254780902

254780902

isocitrate dehydrogenase

GeneID in NCBI database:8209922Locus tag:CLIBASIA_04005
Protein GI in NCBI database:254780902Protein Accession:YP_003065315.1
Gene range:-(880349, 881587)Protein Length:412aa
Gene description:isocitrate dehydrogenase
COG prediction:none
KEGG prediction:isocitrate dehydrogenase (EC:1.1.1.42); K00031 isocitrate dehydrogenase [EC:1.1.1.42]
SEED prediction:Isocitrate dehydrogenase [NADP] (EC 1.1.1.42)
Pathway involved in KEGG:Citrate cycle (TCA cycle) [PATH:las00020]
Glutathione metabolism [PATH:las00480]
Subsystem involved in SEED:TCA Cycle
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410--
MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKNLSISDKQ
cccccccccEEEEccccccHHHHHHHHHHHHcccccccEEEEEEEccccccccccccHHHHHHHHHccEEEEcccccccccccccccccccccHHHHHHHHHcccEEEEEEEEEcccccccccccccEEEEEEccccEEcccEEEEcccccEEEEEEcccccEEEEEEEccccccEEEEEEEcHHHHHHHHHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEHHHHHHHHHHHHccccEEEEEccccccHHHHHHHHHccHHHHcccccccccccccEEccccccHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccc
cccEEccccEEEEEccHHHHHHHHHHHHHcccccEEccEEEEEccHHHHHHcccHHHHHHHHHHHHHcEEEEcccccccHHHHHHHccccccccHHHHHHHHHccEEEEEEccccccccccccccccEEEEEEcccHHHHcEEEEEcccEEEEEEEEEcccccEEEEEEEEcccEEEEEEEEEHHHHHHHHHHHHHHHHHHcccEEEEEcccccccHHHHHHHHHHHHHHHHcHHHHHHccccEEEEEHHHHHHHHHHccccEEEEEcHHHHHHHHHHHHHHHcccccEEEEEEccccccEEEEccccccHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcccccccc
mkkikvtkpvvsldgdEMTRIIWQLIQENlihpyldikieyfdlsiqnrdltddqvTIDAAHAIKncgvgikcatITADQARVKEFNLkkmwkspngtirNILGgiifrepiicsnvprlipgwkkpiiigrhafgdqyratdfqfpskGKLILKFvgddgqtiekevfdspgsgIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWacknydgdvqsDIVAQGFGSLGLMTSVLITadgktmeteaahgtvtrhyrqhqqgketstnSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKtvedgfmtKDLALLigpeqdwlstTDFIEKISDNLRDALQKnlsisdkq
mkkikvtkpvvsldgdeMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEfnlkkmwkspngTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKevfdspgsgIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTrhyrqhqqgketstnsIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDAlqknlsisdkq
MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKNLSISDKQ
******TKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQG*ETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLR*************
MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGT***************TNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKNLSISDKQ
*KKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKN*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKNLSISDKQ
MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKNLSISDKQ
MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAAHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLIPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAMYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDELGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKTMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERVCIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQKNLSISDKQ

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target412 isocitrate dehydrogenase [Candidatus Liberibacter asiat
315122621403 isocitrate dehydrogenase [Candidatus Liberibacter solan 1 0.0
46909738403 isocitrate dehydrogenase [Rhizobium leguminosarum bv. v 1 0.0
209549547403 isocitrate dehydrogenase [Rhizobium leguminosarum bv. t 1 0.0
116252377403 isocitrate dehydrogenase [Rhizobium leguminosarum bv. v 1 0.0
222148421404 isocitrate dehydrogenase [Agrobacterium vitis S4] Lengt 1 0.0
222086159404 isocitrate dehydrogenase, NADP-dependent [Agrobacterium 1 0.0
241204884403 isocitrate dehydrogenase [Rhizobium leguminosarum bv. t 1 0.0
190892004403 isocitrate dehydrogenase (NADP(+)) protein [Rhizobium e 1 0.0
325293272404 isocitrate dehydrogenase [Agrobacterium sp. H13-3] Leng 1 0.0
256061279404 isocitrate dehydrogenase [Brucella neotomae 5K33] Lengt 1 0.0
>gi|315122621|ref|YP_004063110.1| isocitrate dehydrogenase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 403 Back     alignment and organism information
 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/403 (87%), Positives = 382/403 (94%)

Query: 1   MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDA 60
           MKKIKV  PVVSLDGDEMTRIIWQLIQE LIHPYLD+KIEYFDLSIQNRDLT+DQVT+DA
Sbjct: 1   MKKIKVINPVVSLDGDEMTRIIWQLIQEKLIHPYLDLKIEYFDLSIQNRDLTNDQVTVDA 60

Query: 61  AHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRL 120
           A AIK CGVG+KCATITAD+ RVKEFNLK+MWKSPNGTIRNILGG IFREPIIC NVPRL
Sbjct: 61  ARAIKKCGVGVKCATITADKERVKEFNLKEMWKSPNGTIRNILGGTIFREPIICKNVPRL 120

