHHHHHHHHHHGGGCCTTCBHHHHHHHHHHHHHHTTCEETTTTGGGCCSSSEEEETTEEECC
T ss_pred             CCCEEECCHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCC
T ss_conf             87227789999999999999999999999987769997999999999999986986467666567643205676504589


Q ss_pred             CCCCCCCCCCEEEEEEEEEEEEEECCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCCCCHHHHHHHHHHHHCC
Q ss_conf             12222001340579978766530002311123334444321036778776543221100112122104899999998629
Q gi|254780899|r   89 IPSNKQLREGDIVNVDVTYVVNGWHGDSSRMYPVGKIKRAAERILQVTYESLYKGIAAVKLNANIEDIGKAIQRYAHSER  168 (273)
Q Consensus        89 ~p~d~~l~~GD~v~iD~g~~~~GY~~D~~RT~~~G~~~~~~~~l~~~~~~a~~~~i~~ikpG~~~~ei~~a~~~~~~~~g  168 (273)
                      .|+|+++++||+|++|+|+.|+||++|++|||++|+++++++++|+++++|++++++++|||++++||+++++++++++|
T Consensus        83 ~~~d~~l~~Gd~v~iD~g~~~~gY~aD~tRT~~vg~~~~~~~~~~~~~~~a~~~~i~~~rpG~~~~dv~~a~~~~~~~~g  162 (262)
T 3mx6_A           83 IPNDKPLKNGDIVNIDVTVILDGWYGDTSRMYYVGDVAIKPKRLIQVTYDAMMKGIEVVRPGAKLGDIGYAIQSYAEKHN  162 (262)
T ss_dssp             CCCSCBCCTTCEEEEEEEEEETTEEEEEEEEEECSSCCHHHHHHHHHHHHHHHHHHHTCSTTCBHHHHHHHHHHHHHHTT
T ss_pred             CCCCCCCCCCCEEEEEEEEEECCEEEECCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHCC
T ss_conf             89983658999899988999999992212136647999899999999999999999971398999999999999999868


Q ss_pred             CEECCCCCCCCCCCCCCCCCEEEECCCCCCCCCCEECCCCEEEECCEEECCCCCCEE-CCCCCEEEECCCCEEEEEEEEE
Q ss_conf             601047521233221135403653156454566451167378831114437776256-4688668833787167844218
Q gi|254780899|r  169 YSVVEVFCGHGIGKSFHEKPEILHFYDPLYPSVGTFQEGMVFTIEPMLNVGGSSAKV-LSDGWTAVTRDRSLSAQYEHTI  247 (273)
Q Consensus       169 ~~~~~~~~GHgiGl~~hE~P~i~~~~~~~~~~~~~le~GMV~aiEP~i~~~~~~~~~-~~d~w~~~~~~g~~~~~~Ed~v  247 (273)
                      |+.+++++|||||+.+||.|.+++...  .+++.+|++||||+|||++|.+..+.+. ..|+|++.++||++|+|+||||
T Consensus       163 ~~~~~~~~GHgiGl~~he~P~i~~~~~--~~~~~~L~~GmV~~iEp~~~~~~~~~~~~~~d~w~~~~~~g~~g~riEd~v  240 (262)
T 3mx6_A          163 YSVVRDYTGHGIGRVFHDKPSILNYGR--NGTGLTLKEGMFFTVEPMINAGNYDTILSKLDGWTVTTRDKSLSAQFEHTI  240 (262)
T ss_dssp             CEECCSCCEEECSSSSSEEEEECSSCC--TTCSCBCCTTCEEEECCEEESSCSCEEECTTTSCCEEETTCCCEEECBEEE
T ss_pred             CCCCCCCCCCCCCCCCCCCCCCCCCCC--CCCCCCCCCCCEEEEEEEEECCCCCEEEECCCCCEEEEECCCCEEEEEEEE
T ss_conf             942899862878886068986577776--899978348978998634761777604533789668852687488973099


Q ss_pred             EECCCCCEECCCCCCCCCCCC
Q ss_conf             984798576526798867688
Q gi|254780899|r  248 GITKAGCEIFTLSPNNLGQPG  268 (273)
Q Consensus       248 lVT~~G~E~LT~~p~~l~~~~  268 (273)
                      +||++|+|+||.+|++|+.|+
T Consensus       241 ~VTe~G~E~LT~~p~~L~~~~  261 (262)
T 3mx6_A          241 GVTKDGFEIFTLSPKKLDYPP  261 (262)
T ss_dssp             EECSSSEEESCCCTTCCCSSC
T ss_pred             EECCCCCEECCCCCCCCCCCC
T ss_conf             996993778989976457998



