254780903

254780903

two-component sensor histidine kinase protein

GeneID in NCBI database:8209923Locus tag:CLIBASIA_04010
Protein GI in NCBI database:254780903Protein Accession:YP_003065316.1
Gene range:-(881796, 884096)Protein Length:766aa
Gene description:two-component sensor histidine kinase protein
COG prediction:[T] Signal transduction histidine kinase
KEGG prediction:two-component sensor histidine kinase protein; K07716 two-component system, cell cycle sensor histidine kinase PleC [EC:2.7.13.3]
SEED prediction:Two-component sensor histidine kinase PleC
Pathway involved in KEGG:Two-component system [PATH:las02020]
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMM2 TM-Helix
TOPPRED4 TM-Helix
HMMTOP2 TM-Helix
MEMSAT1 TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS2 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760------
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
cccHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccHHHcccccccEEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEEccccHHHHHHHHHHHHHHHccccccccEEEEccccccccHHHHHHHHcccccccEEEEccccccccccccccEEEEEHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccEEEEEccccEEEEcHHHHHHHcccHHHHHHccHHHHHHccHHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEEEEEEEEEccccEEEEEEEccccHHHcccccccccccccccccccccccHHccccccHHHHHHHHHHHHHcccHHHccccccccEEEcccccHHHHHHHHHHHHHHHHHHcccccccccHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHcccccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEHHHHHHHHHHHHHHHHHHccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHcccccEEEEEEEccccEEEEEEEEccccccHHHHHHHccccEEccccccccccccHHHHHHHHHHHHHcccEEEEEEEccccEEEEEEccc
cHHHHHHHHHHHcccccccccEEEEEcccHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHcHHHHHHHHHHHcccccccccEEEEEEccccEEEEEccccHHHccccHHHHHHHccHHHHccccccEEEEcccccHHHHHHHHHHcccccEEEEcccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHcccHHHHcccHHHHHHHccHHHHHHHHHHHHHHHHcccccEEEEEEEcccccEEEEEEEcccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEEcHHHHHHHcccHHHHccccHHHHcccccHHHHHHHHHHHHHcccccEEEEEEccccEEEEEEEEcccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHcccccHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEEcccHHHHHHHHHHHHHHHHHHcccEEEEEcccccEEEccHHHHHHHHHHHHHHHHEEcccccEEEEEEEEcccEEEEEEEEccccccHHHHHHHHcccHEccccccccccccHHHHHHHHHHHHHcccEEEEEEcccccEEEEEEccc
MENMQNILAnyglyypgnrqkiTVSSKQAFKRAYTSIISHLFSFfssfnqtipMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFqnnnikfdlASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIpelsrsrsrsktvqmseasldqqpyhvlsvnlphnsgsiliinsrvpllrlWREEVTLEVVFFSIISALLLFILFSYYRQAkknkendtILLEANICVETAlsrgrcglwnfnfdnkkfhlSRSMYEImgipyenktlSFRAIARLIHYDNKKICEIARSvtgkhvkqLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWdkndrlvmcnanyqkayglpdhvlvpgnarsiiqdaqtrpiieyrtsdpersqDMSKEIKLADSRWLQINEWcthdggtisvgtDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISidkqnadlipIINEGIRLIgssaqsknikiekkipselffNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIadtgigipksalekigqpfeplhnqydqsiggFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFAsstknshyigkkigeiipelsrsrSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSiiqdaqtrpiieyrtsdpersqdmSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKAtindlstsrqilerqktelSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIgssaqsknikiekkipselffnADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRlkiisqegkgtivticmpq
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLfsffssfNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVffsiisalllfilfsYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
**********************************TSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMT*QTSLMLTEAIEI**********************QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRS*********ASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIF**L*SVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQ*DQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPEL****************LDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTS**********EIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ
MENMQNILANYGLYYPGNRQKITVSSKQAFKRAYTSIISHLFSFFSSFNQTIPMISMVFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLGQLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEASLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYYRQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTLSFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGGMNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGLPDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGTISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target766 two-component sensor histidine kinase protein [Candidat
254780701495 putative two-component sensor histidine kinase tra 6e-42
254780413820 PAS/PAC sensor signal transduction histidine kinas 1e-40
255764476792 two-component sensor histidine kinase protein [Can 1e-24
254780450 803 two-component sensor histidine kinase/response reg 2e-06
>gi|254780701|ref|YP_003065114.1| putative two-component sensor histidine kinase transcriptional regulatory protein [Candidatus Liberibacter asiaticus str. psy62] Length = 495 Back     alignment
 Score =  164 bits (414), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 103/249 (41%), Positives = 146/249 (58%), Gaps = 6/249 (2%)

Query: 521 ELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVK 580
           EL +A +     ++RAE  N  KS FLA MSHELRTPLNAILGFSEVI+ E  G L +  
Sbjct: 227 ELEVAKSLSDETRKRAEEENLAKSRFLASMSHELRTPLNAILGFSEVIELETMGPLNNET 286

Query: 581 YYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSK 640
           Y EY  DIH SGQHLLN+IN IL++S+IE  +  + +    LI I+ E I ++   AQ K
Sbjct: 287 YKEYIGDIHRSGQHLLNLINEILDLSRIEAGRYELSESAISLIDIVRECIIMLQLRAQEK 346

Query: 641 NIKIEKKI-PSELFFNADKRIIKKILFPILSNSIKFTNNNGKMMIR---TSKIGQCVIIT 696
           NI+I +KI PS     AD++ +++++  +LSN++KFT   G++ +    TS  GQ   I+
Sbjct: 347 NIEIFQKIDPSLSSVWADEKGMRQVILNLLSNAVKFTAIGGRVHVTVGWTSGRGQY--IS 404

Query: 697 IADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGK 756
           I D G GI +  +  +   F         +  G GLGL I+ ++   HGG+  I S+  +
Sbjct: 405 IKDNGPGIAEGEIPTVLTSFGQGSIAIKSAEQGVGLGLPIAQSIMANHGGQFLIRSKLRE 464

Query: 757 GTIVTICMP 765
           G  V   +P
Sbjct: 465 GVEVIAILP 473

>gi|254780413|ref|YP_003064826.1| PAS/PAC sensor signal transduction histidine kinase [Candidatus Liberibacter asiaticus str. psy62] Length = 820 Back     alignment
 Score =  159 bits (402), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 103/267 (38%), Positives = 158/267 (59%), Gaps = 19/267 (7%)

