254780900

254780900

homoserine dehydrogenase

GeneID in NCBI database:8209920Locus tag:CLIBASIA_03995
Protein GI in NCBI database:254780900Protein Accession:YP_003065313.1
Gene range:+(877139, 878455)Protein Length:438aa
Gene description:homoserine dehydrogenase
COG prediction:[E] Homoserine dehydrogenase
KEGG prediction:thrA; homoserine dehydrogenase (EC:1.1.1.3); K00003 homoserine dehydrogenase [EC:1.1.1.3]
SEED prediction:Homoserine dehydrogenase (EC 1.1.1.3)
Pathway involved in KEGG:Glycine, serine and threonine metabolism [PATH:las00260]
Cysteine and methionine metabolism [PATH:las00270]
Lysine biosynthesis [PATH:las00300]
Subsystem involved in SEED:Threonine and Homoserine Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED3 TM-Helix
HMMTOP2 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------44
MAGVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI
cccEEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccHHHccHHHHHccccccEEEEEccccccHHHHHHHHHHHccccEEccccHHHHHHHHHHHHHHHHcccEEEEEccHHcccHHHHHHHHHccccEEEEEEEEEccHHHHHHHHHHHccccHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHccccccHHHEEEcccccccHHHHHHHHHHccHHHHHHHHHHcccEEEEEEEEEEEcccccccccccccEEEEEEEcccccEEEEccccccHHHHHHHHHHHHHHHHHcccccccccccccccHHHHcccccHHHHcccEEEEEEEcccccHHHHHHHHHHHccccHHHHccccccccccEEEEEEEEEEccHHHHHHHHHHHHcccHHHccEEEEEEcccccc
ccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEEEEEccccccccccccEEEEccHHHHHccccccEEEEEEccccccHHHHHHHHHHcccEEEEccHHHHHHcHHHHHHHHHHccccEEEHHHHHcHHHHHHHHHHcccccHHHEEEEEEcccHHHHHHHHHHccccHHHHHHHHHHcccccccccccccHHHHHHHHHHHHHHHcccccccccEEEEccccccHHHHHHHHHHccEEEEEEEEEEccccEEEEEcccccccccccHcEcccEEEEEEEccccccEEEEcccccccccHHHHHHHHHHHHHHcccccccccccccHHHHcccccccHHHccccEEEEEEEcccHHHHHHHHHHHHHccccHHHHHEccccccccccEEEEEEccccHHHHHHHHHHHHcccccccccEEEEEEccccc
MAGVLKVGVAGLGTVGSALIRSIQKREgrfkdldqhsFVVSAISARdknidrgidclryewfddplimagEADIDVFVELiggedypayDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHmnnlglsfQDCLEEARRQgyaegdatfdingvdssHKIAILSAIAFGidtsvegvycegisnitledirgaadFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETnglgkltmtgpgaggsataSAVLGDICSIAKTNTQKSVSWalgkesssfsvihcdgvyeeEKEYFIRLTIRNFEGILDKITSQMSdfnislrlfscphqeensqEFSVFMITHKVSGKLIRDAIECfngksdaiRYSCVICIENFESI
MAGVLKVGvaglgtvgSALIRSIQKRegrfkdldqhSFVVsaisardknidrGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSwalgkesssfsvIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI
MagvlkvgvaglgtvgSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMtgpgaggsatasaVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI
**GVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSC*******QEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFE**
MAGVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI
**GVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFES*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
HHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAGVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI
MAGVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI
MAGVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYEWFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALLAQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQDCLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRGAADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTGPGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGKSDAIRYSCVICIENFESI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target438 homoserine dehydrogenase [Candidatus Liberibacter asiat
315122681434 homoserine dehydrogenase [Candidatus Liberibacter solan 1 0.0
227821963440 homoserine dehydrogenase [Sinorhizobium fredii NGR234] 1 1e-109
222148682440 homoserine dehydrogenase [Agrobacterium vitis S4] Lengt 1 1e-109
159184828436 homoserine dehydrogenase [Agrobacterium tumefaciens str 1 1e-108
307302596440 Homoserine dehydrogenase [Sinorhizobium meliloti BL225C 1 1e-108
15965475440 homoserine dehydrogenase [Sinorhizobium meliloti 1021] 1 1e-108
325292977436 Homoserine dehydrogenase [Agrobacterium sp. H13-3] Leng 1 1e-107
150396666440 homoserine dehydrogenase [Sinorhizobium medicae WSM419] 1 1e-107
190891566441 homoserine dehydrogenase [Rhizobium etli CIAT 652] Leng 1 1e-107
327190811441 homoserine dehydrogenase protein [Rhizobium etli CNPAF5 1 1e-107
>gi|315122681|ref|YP_004063170.1| homoserine dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 434 Back     alignment and organism information
 Score =  643 bits (1658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 310/435 (71%), Positives = 373/435 (85%), Gaps = 1/435 (0%)

Query: 1   MAGVLKVGVAGLGTVGSALIRSIQKREGRFKDLDQHSFVVSAISARDKNIDRGIDCLRYE 60
           M  VL++GVAGLGTVGS+LI+ IQ+RE R K  D  SFVVSAISARD+NIDRGID +  E
Sbjct: 1   MENVLRIGVAGLGTVGSSLIKIIQEREERLKGTDHLSFVVSAISARDRNIDRGIDLVDAE 60

Query: 61  WFDDPLIMAGEADIDVFVELIGGEDYPAYDAVRIALMRGCHVVTANKALIASHGKDLALL 120
           WFDDP++MA +ADIDVFVE+IGG+ YPAYD+VR+AL+RGCHVVTANKALIA+HG DL+LL
Sbjct: 61  WFDDPIVMADKADIDVFVEVIGGKGYPAYDSVRVALIRGCHVVTANKALIANHGVDLSLL 120

Query: 121 AQKNNAILNFEAAVAGGIPIIRILKNYVEYDEINRVYGIINGTCNYILSHMNNLGLSFQD 180
           AQ+N   L+FEAAVAGGIP+I++LK+YVEYD+INR+YGIINGTCNY+LSHMN + LSF++
Sbjct: 121 AQQNKTTLSFEAAVAGGIPVIKVLKDYVEYDKINRIYGIINGTCNYMLSHMNKMELSFEE 180

Query: 181 CLEEARRQGYAEGDATFDINGVDSSHKIAILSAIAFGIDTSVEGVYCEGISNITLEDIRG 240
           CL+EA+R GYAE +A FDING+DS+HK+AILS+IAFGI+TSVEG+YCEGIS+ITLED+R 