Query: 121 IPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEKEVFDSPGSGIAMAM 180
           +PGWKKPIIIGRHAFGDQYRATDF FP KGKLILKFVG++G+TIEKEVF+SP SG+AMAM
Sbjct: 121 VPGWKKPIIIGRHAFGDQYRATDFTFPGKGKLILKFVGENGETIEKEVFNSPSSGVAMAM 180

Query: 181 YNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDEL 240
           YNLD+SIR+FARAAMQYAL RQLPLYLSTK+TILK+YDG+FKNIF EI+  EFK+QFDEL
Sbjct: 181 YNLDNSIRDFARAAMQYALTRQLPLYLSTKNTILKTYDGQFKNIFEEIYNNEFKHQFDEL 240

Query: 241 GITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKT 300
           G+TYTHRLIDDMVASSIK SGGY+WACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKT
Sbjct: 241 GLTYTHRLIDDMVASSIKLSGGYVWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKT 300

Query: 301 METEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERV 360
           +E+EAAHGTVTRHYRQHQ+G+ETSTNSIASIF+WTRGLLHRAKLDENAELKKFAE LE V
Sbjct: 301 IESEAAHGTVTRHYRQHQKGEETSTNSIASIFSWTRGLLHRAKLDENAELKKFAEKLEHV 360

Query: 361 CIKTVEDGFMTKDLALLIGPEQDWLSTTDFIEKISDNLRDALQ 403
           CIKTVEDGFMTKDLALLIGPEQDWLST+ FIEKIS NL+D LQ
Sbjct: 361 CIKTVEDGFMTKDLALLIGPEQDWLSTSGFIEKISHNLQDNLQ 403