Query: 504 TINDLSTSRQILERQKTELSIANAKYQVEKERAETANKTKSEFLAKMSHELRTPLNAILG 563
           T++D+S  +Q    +K +LS A       K+ AE  +  KS+FLA++SHE+RTPL AI+G
Sbjct: 557 TMHDISEWKQ----EKNKLSHA-------KKIAEKESSHKSDFLARVSHEIRTPLTAIIG 605

Query: 564 FSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMINNILEMSKIETEKISIDKQNADLI 623
           FSEVIK + FG LG+ +Y EYA  I  SG  +L+++N++L++SKIE+ K+++  +   L 
Sbjct: 606 FSEVIKNQRFGPLGNPRYIEYANYIDRSGNLVLDIVNDLLDISKIESGKMNLHFEPVSLD 665

Query: 624 PIINEGIRLIGSSAQSKNIKIE----KKIPSELFFNADKRIIKKILFPILSNSIKFTNNN 679
             ++E I L+   A  K I I       IP  L   AD R +K+I   ILSN+I FT + 
Sbjct: 666 EAVSEAISLVQLYANEKRILIRTSFANNIPRIL---ADLRSVKQIALNILSNAIHFTPSG 722

Query: 680 GKMMIRTSKIG-QCVIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIGGFGLGLAISD 738
           G+++I T+    + VI+ + DTG+G+    LEK  +PF  + N       G GLGL ++ 
Sbjct: 723 GQIIISTTHTSNEEVILRVRDTGVGMTNYELEKAMKPFGQIPNSQQIRGEGTGLGLPLAK 782

Query: 739 ALTNLHGGRLKIISQEGKGTIVTICMP 765
           A+ + + G+  I S   KGT++ I  P
Sbjct: 783 AMVDANMGKFYIFSTPAKGTLIEIIFP 809

>gi|255764476|ref|YP_003065238.2| two-component sensor histidine kinase protein [Candidatus Liberibacter asiaticus str. psy62] Length = 792 Back     alignment
 Score =  106 bits (265), Expect = 1e-24,   Method: Compositional matrix adjust.
 Identities = 79/286 (27%), Positives = 148/286 (51%), Gaps = 21/286 (7%)

Query: 496 ESKRRLKATINDLSTSRQILE-------RQKTELSIANAKYQVEKERAET--------AN 540
           + ++ L+ T+  LS S  +LE         +T L+  N    V  ERA T        A+
Sbjct: 509 DERKSLQGTLELLSDS--VLEYSIIPLPNAQTMLTFVNVTDSVRAERALTEKNEALRKAD 566

Query: 541 KTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLNMIN 600
           + K+ F+  +S+ELR+PL  I+GF++++K    G L S K  +Y + I  S   LLN++N
Sbjct: 567 EIKNSFVQHVSYELRSPLTNIIGFTDLLKTSKLGSLNS-KQSQYVEYISASSTILLNLVN 625

Query: 601 NILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSEL-FFNADKR 659
           +IL+++ ++   + ++     L  ++NE  + I +     NI+I+     +L  F AD++
Sbjct: 626 DILDLATVDAGIMKLNYSTIVLNDLLNEVKQSIATKMHENNIRIKVISDGKLGSFVADRQ 685

Query: 660 IIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFEPL 719
            + +I   ILSN++ F++    ++++ ++     I ++ + G  IP+   + +   F  +
Sbjct: 686 RLLQIFSKILSNAMDFSSKGSTVILKAARDNGDFIFSVKNNGSSIPEDMCKSVFNRF--V 743

Query: 720 HNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
            N +     G GLGL+I ++  NLHGG + I S +   T +   +P
Sbjct: 744 SNAHRGQRRGVGLGLSIVESFINLHGGHVSISSSDEGVTTINCRIP 789

>gi|254780450|ref|YP_003064863.1| two-component sensor histidine kinase/response regulator hybrid protein [Candidatus Liberibacter asiaticus str. psy62] Length = 803 Back     alignment
 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 6/75 (8%)

Query: 693 VIITIADTGIGIPKSALEKIGQPFEPLHNQYDQSIG-GFGLGLAISDALTNLHGGRLKII 751
           V++ + DTGIG+    +EKI +PF        + +G G GLGL++   +    GG +   
Sbjct: 582 VLVEVEDTGIGMSPDIMEKIFEPF-----FTTKKVGEGTGLGLSVVYGIIRQSGGYILPE 636

Query: 752 SQEGKGTIVTICMPQ 766
           S+ GKGTI  I +P+
Sbjct: 637 SEVGKGTIFRIFLPR 651

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target766 two-component sensor histidine kinase protein [Candidat
315122620709 two-component sensor histidine kinase protein [Candidat 1 0.0
86356937767 two-component sensor histidine kinase protein [Rhizobiu 1 0.0
209548532769 multi-sensor signal transduction histidine kinase [Rhiz 1 0.0
327193951769 putative two-component sensor histidine kinase protein 1 0.0
190891008761 two-component sensor histidine kinase [Rhizobium etli C 1 0.0
241203816769 PAS/PAC sensor signal transduction histidine kinase [Rh 1 0.0
116251211769 two component sensor histidine kinase transcriptional r 1 0.0
222085322771 two-component sensor histidine kinase protein [Agrobact 1 0.0
150395865772 multi-sensor signal transduction histidine kinase [Sino 1 0.0
307309665775 multi-sensor signal transduction histidine kinase [Sino 1 0.0
>gi|315122620|ref|YP_004063109.1| two-component sensor histidine kinase protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 709 Back     alignment and organism information
 Score = 1053 bits (2723), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 501/709 (70%), Positives = 602/709 (84%)

Query: 58  VFLVFIATSSIIKVTTRYAQQEKMTNQTSLMLTEAIEIIFQNNNIKFDLASQKKAESMLG 117
           +FLV +A SSIIKV T+YAQQE+M +QT+L+LTE+IE +F+N++++F   S+KKAES+L 
Sbjct: 1   MFLVLVAASSIIKVNTKYAQQEQMIHQTTLLLTESIESLFKNSSVQFKPESKKKAESILN 60