>2b3h_A Methionine aminopeptidase 1; hydrolase, metalloprotease, pitabread fold; HET: GOL; 1.10A {Homo sapiens} PDB: 2b3k_A 2b3l_A 2gz5_A* 2nq6_A* 2nq7_A* 2g6p_A* Back     alignment and structure
>2gg2_A Methionine aminopeptidase; PITA-bread fold, MAP inhibitor, antibacterial, hydrolase; HET: U12; 1.00A {Escherichia coli K12} SCOP: d.127.1.1 PDB: 2gg0_A* 2gg3_A* 2gg5_A* 2gg7_A* 2gg8_A* 2gg9_A* 2ggb_A* 2ggc_A 2q93_A* 2q95_A* 2q96_A* 1xnz_A* 1mat_A* 2bb7_A* 2evc_A* 2evm_A* 2evo_A* 3mat_A* 1yvm_A* 2mat_A ... Back     alignment and structure
>1qxy_A Methionyl aminopeptidase; PITA bread fold, hydrolase; HET: M2C; 1.04A {Staphylococcus aureus} SCOP: d.127.1.1 PDB: 1qxw_A* 1qxz_A* Back     alignment and structure
>3iu7_A Methionine aminopeptidase; enzyme-inhibitor complex, cobalt, hydrolase, metal-binding, protease; HET: FCD; 1.40A {Mycobacterium tuberculosis} PDB: 3iu8_A* 3iu9_A* 1y1n_A 1yj3_A Back     alignment and structure
>1o0x_A Methionine aminopeptidase; TM1478, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: d.127.1.1 Back     alignment and structure
>2v3z_A XAA-Pro aminopeptidase; 'PITA-bread' enzyme, proline- specific enzyme, aminopeptidase P, manganese enzyme, protease, manganese; HET: CSO; 1.56A {Escherichia coli} SCOP: c.55.2.1 d.127.1.1 PDB: 2bwy_A* 1wl9_A 1m35_A 1n51_A* 1w2m_A 1a16_A 1wbq_A 1wl6_A* 1w7v_A 1wlr_A* 2bh3_A* 2bha_A* 2bhb_A* 2bhc_A* 2bhd_A* 2bn7_A* 1jaw_A 2bwt_A* 2bwu_A* 2bww_A* ... Back     alignment and structure
>2zsg_A Aminopeptidase P, putative; hydrolase; 1.65A {Thermotoga maritima} Back     alignment and structure
>1kp0_A Creatine amidinohydrolase; alpha betal, 3-layer(ABA) sandwich; 2.70A {Actinobacillus} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>2iw2_A XAA-Pro dipeptidase; metallocarboxypeptidase, disease mutation, acetylation, peptidase D, polymorphism, collagen degradation, metalloaminopeptidase; 1.82A {Homo sapiens} PDB: 2okn_A Back     alignment and structure
>1wn1_A Dipeptidase; prolidase, cobalt(II), structural genomics, riken structural genomics/proteomics initiative, RSGI, hydrolase; 2.25A {Pyrococcus horikoshii OT3} PDB: 2how_A Back     alignment and structure
>1wy2_A XAA-Pro dipeptidase; structural genomics, prolidase, riken structural genomics/proteomics initiative, RSGI, hydrolase; 1.70A {Pyrococcus horikoshii OT3} PDB: 1pv9_A Back     alignment and structure
>3l24_A XAA-Pro dipeptidase; PITA-bread, detoxification, hydrolase, manganese, metal-binding, metalloprotease, protease; 2.30A {Alteromonas SP} PDB: 3l7g_A* Back     alignment and structure
>1chm_A Creatine amidinohydrolase; creatinase; 1.90A {Pseudomonas putida} SCOP: c.55.2.1 d.127.1.1 Back     alignment and structure
>2q8k_A Proliferation-associated protein 2G4; EBP1, PA2G4, methionine aminopeptidase, PITA-bread, transcription; 1.60A {Homo sapiens} PDB: 2v6c_A Back     alignment and structure