Sbjct: 181 CLDEAKRCGYAEDNAEFDINGIDSTHKLAILSSIAFGINTSVEGIYCEGISSITLEDVRV 240

Query: 241 AADFGYCIKFLAMARRKGKGIIRYVYPVLLKYDSVMALVDGITNAVVIETNGLGKLTMTG 300
           AADFGY IK LA+A+RK + I+RYVYP LLK DS MALVDGITNAVVIET  LGKL M G
Sbjct: 241 AADFGYDIKLLAIAQRKDEKIVRYVYPALLKSDSTMALVDGITNAVVIETEVLGKLVMIG 300

Query: 301 PGAGGSATASAVLGDICSIAKTNTQKSVSWALGKESSSFSVIHCDGVYEEEKEYFIRLTI 360
           PGAGG+ TASAVL +IC+IAK +T+KSVS ALG  SS+  +  C+  YE+EKEYFIRL I
Sbjct: 301 PGAGGNPTASAVLDNICNIAKIDTEKSVSLALGNVSSTL-IGQCNNAYEQEKEYFIRLKI 359

Query: 361 RNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGKLIRDAIECFNGK 420
           RN EG+LDKI +QM+DF+I  RL +CPHQ+ENSQE SVFMITH+VSG  I +AI+C N K
Sbjct: 360 RNDEGVLDKIIAQMADFHIFFRLLTCPHQDENSQECSVFMITHEVSGISIHNAIQCINDK 419

Query: 421 SDAIRYSCVICIENF 435
           SD I+YS VICIEN 
Sbjct: 420 SDVIQYSRVICIENL 434


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227821963|ref|YP_002825934.1| homoserine dehydrogenase [Sinorhizobium fredii NGR234] Length = 440 Back     alignment and organism information
>gi|222148682|ref|YP_002549639.1| homoserine dehydrogenase [Agrobacterium vitis S4] Length = 440 Back     alignment and organism information
>gi|159184828|ref|NP_354583.2| homoserine dehydrogenase [Agrobacterium tumefaciens str. C58] Length = 436 Back     alignment and organism information
>gi|307302596|ref|ZP_07582352.1| Homoserine dehydrogenase [Sinorhizobium meliloti BL225C] Length = 440 Back     alignment and organism information
>gi|15965475|ref|NP_385828.1| homoserine dehydrogenase [Sinorhizobium meliloti 1021] Length = 440 Back     alignment and organism information
>gi|325292977|ref|YP_004278841.1| Homoserine dehydrogenase [Agrobacterium sp. H13-3] Length = 436 Back     alignment and organism information
>gi|150396666|ref|YP_001327133.1| homoserine dehydrogenase [Sinorhizobium medicae WSM419] Length = 440 Back     alignment and organism information
>gi|190891566|ref|YP_001978108.1| homoserine dehydrogenase [Rhizobium etli CIAT 652] Length = 441 Back     alignment and organism information
>gi|327190811|gb|EGE57879.1| homoserine dehydrogenase protein [Rhizobium etli CNPAF512] Length = 441 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target438 homoserine dehydrogenase [Candidatus Liberibacter asiat
PRK06349426 PRK06349, PRK06349, homoserine dehydrogenase; Provision 1e-122
PRK06270341 PRK06270, PRK06270, homoserine dehydrogenase; Provision 1e-61
PRK08374336 PRK08374, PRK08374, homoserine dehydrogenase; Provision 2e-43
PRK06813346 PRK06813, PRK06813, homoserine dehydrogenase; Validated 4e-28
PRK09436819 PRK09436, thrA, bifunctional aspartokinase I/homoserine 1e-18
COG0460333 COG0460, ThrA, Homoserine dehydrogenase [Amino acid tra 1e-87
pfam00742179 pfam00742, Homoserine_dh, Homoserine dehydrogenase 2e-57
PRK06392326 PRK06392, PRK06392, homoserine dehydrogenase; Provision 1e-22
KOG0455364 KOG0455, KOG0455, KOG0455, Homoserine dehydrogenase [Am 7e-19
PLN02700377 PLN02700, PLN02700, homoserine dehydrogenase family pro 8e-11
PRK09466810 PRK09466, metL, bifunctional aspartate kinase II/homose 4e-10
pfam03447116 pfam03447, NAD_binding_3, Homoserine dehydrogenase, NAD 8e-07
cd0488179 cd04881, ACT_HSDH-Hom, ACT_HSDH_Hom CD includes the C-t 3e-04
>gnl|CDD|180538 PRK06349, PRK06349, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180500 PRK06270, PRK06270, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|169409 PRK08374, PRK08374, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168683 PRK06813, PRK06813, homoserine dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|181856 PRK09436, thrA, bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>gnl|CDD|30808 COG0460, ThrA, Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|144371 pfam00742, Homoserine_dh, Homoserine dehydrogenase Back     alignment and domain information
>gnl|CDD|102354 PRK06392, PRK06392, homoserine dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|35676 KOG0455, KOG0455, KOG0455, Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|178303 PLN02700, PLN02700, homoserine dehydrogenase family protein Back     alignment and domain information
>gnl|CDD|181881 PRK09466, metL, bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>gnl|CDD|146203 pfam03447, NAD_binding_3, Homoserine dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|153153 cd04881, ACT_HSDH-Hom, ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 438 homoserine dehydrogenase [Candidatus Liberibacter asiat
PRK06349432 homoserine dehydrogenase; Provisional 100.0
TIGR00978358 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: 97.36
PRK06545357 prephenate dehydrogenase; Validated 96.73
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino acid tr 96.54
TIGR01327535 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR0 93.44
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transport and 100.0
PRK06270342 homoserine dehydrogenase; Provisional 100.0
PRK06813341 homoserine dehydrogenase; Validated 100.0
PRK06392326 homoserine dehydrogenase; Provisional 100.0
PRK08374316 homoserine dehydrogenase; Provisional 100.0
PRK09466810 metL bifunctional aspartate kinase II/homoserine dehydr 100.0
PRK09436817 thrA bifunctional aspartokinase I/homeserine dehydrogen 100.0
KOG0455364 consensus 100.0
pfam00742179 Homoserine_dh Homoserine dehydrogenase. 100.0