Query: 118 QLLAKTRFLSESFILLAQPNELVFASSTKNSHYIGKKIGEIIPELSRSRSRSKTVQMSEA 177
           + L K +  S++FILLAQ N LVFASST NS YIG+KI EIIPEL    S SKT Q SE 
Sbjct: 61  EFLLKIQPFSKAFILLAQSNGLVFASSTDNSPYIGEKISEIIPELHPLTSMSKTAQTSEV 120

Query: 178 SLDQQPYHVLSVNLPHNSGSILIINSRVPLLRLWREEVTLEVVFFSIISALLLFILFSYY 237
            L Q+PYHV S+ LP+N G +L+ NS++PLL  WR EVTLEV+FF+ ISA+LLF+L SYY
Sbjct: 121 FLSQEPYHVSSILLPNNDGLVLVANSKLPLLHFWRTEVTLEVIFFASISAILLFLLCSYY 180

Query: 238 RQAKKNKENDTILLEANICVETALSRGRCGLWNFNFDNKKFHLSRSMYEIMGIPYENKTL 297
           +Q K  +ENDT LLEAN C+ETALSRGRCG+W+FN  +KKFHLS+SM EI+GIP  +KTL
Sbjct: 181 KQIKSTEENDTNLLEANTCIETALSRGRCGIWDFNLASKKFHLSQSMCEILGIPATHKTL 240

Query: 298 SFRAIARLIHYDNKKICEIARSVTGKHVKQLDQIFHMRHASGADIWIQVRAQMMRTISGG 357
           SFR IARL+H+D K+I +IARS+T  H  QLD+IF + +++G D+WI+VRAQ+M T+SGG
Sbjct: 241 SFRTIARLVHFDGKEIYDIARSITKGHSTQLDKIFRVHYSTGRDVWIKVRAQVMNTLSGG 300

Query: 358 MNIIGIAMDLTEKYHLEKRYAEADQRLSKAIECTSEALVLWDKNDRLVMCNANYQKAYGL 417
           MN+IGIAMD+TE+Y+LEKRYAE DQRLSKAIECTSE+ VLWDKNDRLVMCNA YQ+ YGL
Sbjct: 301 MNVIGIAMDVTEQYYLEKRYAEVDQRLSKAIECTSESFVLWDKNDRLVMCNAKYQQVYGL 360

Query: 418 PDHVLVPGNARSIIQDAQTRPIIEYRTSDPERSQDMSKEIKLADSRWLQINEWCTHDGGT 477
           PDHVL+PG  RSII +AQ  P++EY TSDP+R Q++SKEIKL DSRWLQINEW T D GT
Sbjct: 361 PDHVLIPGTKRSIINEAQINPVVEYYTSDPKRLQNISKEIKLVDSRWLQINEWHTPDAGT 420

Query: 478 ISVGTDITLLKHNQAQLRESKRRLKATINDLSTSRQILERQKTELSIANAKYQVEKERAE 537
           ISVGTDIT LK NQ +LRES+RRLKATINDLSTSRQILERQKTELSIANAKYQ EKERAE
Sbjct: 421 ISVGTDITQLKRNQKKLRESERRLKATINDLSTSRQILERQKTELSIANAKYQTEKERAE 480

Query: 538 TANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHYSGQHLLN 597
            AN+ KSEFLAKMSHELRTPLNAILGFSE+IK E FG+LGSVKYYEY +DIH SG+HLLN
Sbjct: 481 MANRAKSEFLAKMSHELRTPLNAILGFSEIIKGETFGKLGSVKYYEYVKDIHDSGKHLLN 540

Query: 598 MINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIKIEKKIPSELFFNAD 657
           +INNILEMSKIE+E I+I+K+N +LIPIINE ++ I SSAQ KNI IEK I  ELF NAD
Sbjct: 541 LINNILEMSKIESEHIAINKKNTNLIPIINESLQSIASSAQKKNIMIEKNISPELFCNAD 600

Query: 658 KRIIKKILFPILSNSIKFTNNNGKMMIRTSKIGQCVIITIADTGIGIPKSALEKIGQPFE 717
           +RIIKKIL PI SNSIKFTNN GKM+++TS++   VIIT+ADTGIGIPKSAL+K+G+PFE
Sbjct: 601 ERIIKKILTPIFSNSIKFTNNGGKMIVQTSRVNDSVIITVADTGIGIPKSALKKVGKPFE 660

Query: 718 PLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMPQ 766
            LHNQYDQ+ GG GLGLAISDALTNLHGG+L+I+SQEG+GT++ I MP+
Sbjct: 661 QLHNQYDQNTGGSGLGLAISDALTNLHGGKLEILSQEGEGTVIKIGMPK 709