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|46909738|gb|AAT06312.1| isocitrate dehydrogenase [Rhizobium leguminosarum bv. viciae] Length = 403 Back     alignment and organism information
>gi|209549547|ref|YP_002281464.1| isocitrate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 403 Back     alignment and organism information
>gi|116252377|ref|YP_768215.1| isocitrate dehydrogenase [Rhizobium leguminosarum bv. viciae 3841] Length = 403 Back     alignment and organism information
>gi|222148421|ref|YP_002549378.1| isocitrate dehydrogenase [Agrobacterium vitis S4] Length = 404 Back     alignment and organism information
>gi|222086159|ref|YP_002544691.1| isocitrate dehydrogenase, NADP-dependent [Agrobacterium radiobacter K84] Length = 404 Back     alignment and organism information
>gi|241204884|ref|YP_002975980.1| isocitrate dehydrogenase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 403 Back     alignment and organism information
>gi|190892004|ref|YP_001978546.1| isocitrate dehydrogenase (NADP(+)) protein [Rhizobium etli CIAT 652] Length = 403 Back     alignment and organism information
>gi|325293272|ref|YP_004279136.1| isocitrate dehydrogenase [Agrobacterium sp. H13-3] Length = 404 Back     alignment and organism information
>gi|256061279|ref|ZP_05451429.1| isocitrate dehydrogenase [Brucella neotomae 5K33] Length = 404 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target412 isocitrate dehydrogenase [Candidatus Liberibacter asiat
PRK08299402 PRK08299, PRK08299, isocitrate dehydrogenase; Validated 0.0
PTZ00435413 PTZ00435, PTZ00435, isocitrate dehydrogenase; Provision 0.0
PLN03065483 PLN03065, PLN03065, isocitrate dehydrogenase (NADP+); P 0.0
TIGR00127409 TIGR00127, nadp_idh_euk, isocitrate dehydrogenase, NADP 0.0
PLN00103410 PLN00103, PLN00103, isocitrate dehydrogenase (NADP+); P 0.0
COG0538407 COG0538, Icd, Isocitrate dehydrogenases [Energy product 1e-120
pfam00180349 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehydroge 4e-61
PLN00096393 PLN00096, PLN00096, isocitrate dehydrogenase (NADP+); P 7e-42
COG0473348 COG0473, LeuB, Isocitrate/isopropylmalate dehydrogenase 1e-08
KOG1526422 KOG1526, KOG1526, KOG1526, NADP-dependent isocitrate de 0.0
TIGR00169349 TIGR00169, leuB, 3-isopropylmalate dehydrogenase 5e-07
KOG0785365 KOG0785, KOG0785, KOG0785, Isocitrate dehydrogenase, al 2e-05
TIGR02924 473 TIGR02924, ICDH_alpha, isocitrate dehydrogenase 2e-06
PLN00118372 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+) 8e-05
TIGR00175333 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, NAD- 8e-05
PRK09222 482 PRK09222, PRK09222, isocitrate dehydrogenase; Validated 1e-04
TIGR00183416 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase, NAD 2e-04
TIGR02088322 TIGR02088, LEU3_arch, isopropylmalate/isohomocitrate de 1e-05
>gnl|CDD|181365 PRK08299, PRK08299, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185615 PTZ00435, PTZ00435, isocitrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|178617 PLN03065, PLN03065, isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>gnl|CDD|129233 TIGR00127, nadp_idh_euk, isocitrate dehydrogenase, NADP-dependent, eukaryotic type Back     alignment and domain information
>gnl|CDD|177720 PLN00103, PLN00103, isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>gnl|CDD|30884 COG0538, Icd, Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|143946 pfam00180, Iso_dh, Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|177715 PLN00096, PLN00096, isocitrate dehydrogenase (NADP+); Provisional Back     alignment and domain information
>gnl|CDD|30821 COG0473, LeuB, Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|36739 KOG1526, KOG1526, KOG1526, NADP-dependent isocitrate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|161740 TIGR00169, leuB, 3-isopropylmalate dehydrogenase Back     alignment and domain information
>gnl|CDD|36004 KOG0785, KOG0785, KOG0785, Isocitrate dehydrogenase, alpha subunit [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|163075 TIGR02924, ICDH_alpha, isocitrate dehydrogenase Back     alignment and domain information
>gnl|CDD|177731 PLN00118, PLN00118, isocitrate dehydrogenase (NAD+) Back     alignment and domain information
>gnl|CDD|161744 TIGR00175, mito_nad_idh, isocitrate dehydrogenase, NAD-dependent, mitochondrial type Back     alignment and domain information
>gnl|CDD|181708 PRK09222, PRK09222, isocitrate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|161750 TIGR00183, prok_nadp_idh, isocitrate dehydrogenase, NADP-dependent, prokaryotic type Back     alignment and domain information
>gnl|CDD|162693 TIGR02088, LEU3_arch, isopropylmalate/isohomocitrate dehydrogenases Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 412 isocitrate dehydrogenase [Candidatus Liberibacter asiat
TIGR02088350 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases 100.0
TIGR00175348 mito_nad_idh isocitrate dehydrogenase, NAD-dependent; I 100.0
PRK07362474 isocitrate dehydrogenase; Validated 100.0
COG0473348 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino ac 100.0
PRK09222 482 isocitrate dehydrogenase; Validated 100.0
PRK06451415 isocitrate dehydrogenase; Validated 100.0
PRK00772352 3-isopropylmalate dehydrogenase; Provisional 100.0
TIGR00169370 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR0044 100.0
TIGR02924 481 ICDH_alpha isocitrate dehydrogenase; InterPro: IPR01427 100.0