pfam03447116 NAD_binding_3 Homoserine dehydrogenase, NAD binding dom 99.9
PRK13302271 putative L-aspartate dehydrogenase; Provisional 99.18
PRK13304265 L-aspartate dehydrogenase; Reviewed 99.12
pfam01408120 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossman 99.1
PRK13303265 L-aspartate dehydrogenase; Provisional 99.05
COG1712255 Predicted dinucleotide-utilizing enzyme [General functi 98.98
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.85
PRK05447379 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 98.69
PRK00048265 dihydrodipicolinate reductase; Provisional 98.28
pfam01113122 DapB_N Dihydrodipicolinate reductase, N-terminus. Dihyd 98.1
TIGR01921326 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR0101 98.05
pfam03435384 Saccharop_dh Saccharopine dehydrogenase. This family co 98.04
TIGR00036281 dapB dihydrodipicolinate reductase; InterPro: IPR011770 98.01
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid transpor 97.89
pfam02670129 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoi 97.89
TIGR00243406 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase; In 97.67
pfam03446163 NAD_binding_2 NAD binding domain of 6-phosphogluconate 97.65
PRK08300298 acetaldehyde dehydrogenase; Validated 97.12
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 97.08
PRK08040337 putative semialdehyde dehydrogenase; Provisional 97.04
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating). 96.94
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validated 96.79
PRK12490298 6-phosphogluconate dehydrogenase-like protein; Reviewed 96.7
PRK06598348 aspartate-semialdehyde dehydrogenase; Reviewed 96.63
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Reviewed 96.54
pfam00044150 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 96.47
pfam01210159 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehyd 96.27
COG3367339 Uncharacterized conserved protein [Function unknown] 96.19
COG3804350 Uncharacterized conserved protein related to dihydrodip 95.25
PRK00683418 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 94.37
pfam02826176 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogen 94.08
TIGR03376342 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+ 93.69
TIGR02853288 spore_dpaA dipicolinic acid synthetase, A subunit; Inte 93.56
TIGR01087476 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; I 93.13
KOG2711372 consensus 92.33
CHL00194319 ycf39 Ycf39; Provisional 91.9
PRK12767325 carbamoyl phosphate synthase-like protein; Provisional 91.38
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimat 91.09
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.07
PRK10675338 UDP-galactose-4-epimerase; Provisional 90.71
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucin 90.08
KOG2018430 consensus 90.03
cd0488179 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal AC 99.82
LOAD_ACT76 consensus 98.52
pfam0184266 ACT ACT domain. This family of domains generally have a 98.08
CHL00100172 ilvH acetohydroxyacid synthase small subunit 97.95
cd0487872 ACT_AHAS N-terminal ACT domain of the Escherichia coli 97.93
PRK11895161 ilvH acetolactate synthase 3 regulatory subunit; Review 97.93
PRK08577135 hypothetical protein; Provisional 97.91
cd0487671 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/S 97.8
PRK0817896 acetolactate synthase 1 regulatory subunit; Reviewed 97.79
PRK0673776 acetolactate synthase 1 regulatory subunit; Validated 97.66
PRK10872743 relA GDP/GTP pyrophosphokinase; Provisional 97.61
PRK11092702 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bi 97.53
PRK13581524 D-3-phosphoglycerate dehydrogenase; Provisional 97.44
cd0487472 ACT_Af1403 N-terminal ACT domain of the yet uncharacter 97.42
cd0490273 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3 97.34
cd0488372 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis 97.31
cd0490371 ACT_LSD C-terminal ACT domain of the L-serine dehydrata 97.3
COG0440163 IlvH Acetolactate synthase, small (regulatory) subunit 97.22
PRK04435146 hypothetical protein; Provisional 97.2
cd0488876 ACT_PheB-BS C-terminal ACT domain of a small (~147 a.a. 97.2
cd0488673 ACT_ThrD-II-like C-terminal ACT domain of biodegradativ 97.19
PRK1356284 acetolactate synthase 1 regulatory subunit; Provisional 97.18
cd0490969 ACT_PDH-BS C-terminal ACT domain of the monofunctional, 97.1
COG0317701 SpoT Guanosine polyphosphate pyrophosphohydrolases/synt 96.99
cd0487971 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-termina 96.99
cd0493190 ACT_PAH ACT domain of the nonheme iron-dependent aromat 96.92
cd0490580 ACT_CM-PDT C-terminal ACT domain of the bifunctional ch 96.91
cd0211660 ACT ACT domains are commonly involved in specifically b 96.86
cd0492974 ACT_TPH ACT domain of the nonheme iron-dependent aromat 96.85
cd0488075 ACT_AAAH-PDT-like ACT domain of the nonheme iron-depend 96.82
cd0490474 ACT_AAAH ACT domain of the nonheme iron-dependent, arom 96.81
PRK11899284 prephenate dehydratase; Provisional 96.73
cd0487288 ACT_1ZPV ACT domain proteins similar to the yet unchara 96.7
PRK0019490 hypothetical protein; Validated 96.6
COG4492150 PheB ACT domain-containing protein [General function pr 96.6
PRK10622386 pheA bifunctional chorismate mutase/prephenate dehydrat 96.59
cd0491375 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensi 96.59