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|86356937|ref|YP_468829.1| two-component sensor histidine kinase protein [Rhizobium etli CFN 42] Length = 767 Back     alignment and organism information
>gi|209548532|ref|YP_002280449.1| multi-sensor signal transduction histidine kinase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 769 Back     alignment and organism information
>gi|327193951|gb|EGE60826.1| putative two-component sensor histidine kinase protein [Rhizobium etli CNPAF512] Length = 769 Back     alignment and organism information
>gi|190891008|ref|YP_001977550.1| two-component sensor histidine kinase [Rhizobium etli CIAT 652] Length = 761 Back     alignment and organism information
>gi|241203816|ref|YP_002974912.1| PAS/PAC sensor signal transduction histidine kinase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 769 Back     alignment and organism information
>gi|116251211|ref|YP_767049.1| two component sensor histidine kinase transcriptional regulatory protein [Rhizobium leguminosarum bv. viciae 3841] Length = 769 Back     alignment and organism information
>gi|222085322|ref|YP_002543852.1| two-component sensor histidine kinase protein [Agrobacterium radiobacter K84] Length = 771 Back     alignment and organism information
>gi|150395865|ref|YP_001326332.1| multi-sensor signal transduction histidine kinase [Sinorhizobium medicae WSM419] Length = 772 Back     alignment and organism information
>gi|307309665|ref|ZP_07589317.1| multi-sensor signal transduction histidine kinase [Sinorhizobium meliloti BL225C] Length = 775 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target766 two-component sensor histidine kinase protein [Candidat
TIGR02956 968 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS 6e-41
PRK11107 919 PRK11107, PRK11107, hybrid sensory histidine kinase Bar 5e-36
COG2205890 COG2205, KdpD, Osmosensitive K+ channel histidine kinas 5e-30
PRK11091 779 PRK11091, PRK11091, aerobic respiration control sensor 5e-30
PRK11466 914 PRK11466, PRK11466, hybrid sensory histidine kinase Tor 1e-29
PRK10490895 PRK10490, PRK10490, sensor protein KdpD; Provisional 1e-22
PRK09303380 PRK09303, PRK09303, adaptive-response sensory kinase; V 3e-21
COG4191603 COG4191, COG4191, Signal transduction histidine kinase 1e-13
COG4192673 COG4192, COG4192, Signal transduction histidine kinase 4e-07
KOG0519 786 KOG0519, KOG0519, KOG0519, Sensory transduction histidi 1e-06
COG0642336 COG0642, BaeS, Signal transduction histidine kinase [Si 7e-39
PRK15347 921 PRK15347, PRK15347, two component system sensor kinase 4e-35
COG5002459 COG5002, VicK, Signal transduction histidine kinase [Si 4e-28
PRK09959 1197 PRK09959, PRK09959, hybrid sensory histidine kinase in 2e-22
PRK11360607 PRK11360, PRK11360, sensory histidine kinase AtoS; Prov 2e-21
PRK10841 924 PRK10841, PRK10841, hybrid sensory kinase in two-compon 3e-21
TIGR02966333 TIGR02966, phoR_proteo, phosphate regulon sensor kinase 5e-20
PRK11100475 PRK11100, PRK11100, sensory histidine kinase CreC; Prov 1e-17
PRK10364457 PRK10364, PRK10364, sensor protein ZraS; Provisional 2e-17
TIGR01386457 TIGR01386, cztS_silS_copS, heavy metal sensor kinase 4e-15
COG4251750 COG4251, COG4251, Bacteriophytochrome (light-regulated 1e-12
PRK10549466 PRK10549, PRK10549, signal transduction histidine-prote 1e-12
TIGR03785703 TIGR03785, marine_sort_HK, proteobacterial dedicated so 2e-11
PRK10604433 PRK10604, PRK10604, sensor protein RstB; Provisional 9e-11
COG5000712 COG5000, NtrY, Signal transduction histidine kinase inv 1e-09
PRK09470461 PRK09470, cpxA, two-component sensor protein; Provision 1e-09
PRK11006430 PRK11006, phoR, phosphate regulon sensor protein; Provi 1e-09
COG3852363 COG3852, NtrB, Signal transduction histidine kinase, ni 3e-07
PRK09467435 PRK09467, envZ, osmolarity sensor protein; Provisional 5e-07
PRK13837 828 PRK13837, PRK13837, two-component VirA-like sensor kina 8e-07
PRK10618 894 PRK10618, PRK10618, phosphotransfer intermediate protei 1e-06
PRK10337449 PRK10337, PRK10337, sensor protein QseC; Provisional 1e-06
PRK09835482 PRK09835, PRK09835, sensor kinase CusS; Provisional 1e-05
PRK11073348 PRK11073, glnL, nitrogen regulation protein NR(II); Pro 1e-05
smart00387111 smart00387, HATPase_c, Histidine kinase-like ATPases 9e-23
pfam02518111 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, 4e-22
cd00075103 cd00075, HATPase_c, Histidine kinase-like ATPases; This 5e-18
PRK10755356 PRK10755, PRK10755, sensor protein BasS/PmrB; Provision 2e-05
PRK13557 540 PRK13557, PRK13557, histidine kinase; Provisional 4e-05
pfam0051266 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain 1e-11
smart0038866 smart00388, HisKA, His Kinase A (phosphoacceptor) domai 1e-11
cd0008265 cd00082, HisKA, Histidine Kinase A (dimerization/phosph 4e-11
TIGR02938494 TIGR02938, nifL_nitrog, nitrogen fixation negative regu 1e-11
COG3290537 COG3290, CitA, Signal transduction histidine kinase reg 9e-05
TIGR02916679 TIGR02916, PEP_his_kin, putative PEP-CTERM system histi 2e-10
PRK13560 807 PRK13560, PRK13560, hypothetical protein; Provisional 8e-05
PRK09776 1092 PRK09776, PRK09776, putative diguanylate cyclase; Provi 0.004
>gnl|CDD|163083 TIGR02956, TMAO_torS, TMAO reductase sytem sensor TorS Back     alignment and domain information
>gnl|CDD|182968 PRK11107, PRK11107, hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>gnl|CDD|32387 COG2205, KdpD, Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182956 PRK11091, PRK11091, aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>gnl|CDD|183148 PRK11466, PRK11466, hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>gnl|CDD|182496 PRK10490, PRK10490, sensor protein KdpD; Provisional Back     alignment and domain information
>gnl|CDD|181772 PRK09303, PRK09303, adaptive-response sensory kinase; Validated Back     alignment and domain information
>gnl|CDD|33926 COG4191, COG4191, Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33927 COG4192, COG4192, Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|35739 KOG0519, KOG0519, KOG0519, Sensory transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|30987 COG0642, BaeS, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|185245 PRK15347, PRK15347, two component system sensor kinase SsrA; Provisional Back     alignment and domain information
>gnl|CDD|34607 COG5002, VicK, Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182169 PRK09959, PRK09959, hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>gnl|CDD|183098 PRK11360, PRK11360, sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>gnl|CDD|182772 PRK10841, PRK10841, hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>gnl|CDD|163090 TIGR02966, phoR_proteo, phosphate regulon sensor kinase PhoR Back     alignment and domain information
>gnl|CDD|182962 PRK11100, PRK11100, sensory histidine kinase CreC; Provisional Back     alignment and domain information
>gnl|CDD|182411 PRK10364, PRK10364, sensor protein ZraS; Provisional Back     alignment and domain information
>gnl|CDD|162333 TIGR01386, cztS_silS_copS, heavy metal sensor kinase Back     alignment and domain information
>gnl|CDD|33974 COG4251, COG4251, Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182539 PRK10549, PRK10549, signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>gnl|CDD|163497 TIGR03785, marine_sort_HK, proteobacterial dedicated sortase system histidine kinase Back     alignment and domain information
>gnl|CDD|182583 PRK10604, PRK10604, sensor protein RstB; Provisional Back     alignment and domain information
>gnl|CDD|34605 COG5000, NtrY, Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181885 PRK09470, cpxA, two-component sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|182895 PRK11006, phoR, phosphate regulon sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|33642 COG3852, NtrB, Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|181882 PRK09467, envZ, osmolarity sensor protein; Provisional Back     alignment and domain information
>gnl|CDD|184354 PRK13837, PRK13837, two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>gnl|CDD|182591 PRK10618, PRK10618, phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>gnl|CDD|182388 PRK10337, PRK10337, sensor protein QseC; Provisional Back     alignment and domain information