PRK07006409 isocitrate dehydrogenase; Reviewed 100.0
PRK08997334 isocitrate dehydrogenase; Provisional 100.0
PRK03437345 3-isopropylmalate dehydrogenase; Provisional 100.0
PRK08194352 tartrate dehydrogenase; Provisional 100.0
pfam00180349 Iso_dh Isocitrate/isopropylmalate dehydrogenase. 100.0
COG0538407 Icd Isocitrate dehydrogenases [Energy production and co 100.0
KOG0785365 consensus 100.0
TIGR02089355 TTC tartrate dehydrogenase; InterPro: IPR011829 Tartrat 100.0
PRK08299403 isocitrate dehydrogenase; Validated 100.0
KOG0784375 consensus 100.0
KOG1526422 consensus 100.0
KOG0786363 consensus 100.0
TIGR00183483 prok_nadp_idh isocitrate dehydrogenase, NADP-dependent; 100.0
TIGR00127413 nadp_idh_euk isocitrate dehydrogenase, NADP-dependent; 100.0
TIGR00178745 monomer_idh isocitrate dehydrogenase, NADP-dependent; I 97.81
pfam03971735 IDH Monomeric isocitrate dehydrogenase. NADP(+)-depende 99.45
COG2838744 Icd Monomeric isocitrate dehydrogenase [Energy producti 99.26
PRK03877328 consensus 96.63
PRK03743333 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 96.51
PRK04507323 consensus 96.49
PRK03946304 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 96.47
PRK02848341 consensus 96.47
PRK01909329 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Vali 96.31
PRK05312336 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 96.26
PRK04607330 consensus 96.22
PRK03367329 consensus 96.21
PRK00232334 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Revi 96.18
PRK03371326 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Pr 96.05
PRK02746332 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Prov 96.03
pfam04166299 PdxA Pyridoxal phosphate biosynthetic protein PdxA. In 95.82
COG1995332 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme 95.87
>TIGR02088 LEU3_arch isopropylmalate/isohomocitrate dehydrogenases; InterPro: IPR011828 This entry represents a group of archaeal decarboxylating dehydrogenases which include the leucine biosynthesis enzyme 3-isopropylmalate dehydrogenase (LeuB, LEU3) and the methanogenic cofactor CoB biosynthesis enzyme isohomocitrate dehydrogenase (AksF) Back     alignment and domain information
>TIGR00175 mito_nad_idh isocitrate dehydrogenase, NAD-dependent; InterPro: IPR004434 Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs Back     alignment and domain information
>PRK07362 isocitrate dehydrogenase; Validated Back     alignment and domain information
>COG0473 LeuB Isocitrate/isopropylmalate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09222 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK06451 isocitrate dehydrogenase; Validated Back     alignment and domain information
>PRK00772 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>TIGR00169 leuB 3-isopropylmalate dehydrogenase; InterPro: IPR004429 Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the dimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs Back     alignment and domain information
>TIGR02924 ICDH_alpha isocitrate dehydrogenase; InterPro: IPR014273 This entry represents a group of isocitrate dehydrogenases found mainly in the alphaproteobacteria Back     alignment and domain information
>PRK07006 isocitrate dehydrogenase; Reviewed Back     alignment and domain information
>PRK08997 isocitrate dehydrogenase; Provisional Back     alignment and domain information
>PRK03437 3-isopropylmalate dehydrogenase; Provisional Back     alignment and domain information
>PRK08194 tartrate dehydrogenase; Provisional Back     alignment and domain information
>pfam00180 Iso_dh Isocitrate/isopropylmalate dehydrogenase Back     alignment and domain information
>COG0538 Icd Isocitrate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>KOG0785 consensus Back     alignment and domain information
>TIGR02089 TTC tartrate dehydrogenase; InterPro: IPR011829 Tartrate dehydrogenase catalyzes the oxidation of both meso- and (+)-tartrate as well as a D-malate Back     alignment and domain information
>PRK08299 isocitrate dehydrogenase; Validated Back     alignment and domain information
>KOG0784 consensus Back     alignment and domain information
>KOG1526 consensus Back     alignment and domain information
>KOG0786 consensus Back     alignment and domain information
>TIGR00183 prok_nadp_idh isocitrate dehydrogenase, NADP-dependent; InterPro: IPR004439 Several NAD- or NADP-dependent dehydrogenases, including 3-isopropylmalate dehydrogenase, tartrate dehydrogenase, and the multimeric forms of isocitrate dehydrogenase, share a nucleotide binding domain unrelated to that of lactate dehydrogenase and its homologs Back     alignment and domain information
>TIGR00127 nadp_idh_euk isocitrate dehydrogenase, NADP-dependent; InterPro: IPR004790 Isocitrate dehydrogenase (IDH) , is an important enzyme of carbohydrate metabolism which catalyzes the oxidative decarboxylation of isocitrate into alpha-ketoglutarate Back     alignment and domain information
>TIGR00178 monomer_idh isocitrate dehydrogenase, NADP-dependent; InterPro: IPR004436 This family of enzymes catalyses the NADP(+)-dependent oxidative decarboxylation of isocitrate to form 2-oxoglutarate, CO2, and NADPH within the Krebs cycle (1 Back     alignment and domain information
>pfam03971 IDH Monomeric isocitrate dehydrogenase Back     alignment and domain information
>COG2838 Icd Monomeric isocitrate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK03877 consensus Back     alignment and domain information