cd0490169 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Pho 96.53
cd0488265 ACT_Bt0572_2 C-terminal ACT domain of a novel protein c 96.47
PRK11898285 prephenate dehydratase; Provisional 96.35
COG0077279 PheA Prephenate dehydratase [Amino acid transport and m 96.28
cd0487574 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofo 96.25
cd0489161 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensi 96.21
cd0486981 ACT_GcvR_2 ACT domains that comprise the Glycine Cleava 96.21
COG2150167 Predicted regulator of amino acid metabolism, contains 96.2
COG1707 218 ACT domain-containing protein [General function predict 96.16
cd0488774 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-termina 96.09
cd0488472 ACT_CBS C-terminal ACT domain of the cystathionine beta 96.08
KOG2663 309 consensus 95.91
cd0492672 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT 95.57
TIGR00691741 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 95.47
cd0489970 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacter 95.37
cd0487370 ACT_UUR-ACR-like ACT domains of the bacterial signal-tr 95.31
COG4747142 ACT domain-containing protein [General function predict 95.07
PRK07431594 aspartate kinase; Provisional 94.79
cd0490866 ACT_Bt0572_1 N-terminal ACT domain of a novel protein c 94.68
COG4747142 ACT domain-containing protein [General function predict 94.48
cd0487075 ACT_PSP_1 CT domains found N-terminal of phosphoserine 94.47
PRK07431 594 aspartate kinase; Provisional 94.3
COG383090 ACT domain-containing protein [Signal transduction mech 94.17
TIGR00119 205 acolac_sm acetolactate synthase, small subunit; InterPr 93.54
TIGR00655 294 PurU formyltetrahydrofolate deformylase; InterPro: IPR0 93.29
cd0489265 ACT_AK-like_2 ACT domains C-terminal to the catalytic d 93.02
cd0492180 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctiona 92.82
cd04930115 ACT_TH ACT domain of the nonheme iron-dependent aromati 91.7
cd0492466 ACT_AK-Arch_2 ACT domains of a monofunctional aspartoki 91.01
cd0492266 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enz 90.84
cd0492363 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensi 90.63
cd0491966 ACT_AK-Hom3_2 ACT domains located C-terminal to the cat 90.61
cd0491275 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal 90.25
PRK11579346 putative oxidoreductase; Provisional 99.56
COG0673342 MviM Predicted dehydrogenases and related proteins [Gen 99.42
KOG2741351 consensus 99.39
PRK10206345 putative dehydrogenase; Provisional 99.39
PRK12464392 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provis 98.51
COG0743385 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Li 98.49
COG1748389 LYS9 Saccharopine dehydrogenase and related proteins [A 98.07
TIGR03450351 mycothiol_INO1 inositol 1-phosphate synthase, Actinobac 97.98
COG1260362 INO1 Myo-inositol-1-phosphate synthase [Lipid metabolis 97.25
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose 97.19
PRK04207338 glyceraldehyde-3-phosphate dehydrogenase; Provisional 97.18
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 97.07
PRK08955333 glyceraldehyde-3-phosphate dehydrogenase; Validated 96.95
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 96.78
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisional 96.24
COG4693361 PchG Oxidoreductase (NAD-binding), involved in sideroph 95.42
TIGR01546335 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenas 93.75
COG4091438 Predicted homoserine dehydrogenase [Amino acid transpor 99.18
TIGR01532334 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; In 95.95
KOG2742367 consensus 95.55
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogena 95.35
COG0240329 GpsA Glycerol-3-phosphate dehydrogenase [Energy product 95.16
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.54
PRK11559295 garR tartronate semialdehyde reductase; Provisional 97.68
PRK06130310 3-hydroxybutyryl-CoA dehydrogenase; Validated 97.3
COG2084286 MmsB 3-hydroxyisobutyrate dehydrogenase and related bet 97.23
KOG0409327 consensus 96.85
PRK07660283 consensus 96.06
PRK09260289 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.61
PRK08293288 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.45
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.42
TIGR01761378 thiaz-red thiazolinyl imide reductase; InterPro: IPR010 95.29
PRK08268503 3-hydroxybutyryl-CoA dehydrogenase; Validated 95.05
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of gluta 93.83
PRK08507275 prephenate dehydrogenase; Validated 93.55
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate de 93.04
PRK07819284 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.85
PRK09117282 consensus 92.05
PTZ00142474 6-phosphogluconate dehydrogenase; Provisional 91.46
PRK12921306 2-dehydropantoate 2-reductase; Provisional 90.55
PRK08618325 ornithine cyclodeaminase; Validated 90.02
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 97.51
PRK08664350 aspartate-semialdehyde dehydrogenase; Reviewed 97.16
pfam01118121 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 97.12
PRK00436345 argC N-acetyl-gamma-glutamyl-phosphate reductase; Valid 97.04
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 96.17
PRK07680273 late competence protein ComER; Validated 96.14
PRK06901323 aspartate-semialdehyde dehydrogenase; Provisional 96.1
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino 95.58