>gnl|CDD|182101 PRK09835, PRK09835, sensor kinase CusS; Provisional Back     alignment and domain information
>gnl|CDD|182947 PRK11073, glnL, nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>gnl|CDD|128669 smart00387, HATPase_c, Histidine kinase-like ATPases Back     alignment and domain information
>gnl|CDD|145582 pfam02518, HATPase_c, Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>gnl|CDD|28956 cd00075, HATPase_c, Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>gnl|CDD|182702 PRK10755, PRK10755, sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>gnl|CDD|184141 PRK13557, PRK13557, histidine kinase; Provisional Back     alignment and domain information
>gnl|CDD|144196 pfam00512, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|128670 smart00388, HisKA, His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>gnl|CDD|119399 cd00082, HisKA, Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>gnl|CDD|131984 TIGR02938, nifL_nitrog, nitrogen fixation negative regulator NifL Back     alignment and domain information
>gnl|CDD|33099 COG3290, CitA, Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|163071 TIGR02916, PEP_his_kin, putative PEP-CTERM system histidine kinase Back     alignment and domain information
>gnl|CDD|106506 PRK13560, PRK13560, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|182070 PRK09776, PRK09776, putative diguanylate cyclase; Provisional Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 766 two-component sensor histidine kinase protein [Candidat
PRK11091 779 aerobic respiration control sensor protein ArcB; Provis 100.0
PRK13557 538 histidine kinase; Provisional 100.0
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 100.0
PRK13559363 hypothetical protein; Provisional 99.94
PRK10841 947 hybrid sensory kinase in two-component regulatory syste 100.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 100.0
PRK11360607 sensory histidine kinase AtoS; Provisional 100.0
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 100.0
PRK11006431 phoR phosphate regulon sensor protein; Provisional 100.0
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 100.0
COG5002459 VicK Signal transduction histidine kinase [Signal trans 100.0
COG3852363 NtrB Signal transduction histidine kinase, nitrogen spe 100.0
COG5000712 NtrY Signal transduction histidine kinase involved in n 100.0
PRK10618 881 phosphotransfer intermediate protein in two-component r 99.93
PRK11107 920 hybrid sensory histidine kinase BarA; Provisional 100.0
TIGR02956 1052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 100.0
PRK11466 912 hybrid sensory histidine kinase TorS; Provisional 100.0
PRK09303378 adaptive-response sensory kinase; Validated 100.0
PRK10490895 sensor protein KdpD; Provisional 100.0
PRK13837 831 two-component VirA-like sensor kinase; Provisional 100.0
PRK10549467 signal transduction histidine-protein kinase BaeS; Prov 100.0
PRK10364455 sensor protein ZraS; Provisional 100.0
PRK11100475 sensory histidine kinase CreC; Provisional 100.0
PRK09835482 sensor kinase CusS; Provisional 100.0
PRK11086541 sensory histidine kinase DcuS; Provisional 100.0
PRK09470461 cpxA two-component sensor protein; Provisional 100.0
PRK10604433 sensor protein RstB; Provisional 100.0
PRK10755355 sensor protein BasS/PmrB; Provisional 100.0
PRK10337446 sensor protein QseC; Provisional 100.0
COG2205890 KdpD Osmosensitive K+ channel histidine kinase [Signal 100.0
TIGR01386483 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR 100.0
PRK10815484 sensor protein PhoQ; Provisional 100.0
PRK09467437 envZ osmolarity sensor protein; Provisional 100.0
COG4191603 Signal transduction histidine kinase regulating C4-dica 100.0
COG4251750 Bacteriophytochrome (light-regulated signal transductio 100.0
TIGR02916696 PEP_his_kin putative PEP-CTERM system histidine kinase; 100.0
COG3290537 CitA Signal transduction histidine kinase regulating ci 100.0
COG0642336 BaeS Signal transduction histidine kinase [Signal trans 100.0
COG4192673 Signal transduction histidine kinase regulating phospho 99.97
KOG0519 786 consensus 99.92
PRK10935568 nitrate/nitrite sensor protein NarQ; Provisional 99.84
PRK10600569 nitrate/nitrite sensor protein NarX; Provisional 99.75
PRK11644497 sensory histidine kinase UhpB; Provisional 99.69
COG3920221 Signal transduction histidine kinase [Signal transducti 99.66
COG2972456 Predicted signal transduction protein with a C-terminal 99.65
COG3850574 NarQ Signal transduction histidine kinase, nitrate/nitr 99.59
COG3275557 LytS Putative regulator of cell autolysis [Signal trans 99.5
COG3851497 UhpB Signal transduction histidine kinase, glucose-6-ph 99.42
KOG0519 786 consensus 98.34
COG5385214 Uncharacterized protein conserved in bacteria [Function 97.46
PRK13560807 hypothetical protein; Provisional 100.0
PRK09776 1116 putative sensor protein; Provisional 100.0
PRK09776 1116 putative sensor protein; Provisional 100.0
PRK13560807 hypothetical protein; Provisional 99.97
PRK11359 799 cAMP phosphodiesterase; Provisional 99.92
smart00387111 HATPase_c Histidine kinase-like ATPases. Histidine kina 99.96
pfam02518111 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-l 99.95
cd00075103 HATPase_c Histidine kinase-like ATPases; This family in 99.94
PRK03660146 anti-sigma F factor; Provisional 99.5
PRK04069158 serine-protein kinase RsbW; Provisional 98.59
TIGR01925137 spIIAB anti-sigma F factor; InterPro: IPR010194 This en 98.44
COG2172146 RsbW Anti-sigma regulatory factor (Ser/Thr protein kina 98.25
TIGR01924161 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 Th 96.96
COG5381184 Uncharacterized protein conserved in bacteria [Function 96.07
PRK11359 799 cAMP phosphodiesterase; Provisional 99.95
TIGR02938496 nifL_nitrog nitrogen fixation negative regulator NifL; 99.12
KOG3558768 consensus 98.43
KOG3559598 consensus 97.57
KOG3560712 consensus 97.52
PRK10547 662 chemotaxis protein CheA; Provisional 99.86
COG0643 716 CheA Chemotaxis protein histidine kinase and related ki 99.84
COG4585365 Signal transduction histidine kinase [Signal transducti 99.64
KOG0787414 consensus 99.23
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 99.67
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 99.59
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 99.44
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 98.96
PRK11073348 glnL nitrogen regulation protein NR(II); Provisional 98.55
TIGR02966339 phoR_proteo phosphate regulon sensor kinase PhoR; Inter 97.74
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.68
KOG0501 971 consensus 96.15
pfam07310137 PAS_5 PAS domain. This family contains a number of hypo 93.45
PRK13558674 bacterio-opsin activator; Provisional 99.57
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 99.42
PRK10060663 RNase II stability modulator; Provisional 99.31
PRK11006431 phoR phosphate regulon sensor protein; Provisional 98.79
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 98.78
PRK11360607 sensory histidine kinase AtoS; Provisional 98.64
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 98.52
COG5002459 VicK Signal transduction histidine kinase [Signal trans 98.0
PRK09959 1197 hybrid sensory histidine kinase in two-component regula 97.48
COG5000712 NtrY Signal transduction histidine kinase involved in n 96.3
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.34
PRK13558674 bacterio-opsin activator; Provisional 98.14
pfam0051266 HisKA His Kinase A (phosphoacceptor) domain. dimerizati 99.29
smart0038866 HisKA His Kinase A (phosphoacceptor) domain. Dimerisati 99.07
cd0008265 HisKA Histidine Kinase A (dimerization/phosphoacceptor) 98.98
COG4564459 Signal transduction histidine kinase [Signal transducti 99.27
pfam10090181 DUF2328 Uncharacterized protein conserved in bacteria ( 97.57
PRK13557538 histidine kinase; Provisional 99.13
PRK10060663 RNase II stability modulator; Provisional 98.94
pfam00989112 PAS PAS fold. The PAS fold corresponds to the structura 98.9
pfam08448110 PAS_4 PAS fold. The PAS fold corresponds to the structu 98.61
TIGR00229130 sensory_box PAS domain S-box; InterPro: IPR000014 PAS d 98.42