>PRK03743 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK04507 consensus Back     alignment and domain information
>PRK03946 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK02848 consensus Back     alignment and domain information
>PRK01909 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK05312 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK04607 consensus Back     alignment and domain information
>PRK03367 consensus Back     alignment and domain information
>PRK00232 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK03371 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase 2; Provisional Back     alignment and domain information
>PRK02746 pdxA 4-hydroxythreonine-4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>pfam04166 PdxA Pyridoxal phosphate biosynthetic protein PdxA Back     alignment and domain information
>COG1995 PdxA Pyridoxal phosphate biosynthesis protein [Coenzyme metabolism] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target412 isocitrate dehydrogenase [Candidatus Liberibacter asiat
1lwd_A413 Crystal Structure Of Nadp-Dependent Isocitrate Dehy 1e-138
3mas_B419 Crystal Structure Of Heterodimeric R132h Mutant Of 1e-129
1t09_A414 Crystal Structure Of Human Cytosolic Nadp(+)-Depend 1e-129
2cmj_A410 Crystal Structure Of Mouse Cytosolic Isocitrate Deh 1e-129
3inm_A425 Crystal Structure Of Human Cytosolic Nadp(+)-Depend 1e-128
3map_A422 Crystal Structure Of Homodimeric R132h Mutant Of Hu 1e-128
2qfv_A427 Crystal Structure Of Saccharomyces Cerevesiae Mitoc 1e-127
1zor_A399 Isocitrate Dehydrogenase From The Hyperthermophile 1e-111
2uxq_A402 Isocitrate Dehydrogenase From The Psychrophilic Bac 1e-110
2iv0_A412 Thermal Stability Of Isocitrate Dehydrogenase From 9e-71
2d1c_A 496 Crystal Structure Of Tt0538 Protein From Thermus Th 4e-69
1hqs_A423 Crystal Structure Of Isocitrate Dehydrogenase From 2e-67
1v5b_A366 The Structure Of The Mutant, S225a And E251l, Of 3- 3e-66
2ayq_A366 3-Isopropylmalate Dehydrogenase From The Moderate F 1e-65
1v53_A366 The Crystal Structure Of 3-Isopropylmalate Dehydrog 1e-65
3blw_B354 Yeast Isocitrate Dehydrogenase With Citrate And Amp 2e-65
1x0l_A333 Crystal Structure Of Tetrameric Homoisocitrate Dehy 3e-65
1cm7_A363 3-Isopropylmalate Dehydrogenase From Escherichia Co 2e-64
1bl5_A414 Isocitrate Dehydrogenase From E. Coli Single Turnov 2e-64
1p8f_A416 A Four Location Model To Explain The Stereospecific 3e-64
1iso_A416 Isocitrate Dehydrogenase: Structure Of An Engineere 4e-64
6icd_A416 Regulation Of An Enzyme By Phosphorylation At The A 4e-64
1hj6_A416 Isocitrate Dehydrogenase S113e Mutant Complexed Wit 4e-64
4icd_A416 Regulation Of Isocitrate Dehydrogenase By Phosphory 5e-64
1vlc_A366 Crystal Structure Of 3-Isopropylmalate Dehydrogenas 5e-64
1cnz_A363 3-Isopropylmalate Dehydrogenase (Ipmdh) From Salmon 5e-64
1cw7_A416 Low Temperature Structure Of Wild-Type Idh Complexe 6e-64
1grp_A416 Regulatory And Catalytic Mechanisms In Escherichia 2e-63
1gro_A416 Regulatory And Catalytic Mechanisms In Escherichia 2e-63
1idd_A416 Isocitrate Dehydrogenase Y160f Mutant Apo Enzyme Le 5e-63
3ah3_A334 Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehyd 8e-63
1cw1_A416 Crystal Structure Of Isocitrate Dehydrogenase Mutan 1e-62
2d4v_A429 Crystal Structure Of Nad Dependent Isocitrate Dehyd 1e-62
2dht_A409 Crystal Structure Of Isocitrate Dehydrogenase From 3e-62
1a05_A358 Crystal Structure Of The Complex Of 3-Isopropylmala 9e-62
3dms_A427 1.65a Crystal Structure Of Isocitrate Dehydrogenase 2e-60
3blw_A349 Yeast Isocitrate Dehydrogenase With Citrate And Amp 2e-60
3blv_B354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 3e-59
1xac_A345 Chimera Isopropylmalate Dehydrogenase Between Bacil 7e-59
1v94_A435 Crystal Structure Of Isocitrate Dehydrogenase From 7e-59
3fmx_X364 Crystal Structure Of Tartrate Dehydrogenase From Ps 1e-58
3blv_A354 Yeast Isocitrate Dehydrogenase With Citrate Bound I 9e-58
1gc8_A345 The Crystal Structure Of Thermus Thermophilus 3- Is 2e-57
1osj_A345 Structure Of 3-Isopropylmalate Dehydrogenase Length 2e-57
1ipd_A345 Three-Dimensional Structure Of A Highly Thermostabl 4e-57
1osi_A345 Structure Of 3-Isopropylmalate Dehydrogenase Length 4e-57
1g2u_A345 The Structure Of The Mutant, A172v, Of 3-Isopropylm 6e-57
1dpz_A349 Stucture Of Modified 3-Isopropylmalate Dehydrogenas 7e-57
1wpw_A336 Crystal Structure Of Ipmdh From Sulfolobus Tokodaii 8e-57
1gc9_A345 The Crystal Structure Of Thermus Thermophilus 3- Is 1e-56
1wal_A345 3-Isopropylmalate Dehydrogenase (Ipmdh) Mutant (M21 1e-56
1dr0_A346 Structure Of Modified 3-Isopropylmalate Dehydrogena 4e-56
2y3z_A359 Structure Of Isopropylmalate Dehydrogenase From The 4e-56
1idm_A343 3-Isopropylmalate Dehydrogenase, Loop-Deleted Chime 4e-56
1dr8_A344 Structure Of Modified 3-Isopropylmalate Dehydrogena 5e-56
3flk_A364 Crystal Structure Of Tartrate Dehydrogenase From Ps 2e-55
1w0d_A337 The High Resolution Structure Of Mycobacterium Tube 2e-51
2b0t_A738 Structure Of Monomeric Nadp Isocitrate Dehydrogenas 4e-04
>gi|27065480|pdb|1LWD|A Chain A, Crystal Structure Of Nadp-Dependent Isocitrate Dehydrogenase From Porcine Heart Mitochondria Length = 413 Back     alignment and structure
 Score =  494 bits (1273), Expect = e-138,   Method: Composition-based stats.
 Identities = 257/410 (62%), Positives = 316/410 (77%), Gaps = 7/410 (1%)