PRK06476255 pyrroline-5-carboxylate reductase; Reviewed 95.42
pfam0380793 F420_oxidored NADP oxidoreductase coenzyme F420-depende 95.42
pfam0262996 CoA_binding CoA binding domain. This domain has a Rossm 95.3
COG0345266 ProC Pyrroline-5-carboxylate reductase [Amino acid tran 95.25
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 95.17
PRK12491272 pyrroline-5-carboxylate reductase; Reviewed 95.13
PRK07502307 cyclohexadienyl dehydrogenase; Validated 95.06
PRK05472211 redox-sensing transcriptional repressor Rex; Provisiona 95.02
TIGR02964270 xanthine_xdhC xanthine dehydrogenase accessory protein 94.91
PRK07679279 pyrroline-5-carboxylate reductase; Reviewed 94.9
COG1179263 Dinucleotide-utilizing enzymes involved in molybdopteri 94.11
TIGR01850361 argC N-acetyl-gamma-glutamyl-phosphate reductase; Inter 94.1
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding 94.03
PRK11863314 N-acetyl-gamma-glutamyl-phosphate reductase; Provisiona 93.95
COG2344211 AT-rich DNA-binding protein [General function predictio 93.85
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 93.83
cd00755231 YgdL_like Family of activating enzymes (E1) of ubiquiti 93.79
pfam02423312 OCD_Mu_crystall Ornithine cyclodeaminase/mu-crystallin 93.58
PRK06928275 pyrroline-5-carboxylate reductase; Reviewed 93.51
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 93.06
pfam02737180 3HCDH_N 3-hydroxyacyl-CoA dehydrogenase, NAD binding do 92.95
PRK06199379 ornithine cyclodeaminase; Validated 92.49
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondar 92.48
PRK00141476 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.3
pfam06408471 consensus 92.21
PRK04663438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 92.04
PRK07417280 arogenate dehydrogenase; Reviewed 91.94
PRK05442325 malate dehydrogenase; Provisional 91.89
PRK07531489 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioestera 91.8
PRK03369487 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syntheta 91.63
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 91.47
PRK06823315 ornithine cyclodeaminase; Validated 91.04
PRK06407302 ornithine cyclodeaminase; Provisional 91.03
PRK08291330 ornithine cyclodeaminase; Validated 90.73
KOG2380480 consensus 90.64
PRK06046326 alanine dehydrogenase; Validated 90.22
PRK08526403 threonine dehydratase; Provisional 96.97
PRK06382400 threonine dehydratase; Provisional 96.7
PRK08198406 threonine dehydratase; Provisional 96.54
PRK07334399 threonine dehydratase; Provisional 96.18
) and D-serine dehydratase () catalyze the dehydratation of L-serine (respectively D-serine) into ammonia and pyruvate. Threonine dehydratase () (TDH) catalyzes the dehydratation of threonine into alpha-ketobutarate and ammonia. In Escherichia coli and other microorganisms, two classes of TDH are known to exist. One is involved in the biosynthesis of isoleucine, the other in hydroxamino acid catabolism. Threonine synthase () is also a pyridoxal-phosphate enzyme, it catalyzes the transformation of homoserine-phosphate into threonine. It has been shown that threonine synthase is distantly related to the serine/threonine dehydratases. In all these enzymes, the pyridoxal-phosphate group is attached to a lysine residue. A form of threonine dehydratase with two copies of the C-terminal domain is described by . This model describes a phylogenetically distinct which branches with the catabolic threonine dehydratase of E. coli; many members are designated as catabolic for this reason. However, the catabolic form lacks any domain. Many members of this model are found in species with other isoleucine biosynthetic enzymes.; GO: 0004794 L-threonine ammonia-lyase activity." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR01127">TIGR01127381 ilvA_1Cterm threonine dehydratase; InterPro: IPR005789 96.07
PRK08639418 threonine dehydratase; Validated 91.5
PRK11589183 gcvR glycine cleavage system transcriptional repressor; 96.64
cd0488956 ACT_PDH-BS-like C-terminal ACT domain of the monofuncti 96.4
COG2716176 GcvR Glycine cleavage system regulatory protein [Amino 96.1
PRK01759862 glnD PII uridylyl-transferase; Provisional 95.98
PRK04374869 PII uridylyl-transferase; Provisional 95.62
PRK13010 289 purU formyltetrahydrofolate deformylase; Reviewed 95.62
PRK00275894 glnD PII uridylyl-transferase; Provisional 95.1
PRK05092934 PII uridylyl-transferase; Provisional 95.09
PRK03059857 PII uridylyl-transferase; Provisional 94.96
PRK05007881 PII uridylyl-transferase; Provisional 94.86
cd0489572 ACT_ACR_1 ACT domain-containing protein which is compos 93.39
cd0490073 ACT_UUR-like_1 ACT domain family, ACT_UUR-like_1, inclu 93.19
cd0492574 ACT_ACR_2 ACT domain-containing protein which is compos 90.65
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD b 96.34
pfam07994389 NAD_binding_5 Myo-inositol-1-phosphate synthase. This i 95.88
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate de 94.68
cd00757228 ThiF_MoeB_HesA_family ThiF_MoeB_HesA. Family of E1-like 92.81
PRK08223287 hypothetical protein; Validated 92.69
COG2085211 Predicted dinucleotide-binding enzymes [General functio 91.28
PRK05690245 molybdopterin biosynthesis protein MoeB; Provisional 90.68
PRK13011287 formyltetrahydrofolate deformylase; Reviewed 96.26
PRK06027285 purU formyltetrahydrofolate deformylase; Reviewed 96.06