cd00130103 PAS PAS domain; PAS motifs appear in archaea, eubacteri 97.52
pfam0844790 PAS_3 PAS fold. The PAS fold corresponds to the structu 96.11
KOG3560712 consensus 94.27
COG1389538 DNA topoisomerase VI, subunit B [DNA replication, recom 98.86
PRK04184533 DNA topoisomerase VI subunit B; Validated 98.68
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 97.63
PTZ00272701 heat shock protein 83 kDa (Hsp83); Provisional 97.28
PRK05218612 heat shock protein 90; Provisional 96.93
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 93.1
PRK13559363 hypothetical protein; Provisional 98.62
TIGR01052662 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005 98.57
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 97.82
KOG3753 1114 consensus 94.27
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.51
PRK10841 947 hybrid sensory kinase in two-component regulatory syste 98.4
COG2202232 AtoS FOG: PAS/PAC domain [Signal transduction mechanism 98.37
KOG3558 768 consensus 98.18
KOG3559598 consensus 96.85
PRK00095612 mutL DNA mismatch repair protein; Reviewed 98.26
PTZ00130824 heat shock protein 90; Provisional 96.3
KOG0019656 consensus 93.93
smart0008643 PAC Motif C-terminal to PAS motifs (likely to contribut 98.23
PTZ00109941 DNA gyrase subunit b; Provisional 93.66
TIGR01058655 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IP 93.34
PRK05559633 DNA topoisomerase IV subunit B; Reviewed 92.28
smart00433594 TOP2c TopoisomeraseII. Eukaryotic DNA topoisomerase II, 92.22
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.14
smart0009167 PAS PAS domain. PAS motifs appear in archaea, eubacteri 98.01
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 97.98
COG3290537 CitA Signal transduction histidine kinase regulating ci 97.92
PRK11086541 sensory histidine kinase DcuS; Provisional 97.03
TIGR00585 367 mutl DNA mismatch repair protein MutL; InterPro: IPR014 97.81
COG0323638 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA 97.33
COG0326623 HtpG Molecular chaperone, HSP90 family [Posttranslation 96.98
PRK10364455 sensor protein ZraS; Provisional 95.8
KOG3561803 consensus 93.8
PTZ00108 1506 DNA topoisomerase II; Provisional 93.67
KOG0020785 consensus 93.19
KOG1979694 consensus 93.34
KOG19771142 consensus 92.39
TIGR01059818 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA top 92.31
TIGR01055647 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IP 92.3
pfam0826995 Cache_2 Cache domain. 91.31
PRK13374233 purine nucleoside phosphorylase; Provisional 91.15
PRK05819235 deoD purine nucleoside phosphorylase; Reviewed 90.15
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG3852 NtrB Signal transduction histidine kinase, nitrogen specific [Signal transduction mechanisms] Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK10618 phosphotransfer intermediate protein in two-component regulatory system with RcsBC; Provisional Back     alignment and domain information
>PRK11107 hybrid sensory histidine kinase BarA; Provisional Back     alignment and domain information
>TIGR02956 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: IPR014302 This protein, TorS, is part of a regulatory system for the torCAD operon that encodes the pterin molybdenum cofactor-containing enzyme trimethylamine-N-oxide (TMAO) reductase (TorA), a cognate chaperone (TorD), and a penta-haem cytochrome (TorC) Back     alignment and domain information
>PRK11466 hybrid sensory histidine kinase TorS; Provisional Back     alignment and domain information
>PRK09303 adaptive-response sensory kinase; Validated Back     alignment and domain information
>PRK10490 sensor protein KdpD; Provisional Back     alignment and domain information
>PRK13837 two-component VirA-like sensor kinase; Provisional Back     alignment and domain information
>PRK10549 signal transduction histidine-protein kinase BaeS; Provisional Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>PRK11100 sensory histidine kinase CreC; Provisional Back     alignment and domain information
>PRK09835 sensor kinase CusS; Provisional Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>PRK09470 cpxA two-component sensor protein; Provisional Back     alignment and domain information
>PRK10604 sensor protein RstB; Provisional Back     alignment and domain information
>PRK10755 sensor protein BasS/PmrB; Provisional Back     alignment and domain information
>PRK10337 sensor protein QseC; Provisional Back     alignment and domain information
>COG2205 KdpD Osmosensitive K+ channel histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01386 cztS_silS_copS heavy metal sensor kinase; InterPro: IPR006290 Members of this family contain a sensor histidine kinase domain (IPR003661 from INTERPRO) and a domain found in bacterial signal proteins (IPR003660 from INTERPRO) Back     alignment and domain information
>PRK10815 sensor protein PhoQ; Provisional Back     alignment and domain information
>PRK09467 envZ osmolarity sensor protein; Provisional Back     alignment and domain information
>COG4191 Signal transduction histidine kinase regulating C4-dicarboxylate transport system [Signal transduction mechanisms] Back     alignment and domain information
>COG4251 Bacteriophytochrome (light-regulated signal transduction histidine kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR02916 PEP_his_kin putative PEP-CTERM system histidine kinase; InterPro: IPR014265 Proteins in this entry are putative periplasmic sensor signal transduction histidine kinases Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>COG0642 BaeS Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG4192 Signal transduction histidine kinase regulating phosphoglycerate transport system [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>PRK10935 nitrate/nitrite sensor protein NarQ; Provisional Back     alignment and domain information
>PRK10600 nitrate/nitrite sensor protein NarX; Provisional Back     alignment and domain information
>PRK11644 sensory histidine kinase UhpB; Provisional Back     alignment and domain information
>COG3920 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>COG2972 Predicted signal transduction protein with a C-terminal ATPase domain [Signal transduction mechanisms] Back     alignment and domain information
>COG3850 NarQ Signal transduction histidine kinase, nitrate/nitrite-specific [Signal transduction mechanisms] Back     alignment and domain information
>COG3275 LytS Putative regulator of cell autolysis [Signal transduction mechanisms] Back     alignment and domain information
>COG3851 UhpB Signal transduction histidine kinase, glucose-6-phosphate specific [Signal transduction mechanisms] Back     alignment and domain information
>KOG0519 consensus Back     alignment and domain information
>COG5385 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK09776 putative sensor protein; Provisional Back     alignment and domain information
>PRK13560 hypothetical protein; Provisional Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>smart00387 HATPase_c Histidine kinase-like ATPases Back     alignment and domain information
>pfam02518 HATPase_c Histidine kinase-, DNA gyrase B-, and HSP90-like ATPase Back     alignment and domain information
>cd00075 HATPase_c Histidine kinase-like ATPases; This family includes several ATP-binding proteins for example: histidine kinase, DNA gyrase B, topoisomerases, heat shock protein HSP90, phytochrome-like ATPases and DNA mismatch repair proteins Back     alignment and domain information
>PRK03660 anti-sigma F factor; Provisional Back     alignment and domain information
>PRK04069 serine-protein kinase RsbW; Provisional Back     alignment and domain information
>TIGR01925 spIIAB anti-sigma F factor; InterPro: IPR010194 This entry describes the SpoIIAB anti-sigma F factor Back     alignment and domain information
>COG2172 RsbW Anti-sigma regulatory factor (Ser/Thr protein kinase) [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01924 rsbW_low_gc anti-sigma B factor; InterPro: IPR010193 This entry describes the anti-sigma B factor also known as serine-protein kinase RsbW Back     alignment and domain information