Query: 2   KKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDAA 61
           ++IKV KPVV +DGDEMTRIIWQ I+E LI P++D++++YFDL + NRD T+DQVTID+A
Sbjct: 3   QRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDSA 62

Query: 62  HAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRLI 121
            A +   V +KCATIT D+ARV+EF LKKMWKSPNGTIRNILGG +FREPIIC N+PRL+
Sbjct: 63  LATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRLV 122

Query: 122 PGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQ-TIEKEVFDSPGSGIAMAM 180
           PGW KPI IGRHA GDQY+ATDF     G   + F   DG    + EV++ P  G+ M M
Sbjct: 123 PGWTKPITIGRHAHGDQYKATDFVVDRAGTFKIVFTPKDGSSAKQWEVYNFPAGGVGMGM 182

Query: 181 YNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDEL 240
           YN D+SI  FA +  QYA+ ++ PLY+STK+TILK+YDGRFK+IF EIFE  +K  FD+ 
Sbjct: 183 YNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFEKHYKTDFDKY 242

Query: 241 GITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGKT 300
            I Y HRLIDDMVA  +K SGG++WACKNYDGDVQSDI+AQGFGSLGLMTSVL+  DGKT
Sbjct: 243 KIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGKT 302

Query: 301 METEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLERV 360
           +E EAAHGTVTRHYR+HQ+G+ TSTN IASIFAWTRGL HR KLD N +L +FA+ LE+V
Sbjct: 303 IEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEKV 362

Query: 361 CIKTVEDGFMTKDLALLIGP------EQDWLSTTDFIEKISDNLRDALQK 404
           C++TVE G MTKDLA  I         + +L+T+DF++ I  NL  AL +
Sbjct: 363 CVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTSDFLDTIKSNLDRALGR 412


>gi|311772125|pdb|3MAS|B Chain B, Crystal Structure Of Heterodimeric R132h Mutant Of Human Cytosolic Nadp(+)-Dependent Isocitrate Dehydrogenase In Complex With Nadp And Isocitrate Length = 419 Back     alignment and structure
gi|50513663|pdb|1T09|A Chain A, Crystal Structure Of Human Cytosolic Nadp(+)-Dependent Isocitrate Dehydrogenase In Complex Nadp Length = 414 Back     alignment and structure
>gi|149241012|pdb|2CMJ|A Chain A, Crystal Structure Of Mouse Cytosolic Isocitrate Dehydrogenase Length = 410 Back     alignment and structure
>gi|269914486|pdb|3INM|A Chain A, Crystal Structure Of Human Cytosolic Nadp(+)-Dependent Isocitrate Dehydrogenase R132h Mutant In Complex With Nadph, Alpha-Ketoglutarate And Calcium(2+) Length = 425 Back     alignment and structure
>gi|311772120|pdb|3MAP|A Chain A, Crystal Structure Of Homodimeric R132h Mutant Of Human Cytosolic Nadp(+)-Dependent Isocitrate Dehydrogenase In Complex With Nadp And Isocitrate Length = 422 Back     alignment and structure
>gi|193506511|pdb|2QFV|A Chain A, Crystal Structure Of Saccharomyces Cerevesiae Mitochondrial Nadp(+)-Dependent Isocitrate Dehydrogenase In Complex With Nadp(+) Length = 427 Back     alignment and structure
gi|109157004|pdb|1ZOR|A Chain A, Isocitrate Dehydrogenase From The Hyperthermophile Thermotoga Maritima Length = 399 Back     alignment and structure
gi|167013333|pdb|2UXQ|A Chain A, Isocitrate Dehydrogenase From The Psychrophilic Bacterium Desulfotalea Psychrophila: Biochemical Properties And Crystal Structure Analysis Length = 402 Back     alignment and structure
gi|146387283|pdb|2IV0|A Chain A, Thermal Stability Of Isocitrate Dehydrogenase From Archaeoglobus Fulgidus Studied By Crystal Structure Analysis And Engineering Of Chimers Length = 412 Back     alignment and structure
gi|118137468|pdb|2D1C|A Chain A, Crystal Structure Of Tt0538 Protein From Thermus Thermophilus Hb8 Length = 496 Back     alignment and structure
>gi|15826081|pdb|1HQS|A Chain A, Crystal Structure Of Isocitrate Dehydrogenase From Bacillus Subtilis Length = 423 Back     alignment and structure
>gi|61680088|pdb|1V5B|A Chain A, The Structure Of The Mutant, S225a And E251l, Of 3- Isopropylmalate Dehydrogenase From Bacillus Coagulans Length = 366 Back     alignment and structure
gi|3212661|pdb|2AYQ|A Chain A, 3-Isopropylmalate Dehydrogenase From The Moderate Facultative Thermophile, Bacillus Coagulans Length = 366 Back     alignment and structure
>gi|61680082|pdb|1V53|A Chain A, The Crystal Structure Of 3-Isopropylmalate Dehydrogenase From Bacillus Coagulans Length = 366 Back     alignment and structure
>gi|167013439|pdb|3BLW|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>gi|78100865|pdb|1X0L|A Chain A, Crystal Structure Of Tetrameric Homoisocitrate Dehydrogenase From An Extreme Thermophile, Thermus Thermophilus Length = 333 Back     alignment and structure
gi|5542195|pdb|1CM7|A Chain A, 3-Isopropylmalate Dehydrogenase From Escherichia Coli Length = 363 Back     alignment and structure
>gi|157830369|pdb|1BL5|A Chain A, Isocitrate Dehydrogenase From E. Coli Single Turnover Laue Structure Of Rate-Limited Product Complex, 10 Msec Time Resolution Length = 414 Back     alignment and structure
gi|31616007|pdb|1P8F|A Chain A, A Four Location Model To Explain The Stereospecificity Of Proteins. Length = 416 Back     alignment and structure
>gi|157831499|pdb|1ISO|A Chain A, Isocitrate Dehydrogenase: Structure Of An Engineered Nadp+-- > Nad+ Specificity-Reversal Mutant Length = 416 Back     alignment and structure
>gi|157837106|pdb|6ICD|A Chain A, Regulation Of An Enzyme By Phosphorylation At The Active Site Length = 416 Back     alignment and structure
>gi|13096649|pdb|1HJ6|A Chain A, Isocitrate Dehydrogenase S113e Mutant Complexed With Isopropylmalate, Nadp+ And Magnesium (Flash-Cooled) Length = 416 Back     alignment and structure
>gi|253723332|pdb|4ICD|A Chain A, Regulation Of Isocitrate Dehydrogenase By Phosphorylation Involves No Long-Range Conformational Change In The Free Enzyme Length = 416 Back     alignment and structure
>gi|55670449|pdb|1VLC|A Chain A, Crystal Structure Of 3-Isopropylmalate Dehydrogenase (Tm0556) From Thermotoga Maritima At 1.90 A Resolution Length = 366 Back     alignment and structure
gi|5107574|pdb|1CNZ|A Chain A, 3-Isopropylmalate Dehydrogenase (Ipmdh) From Salmonella Typhimurium Length = 363 Back     alignment and structure
>gi|6137748|pdb|1CW7|A Chain A, Low Temperature Structure Of Wild-Type Idh Complexed With Mg-Isocitrate Length = 416 Back     alignment and structure
>gi|157831249|pdb|1GRP|A Chain A, Regulatory And Catalytic Mechanisms In Escherichia Coli Isocitrate Dehydrogenase: Multiple Roles For N115 Length = 416 Back     alignment and structure
>gi|157831248|pdb|1GRO|A Chain A, Regulatory And Catalytic Mechanisms In Escherichia Coli Isocitrate Dehydrogenase: Multiple Roles For N115 Length = 416 Back     alignment and structure
>gi|157831426|pdb|1IDD|A Chain A, Isocitrate Dehydrogenase Y160f Mutant Apo Enzyme Length = 416 Back     alignment and structure
>gi|321159631|pdb|3AH3|A Chain A, Crystal Structure Of Lr5-1, 3-Isopropylmalate Dehydrogenase Created By Directed Evolution Length = 334 Back     alignment and structure
>gi|5822037|pdb|1CW1|A Chain A, Crystal Structure Of Isocitrate Dehydrogenase Mutant K230m Bound To Isocitrate And Mn2+ Length = 416 Back     alignment and structure
>gi|119389093|pdb|2D4V|A Chain A, Crystal Structure Of Nad Dependent Isocitrate Dehydrogenase From Acidithiobacillus Thiooxidans Length = 429 Back     alignment and structure
gi|145579150|pdb|2DHT|A Chain A, Crystal Structure Of Isocitrate Dehydrogenase From Sulfolobus Tokodaii Strain7 Length = 409 Back     alignment and structure
gi|3318965|pdb|1A05|A Chain A, Crystal Structure Of The Complex Of 3-Isopropylmalate Dehydrogenase From Thiobacillus Ferrooxidans With 3- Isopropylmalate Length = 358 Back     alignment and structure