COG0788287 PurU Formyltetrahydrofolate hydrolase [Nucleotide trans 92.61
PRK06932314 glycerate dehydrogenase; Provisional 92.07
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Ami 90.76
PRK11154706 fadJ multifunctional fatty acid oxidation complex subun 96.16
PRK11730715 fadB multifunctional fatty acid oxidation complex subun 95.51
PRK03381781 PII uridylyl-transferase; Provisional 95.95
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 95.91
COG2844867 GlnD UTP:GlnB (protein PII) uridylyltransferase [Posttr 95.21
TIGR01693903 UTase_glnD protein-P-II uridylyltransferase; InterPro: 91.8
PRK13243333 glyoxylate reductase; Reviewed 94.53
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 93.82
PRK07574385 formate dehydrogenase; Provisional 93.43
COG0111324 SerA Phosphoglycerate dehydrogenase and related dehydro 93.18
PRK06141313 ornithine cyclodeaminase; Validated 91.67
PRK05396341 tdh L-threonine 3-dehydrogenase; Validated 91.12
PRK06635402 aspartate kinase; Reviewed 91.1
PRK00045429 hemA glutamyl-tRNA reductase; Reviewed 90.35
PRK12480330 D-lactate dehydrogenase; Provisional 90.34
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase; InterPro: IPR005676 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>PRK06545 prephenate dehydrogenase; Validated Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase; InterPro: IPR006236 This group of sequences represent the long form of D-3-phosphoglycerate dehydrogenase, they include the serA gene of one pathway of serine biosynthesis Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homeserine dehydrogenase I; Provisional Back     alignment and domain information
>KOG0455 consensus Back     alignment and domain information
>pfam00742 Homoserine_dh Homoserine dehydrogenase Back     alignment and domain information
>pfam03447 NAD_binding_3 Homoserine dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>pfam01408 GFO_IDH_MocA Oxidoreductase family, NAD-binding Rossmann fold Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>pfam01113 DapB_N Dihydrodipicolinate reductase, N-terminus Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase; InterPro: IPR010190 This entry represents the diaminopimelate dehydrogenase enzyme which provides an alternate (shortcut) route of lysine biosynthesis in Corynebacterium, Bacterioides, Porphyromonas and other species Back     alignment and domain information
>pfam03435 Saccharop_dh Saccharopine dehydrogenase Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase; InterPro: IPR011770 Dihydrodipicolinate reductase is an enzyme found in bacteria and higher plants which is involved in the biosynthesis of diaminopimelic acid, a component of bacterial cell walls, and the essential amino acid L-lysine Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>pfam02670 DXP_reductoisom 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR003821 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesizes 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms Back     alignment and domain information
>pfam03446 NAD_binding_2 NAD binding domain of 6-phosphogluconate dehydrogenase Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK12490 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>pfam00044 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>pfam01210 NAD_Gly3P_dh_N NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus Back     alignment and domain information
>COG3367 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>PRK00683 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>pfam02826 2-Hacid_dh_C D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain Back     alignment and domain information
>TIGR03376 glycerol3P_DH glycerol-3-phosphate dehydrogenase (NAD(+)) Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit; InterPro: IPR014215 This predicted Rossman fold-containing protein is the A subunit of dipicolinic acid synthetase as found in most, though not all, endospore-forming low-GC Gram-positive bacteria; it is absent in Clostridium Back     alignment and domain information
>TIGR01087 murD UDP-N-acetylmuramoylalanine--D-glutamate ligase; InterPro: IPR005762 The bacterial cell wall provides strength and rigidity to counteract internal osmotic pressure, and protection against the environment Back     alignment and domain information
>KOG2711 consensus Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PRK12767 carbamoyl phosphate synthase-like protein; Provisional Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>KOG2018 consensus Back     alignment and domain information
>cd04881 ACT_HSDH-Hom ACT_HSDH_Hom CD includes the C-terminal ACT domain of the NAD(P)H-dependent, homoserine dehydrogenase (HSDH) and related domains Back     alignment and domain information
>LOAD_ACT consensus Back     alignment and domain information
>pfam01842 ACT ACT domain Back     alignment and domain information
>CHL00100 ilvH acetohydroxyacid synthase small subunit Back     alignment and domain information
>cd04878 ACT_AHAS N-terminal ACT domain of the Escherichia coli IlvH-like regulatory subunit of acetohydroxyacid synthase (AHAS) Back     alignment and domain information
>PRK11895 ilvH acetolactate synthase 3 regulatory subunit; Reviewed Back     alignment and domain information
>PRK08577 hypothetical protein; Provisional Back     alignment and domain information