>COG5381 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK11359 cAMP phosphodiesterase; Provisional Back     alignment and domain information
>TIGR02938 nifL_nitrog nitrogen fixation negative regulator NifL; InterPro: IPR014285 NifL modulates the activity of the nitrogen fixation positive regulator protein NifA, acting as a negative regulator by binding NifA Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>KOG3559 consensus Back     alignment and domain information
>KOG3560 consensus Back     alignment and domain information
>PRK10547 chemotaxis protein CheA; Provisional Back     alignment and domain information
>COG0643 CheA Chemotaxis protein histidine kinase and related kinases [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>COG4585 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>KOG0787 consensus Back     alignment and domain information
>pfam08447 PAS_3 PAS fold Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>PRK11073 glnL nitrogen regulation protein NR(II); Provisional Back     alignment and domain information
>TIGR02966 phoR_proteo phosphate regulon sensor kinase PhoR; InterPro: IPR014310 Members of this protein are the regulatory histidine kinase PhoR associated with the phosphate ABC transporter found in most Proteobacteria, and related proteins from Gram-positive organisms are excluded Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>KOG0501 consensus Back     alignment and domain information
>pfam07310 PAS_5 PAS domain Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>PRK11006 phoR phosphate regulon sensor protein; Provisional Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>PRK11360 sensory histidine kinase AtoS; Provisional Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG5002 VicK Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>PRK09959 hybrid sensory histidine kinase in two-component regulatory system with EvgA; Provisional Back     alignment and domain information
>COG5000 NtrY Signal transduction histidine kinase involved in nitrogen fixation and metabolism regulation [Signal transduction mechanisms] Back     alignment and domain information
>PRK11091 aerobic respiration control sensor protein ArcB; Provisional Back     alignment and domain information
>PRK13558 bacterio-opsin activator; Provisional Back     alignment and domain information
>pfam00512 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>smart00388 HisKA His Kinase A (phosphoacceptor) domain Back     alignment and domain information
>cd00082 HisKA Histidine Kinase A (dimerization/phosphoacceptor) domain; Histidine Kinase A dimers are formed through parallel association of 2 domains creating 4-helix bundles; usually these domains contain a conserved His residue and are activated via trans-autophosphorylation by the catalytic domain of the histidine kinase Back     alignment and domain information
>COG4564 Signal transduction histidine kinase [Signal transduction mechanisms] Back     alignment and domain information
>pfam10090 DUF2328 Uncharacterized protein conserved in bacteria (DUF2328) Back     alignment and domain information
>PRK13557 histidine kinase; Provisional Back     alignment and domain information
>PRK10060 RNase II stability modulator; Provisional Back     alignment and domain information
>pfam00989 PAS PAS fold Back     alignment and domain information
>pfam08448 PAS_4 PAS fold Back     alignment and domain information
>TIGR00229 sensory_box PAS domain S-box; InterPro: IPR000014 PAS domains are involved in many signalling proteins where they are used as a signal sensor domain Back     alignment and domain information
>cd00130 PAS PAS domain; PAS motifs appear in archaea, eubacteria and eukarya Back     alignment and domain information
>pfam08447 PAS_3 PAS fold Back     alignment and domain information
>KOG3560 consensus Back     alignment and domain information
>COG1389 DNA topoisomerase VI, subunit B [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK04184 DNA topoisomerase VI subunit B; Validated Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>PTZ00272 heat shock protein 83 kDa (Hsp83); Provisional Back     alignment and domain information
>PRK05218 heat shock protein 90; Provisional Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>PRK13559 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01052 top6b DNA topoisomerase VI, B subunit; InterPro: IPR005734 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>KOG3753 consensus Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>PRK10841 hybrid sensory kinase in two-component regulatory system with RcsB and YojN; Provisional Back     alignment and domain information
>COG2202 AtoS FOG: PAS/PAC domain [Signal transduction mechanisms] Back     alignment and domain information
>KOG3558 consensus Back     alignment and domain information
>KOG3559 consensus Back     alignment and domain information
>PRK00095 mutL DNA mismatch repair protein; Reviewed Back     alignment and domain information
>PTZ00130 heat shock protein 90; Provisional Back     alignment and domain information
>KOG0019 consensus Back     alignment and domain information
>smart00086 PAC Motif C-terminal to PAS motifs (likely to contribute to PAS structural domain) Back     alignment and domain information
>PTZ00109 DNA gyrase subunit b; Provisional Back     alignment and domain information
>TIGR01058 parE_Gpos DNA topoisomerase IV, B subunit; InterPro: IPR005740 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>PRK05559 DNA topoisomerase IV subunit B; Reviewed Back     alignment and domain information
>smart00433 TOP2c TopoisomeraseII Back     alignment and domain information
>TIGR02040 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR011785 This entry represents the transcriptional regulator PpsR which is strictly associated with photosynthetic proteobacteria and found in photosynthetic operons Back     alignment and domain information
>smart00091 PAS PAS domain Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG3290 CitA Signal transduction histidine kinase regulating citrate/malate metabolism [Signal transduction mechanisms] Back     alignment and domain information
>PRK11086 sensory histidine kinase DcuS; Provisional Back     alignment and domain information
>TIGR00585 mutl DNA mismatch repair protein MutL; InterPro: IPR014763 This entry represents DNA mismatch repair proteins, such as MutL Back     alignment and domain information
>COG0323 MutL DNA mismatch repair enzyme (predicted ATPase) [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0326 HtpG Molecular chaperone, HSP90 family [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10364 sensor protein ZraS; Provisional Back     alignment and domain information
>KOG3561 consensus Back     alignment and domain information
>PTZ00108 DNA topoisomerase II; Provisional Back     alignment and domain information
>KOG0020 consensus Back     alignment and domain information
>KOG1979 consensus Back     alignment and domain information
>KOG1977 consensus Back     alignment and domain information
>TIGR01059 gyrB DNA gyrase, B subunit; InterPro: IPR011557 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>TIGR01055 parE_Gneg DNA topoisomerase IV, B subunit; InterPro: IPR005737 DNA topoisomerases regulate the number of topological links between two DNA strands (i Back     alignment and domain information
>pfam08269 Cache_2 Cache domain Back     alignment and domain information
>PRK13374 purine nucleoside phosphorylase; Provisional Back     alignment and domain information
>PRK05819 deoD purine nucleoside phosphorylase; Reviewed Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target766 two-component sensor histidine kinase protein [Candidat
3dge_A258 Structure Of A Histidine Kinase-Response Regulator 2e-66
2c2a_A258 Structure Of The Entire Cytoplasmic Portion Of A Se 2e-66
>gi|251836869|pdb|3DGE|A Chain A, Structure Of A Histidine Kinase-Response Regulator Complex Reveals Insights Into Two-Component Signaling And A Novel Cis-Autophosphorylation Mechanism Length = 258 Back     alignment and structure
 Score =  259 bits (661), Expect = 2e-66,   Method: Composition-based stats.
 Identities = 74/241 (30%), Positives = 130/241 (53%), Gaps = 6/241 (2%)