>cd04876 ACT_RelA-SpoT ACT domain found C-terminal of the RelA/SpoT domains Back     alignment and domain information
>PRK08178 acetolactate synthase 1 regulatory subunit; Reviewed Back     alignment and domain information
>PRK06737 acetolactate synthase 1 regulatory subunit; Validated Back     alignment and domain information
>PRK10872 relA GDP/GTP pyrophosphokinase; Provisional Back     alignment and domain information
>PRK11092 bifunctional (p)ppGpp synthetase II/ guanosine-3',5'-bis pyrophosphate 3'-pyrophosphohydrolase; Provisional Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>cd04874 ACT_Af1403 N-terminal ACT domain of the yet uncharacterized, small (~133 a Back     alignment and domain information
>cd04902 ACT_3PGDH-xct C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04883 ACT_AcuB C-terminal ACT domain of the Bacillus subtilis acetoin utilization protein, AcuB Back     alignment and domain information
>cd04903 ACT_LSD C-terminal ACT domain of the L-serine dehydratase (LSD), iron-sulfur-dependent, beta subunit Back     alignment and domain information
>COG0440 IlvH Acetolactate synthase, small (regulatory) subunit [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04435 hypothetical protein; Provisional Back     alignment and domain information
>cd04888 ACT_PheB-BS C-terminal ACT domain of a small (~147 a Back     alignment and domain information
>cd04886 ACT_ThrD-II-like C-terminal ACT domain of biodegradative (catabolic) threonine dehydratase II (ThrD-II) and other related ACT domains Back     alignment and domain information
>PRK13562 acetolactate synthase 1 regulatory subunit; Provisional Back     alignment and domain information
>cd04909 ACT_PDH-BS C-terminal ACT domain of the monofunctional, NAD dependent, prephenate dehydrogenase (PDH) Back     alignment and domain information
>COG0317 SpoT Guanosine polyphosphate pyrophosphohydrolases/synthetases [Signal transduction mechanisms / Transcription] Back     alignment and domain information
>cd04879 ACT_3PGDH-like ACT_3PGDH-like CD includes the C-terminal ACT (regulatory) domain of D-3-phosphoglycerate dehydrogenase (3PGDH) Back     alignment and domain information
>cd04931 ACT_PAH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, phenylalanine hydroxylases (PAH) Back     alignment and domain information
>cd04905 ACT_CM-PDT C-terminal ACT domain of the bifunctional chorismate mutase-prephenate dehydratase (CM-PDT) enzyme and the prephenate dehydratase (PDT) enzyme Back     alignment and domain information
>cd02116 ACT ACT domains are commonly involved in specifically binding an amino acid or other small ligand leading to regulation of the enzyme Back     alignment and domain information
>cd04929 ACT_TPH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tryptophan hydroxylases (TPH), both peripheral (TPH1) and neuronal (TPH2) enzymes Back     alignment and domain information
>cd04880 ACT_AAAH-PDT-like ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>cd04904 ACT_AAAH ACT domain of the nonheme iron-dependent, aromatic amino acid hydroxylases (AAAH) Back     alignment and domain information
>PRK11899 prephenate dehydratase; Provisional Back     alignment and domain information
>cd04872 ACT_1ZPV ACT domain proteins similar to the yet uncharacterized Streptococcus pneumoniae ACT domain protein Back     alignment and domain information
>PRK00194 hypothetical protein; Validated Back     alignment and domain information
>COG4492 PheB ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK10622 pheA bifunctional chorismate mutase/prephenate dehydratase; Provisional Back     alignment and domain information
>cd04913 ACT_AKii-LysC-BS-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related proteins Back     alignment and domain information
>cd04901 ACT_3PGDH C-terminal ACT (regulatory) domain of D-3-Phosphoglycerate Dehydrogenase (3PGDH) found in fungi and bacteria Back     alignment and domain information
>cd04882 ACT_Bt0572_2 C-terminal ACT domain of a novel protein composed of just two ACT domains Back     alignment and domain information
>PRK11898 prephenate dehydratase; Provisional Back     alignment and domain information
>COG0077 PheA Prephenate dehydratase [Amino acid transport and metabolism] Back     alignment and domain information
>cd04875 ACT_F4HF-DF N-terminal ACT domain of formyltetrahydrofolate deformylase (F4HF-DF; formyltetrahydrofolate hydrolase) Back     alignment and domain information
>cd04891 ACT_AK-LysC-DapG-like_1 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII and related proteins Back     alignment and domain information
>cd04869 ACT_GcvR_2 ACT domains that comprise the Glycine Cleavage System Transcriptional Repressor (GcvR) protein, and other related domains Back     alignment and domain information
>COG2150 Predicted regulator of amino acid metabolism, contains ACT domain [General function prediction only] Back     alignment and domain information
>COG1707 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04887 ACT_MalLac-Enz ACT_MalLac-Enz CD includes the N-terminal ACT domain of putative NAD-dependent malic enzyme 1, Bacillus subtilis YqkI and related domains Back     alignment and domain information
>cd04884 ACT_CBS C-terminal ACT domain of the cystathionine beta-synthase (CBS) domain protein found in Thermotoga maritima, Tm0935, and delta proteobacteria Back     alignment and domain information
>KOG2663 consensus Back     alignment and domain information
>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein) Back     alignment and domain information
>TIGR00691 spoT_relA RelA/SpoT family protein; InterPro: IPR004811 The functions of Escherichia coli RelA and SpoT differ somewhat Back     alignment and domain information
>cd04899 ACT_ACR-UUR-like_2 C-terminal ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD and related domains Back     alignment and domain information
>cd04873 ACT_UUR-ACR-like ACT domains of the bacterial signal-transducing uridylyltransferase /uridylyl-removing (UUR) enzyme, GlnD Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>cd04908 ACT_Bt0572_1 N-terminal ACT domain of a novel protein composed almost entirely of two tandem ACT domains Back     alignment and domain information
>COG4747 ACT domain-containing protein [General function prediction only] Back     alignment and domain information
>cd04870 ACT_PSP_1 CT domains found N-terminal of phosphoserine phosphatase (PSP, SerB) Back     alignment and domain information
>PRK07431 aspartate kinase; Provisional Back     alignment and domain information
>COG3830 ACT domain-containing protein [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00119 acolac_sm acetolactate synthase, small subunit; InterPro: IPR004789 Acetolactate synthases are a group of biosynthetic enzymes apparently found in plants, fungi and bacteria that are capable of de novo synthesis of the branched-chain amino acids Back     alignment and domain information
>TIGR00655 PurU formyltetrahydrofolate deformylase; InterPro: IPR004810 An Escherichia coli gene designated purU has been identified and characterised Back     alignment and domain information
>cd04892 ACT_AK-like_2 ACT domains C-terminal to the catalytic domain of aspartokinase (AK; 4-L-aspartate-4-phosphotransferase) Back     alignment and domain information
>cd04921 ACT_AKi-HSDH-ThrA-like_1 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04930 ACT_TH ACT domain of the nonheme iron-dependent aromatic amino acid hydroxylase, tyrosine hydroxylases (TH) Back     alignment and domain information
>cd04924 ACT_AK-Arch_2 ACT domains of a monofunctional aspartokinase found mostly in Archaea species (ACT_AK-Arch_2) Back     alignment and domain information
>cd04922 ACT_AKi-HSDH-ThrA_2 ACT domains of the bifunctional enzyme aspartokinase (AK) - homoserine dehydrogenase (HSDH) Back     alignment and domain information
>cd04923 ACT_AK-LysC-DapG-like_2 ACT domains of the lysine-sensitive aspartokinase isoenzyme AKII of Bacillus subtilis (BS) strain 168 and related domains Back     alignment and domain information
>cd04919 ACT_AK-Hom3_2 ACT domains located C-terminal to the catalytic domain of the aspartokinase (AK) HOM3 Back     alignment and domain information
>cd04912 ACT_AKiii-LysC-EC-like_1 ACT domains located C-terminal to the catalytic domain of the lysine-sensitive aspartokinase isoenzyme AKIII Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>KOG2741 consensus Back     alignment and domain information
>PRK10206 putative dehydrogenase; Provisional Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>COG0743 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase [Lipid metabolism] Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03450 mycothiol_INO1 inositol 1-phosphate synthase, Actinobacterial type Back     alignment and domain information
>COG1260 INO1 Myo-inositol-1-phosphate synthase [Lipid metabolism] Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG4693 PchG Oxidoreductase (NAD-binding), involved in siderophore biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II; InterPro: IPR006436 This family describes the type II glyceraldehyde-3-phosphate dehydrogenases which are limited to archaea Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase; InterPro: IPR006422 This group of sequences represent the small clade of dehydrogenases in gamma-proteobacteria which utilise NAD+ to oxidize erythrose-4-phosphate (E4P) to 4-phospho-erythronate, a precursor for the de novo synthesis of pyridoxine via 4-hydroxythreonine and D-1-deoxyxylulose Back     alignment and domain information
>KOG2742 consensus Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>COG0240 GpsA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG2084 MmsB 3-hydroxyisobutyrate dehydrogenase and related beta-hydroxyacid dehydrogenases [Lipid metabolism] Back     alignment and domain information
>KOG0409 consensus Back     alignment and domain information
>PRK07660 consensus Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase; InterPro: IPR010091 This reductase is found associated with gene clusters for the biosynthesis of various non-ribosomal peptide derived natural products in which cysteine is cyclised to a thiazoline ring containing an imide double bond Back     alignment and domain information
>PRK08268 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK09117 consensus Back     alignment and domain information
>PTZ00142 6-phosphogluconate dehydrogenase; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08618 ornithine cyclodeaminase; Validated Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>pfam01118 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information