Query: 531 VEKERAETANKTKSEFLAKMSHELRTPLNAILGFSEVIKKEIFGELGSVKYYEYAQDIHY 590
            E ER +  ++ K+EF+A +SHELRTPL AI  ++E I     GEL      E+ + I  
Sbjct: 8   KELERLKRIDRMKTEFIANISHELRTPLTAIKAYAETIYNS-LGELDLSTLKEFLEVIID 66

Query: 591 SGQHLLNMINNILEMSKIETEKISIDKQNADLIPIINEGIRLIGSSAQSKNIK--IEKKI 648
              HL N++N +L+ S++E + + I+++  DL  ++   +  I   A S N+    E  +
Sbjct: 67  QSNHLENLLNELLDFSRLERKSLQINREKVDLCDLVESAVNAIKEFASSHNVNVLFESNV 126

Query: 649 PSELFFNADKRIIKKILFPILSNSIKFTN---NNGKMMIRTSKIGQCVIITIADTGIGIP 705
           P  +    D   I+++L  +L+N +K++     +  + +   +    V+I + D GIGIP
Sbjct: 127 PCPVEAYIDPTRIRQVLLNLLNNGVKYSKKDAPDKYVKVILDEKDGGVLIIVEDNGIGIP 186

Query: 706 KSALEKIGQPFEPLHNQYDQSIGGFGLGLAISDALTNLHGGRLKIISQEGKGTIVTICMP 765
             A ++I + F  + +     + G GLGLAI+  +  LHGGR+ + S+ GKG+   + +P
Sbjct: 187 DHAKDRIFEQFYRVDSSLTYEVPGTGLGLAITKEIVELHGGRIWVESEVGKGSRFFVWIP 246

Query: 766 Q 766
           +
Sbjct: 247 K 247


>gi|83754490|pdb|2C2A|A Chain A, Structure Of The Entire Cytoplasmic Portion Of A Sensor Histidine Kinase Protein Length = 258 Back     alignment and structure