>gi|194320132|pdb|3DMS|A Chain A, 1.65a Crystal Structure Of Isocitrate Dehydrogenase From Burkholderia Pseudomallei Length = 427 Back     alignment and structure
>gi|167013438|pdb|3BLW|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate And Amp Bound In The Regulatory Subunits Length = 349 Back     alignment and structure
>gi|167013431|pdb|3BLV|B Chain B, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>gi|157834225|pdb|1XAC|A Chain A, Chimera Isopropylmalate Dehydrogenase Between Bacillus Subtilis (M) And Thermus Thermophilus (T) From N-Terminal: 20% T Middle 20% M Residual 60% T, Mutated At S82r. Low Temperature (100k) Structure. Length = 345 Back     alignment and structure
>gi|60593690|pdb|1V94|A Chain A, Crystal Structure Of Isocitrate Dehydrogenase From Aeropyrum Pernix Length = 435 Back     alignment and structure
>gi|167013430|pdb|3BLV|A Chain A, Yeast Isocitrate Dehydrogenase With Citrate Bound In The Regulatory Subunits Length = 354 Back     alignment and structure
>gi|10835548|pdb|1GC8|A Chain A, The Crystal Structure Of Thermus Thermophilus 3- Isopropylmalate Dehydrogenase Mutated At 172th From Ala To Phe Length = 345 Back     alignment and structure
>gi|1942481|pdb|1OSJ|A Chain A, Structure Of 3-Isopropylmalate Dehydrogenase Length = 345 Back     alignment and structure
>gi|157831487|pdb|1IPD|A Chain A, Three-Dimensional Structure Of A Highly Thermostable Enzyme, 3-Isopropylmalate Dehydrogenase Of Thermus Thermophilus At 2.2 Angstroms Resolution Length = 345 Back     alignment and structure
gi|1942477|pdb|1OSI|A Chain A, Structure Of 3-Isopropylmalate Dehydrogenase Length = 345 Back     alignment and structure
>gi|11514206|pdb|1G2U|A Chain A, The Structure Of The Mutant, A172v, Of 3-Isopropylmalate Dehydrogenase From Thermus Thermophilus Hb8 : Its Thermostability And Structure Length = 345 Back     alignment and structure
>gi|6980658|pdb|1DPZ|A Chain A, Stucture Of Modified 3-Isopropylmalate Dehydrogenase At The C-Terminus, Hd711 Length = 349 Back     alignment and structure
>gi|55670759|pdb|1WPW|A Chain A, Crystal Structure Of Ipmdh From Sulfolobus Tokodaii Length = 336 Back     alignment and structure
>gi|10835550|pdb|1GC9|A Chain A, The Crystal Structure Of Thermus Thermophilus 3- Isopropylmalate Dehydrogenase Mutated At 172th From Ala To Gly Length = 345 Back     alignment and structure
gi|5107701|pdb|1WAL|A Chain A, 3-Isopropylmalate Dehydrogenase (Ipmdh) Mutant (M219a)from Thermus Thermophilus Length = 345 Back     alignment and structure
>gi|6980526|pdb|1DR0|A Chain A, Structure Of Modified 3-Isopropylmalate Dehydrogenase At The C-Terminus, Hd708 Length = 346 Back     alignment and structure
>gi|319443417|pdb|2Y3Z|A Chain A, Structure Of Isopropylmalate Dehydrogenase From Thermus Thermophilus - Apo Enzyme Length = 359 Back     alignment and structure
>gi|157831430|pdb|1IDM|A Chain A, 3-Isopropylmalate Dehydrogenase, Loop-Deleted Chimera Length = 343 Back     alignment and structure
>gi|6980528|pdb|1DR8|A Chain A, Structure Of Modified 3-Isopropylmalate Dehydrogenase At The C-Terminus, Hd177 Length = 344 Back     alignment and structure
>gi|281500720|pdb|3FLK|A Chain A, Crystal Structure Of Tartrate Dehydrogenase From Pseudomonas Complex With Nadh, Oxalate And Metal Ion Length = 364 Back     alignment and structure
>gi|58177068|pdb|1W0D|A Chain A, The High Resolution Structure Of Mycobacterium Tuberculosis Leub (Rv2995c) Length = 337 Back     alignment and structure
gi|88192194|pdb|2B0T|A Chain A, Structure Of Monomeric Nadp Isocitrate Dehydrogenase Length = 738 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target412 isocitrate dehydrogenase [Candidatus Liberibacter asiat
1lwd_A413 Isocitrate dehydrogenase; tricarboxylic acid cycle, oxi 1e-123
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, oxidore 1e-118
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, cold ad 1e-102
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-proline 3e-93
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tri 2e-46
3dms_A427 Isocitrate dehydrogenase [NADP]; structural genomics, s 3e-45
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp complex, ox 2e-34
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate dehyd 2e-29
1v53_A366 3-isopropylmalate dehydrogenase; IPMDH, HOMO dimer, X-R 1e-27
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structural gen 6e-27
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, isoci 8e-27
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoredu 2e-25
1g2u_A345 IPMDH, 3-isopropylmalate dehydrogenase; beta-barrel, NA 1e-24
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, 2e-22
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarboxylic 1e-31
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); 2e-30
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A 3e-21
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPPSFA, 4e-20
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, decarboxy 1e-18
1itw_A741 Isocitrate dehydrogenase; greece KEY motif, oxidoreduct 3e-27
>1lwd_A Isocitrate dehydrogenase; tricarboxylic acid cycle, oxidoreductase, NADP; HET: ICT; 1.85A {Sus scrofa} SCOP: c.77.1.1 PDB: 1t0l_A* 1t09_A* 3inm_A* 2cmj_A* 2cmv_A* Length = 413 Back     alignment and structure
 Score =  435 bits (1120), Expect = e-123
 Identities = 257/411 (62%), Positives = 318/411 (77%), Gaps = 7/411 (1%)

Query: 1   MKKIKVTKPVVSLDGDEMTRIIWQLIQENLIHPYLDIKIEYFDLSIQNRDLTDDQVTIDA 60
            ++IKV KPVV +DGDEMTRIIWQ I+E LI P++D++++YFDL + NRD T+DQVTID+
Sbjct: 2   DQRIKVAKPVVEMDGDEMTRIIWQFIKEKLILPHVDVQLKYFDLGLPNRDQTNDQVTIDS 61

Query: 61  AHAIKNCGVGIKCATITADQARVKEFNLKKMWKSPNGTIRNILGGIIFREPIICSNVPRL 120
           A A +   V +KCATIT D+ARV+EF LKKMWKSPNGTIRNILGG +FREPIIC N+PRL
Sbjct: 62  ALATQKYSVAVKCATITPDEARVEEFKLKKMWKSPNGTIRNILGGTVFREPIICKNIPRL 121

Query: 121 IPGWKKPIIIGRHAFGDQYRATDFQFPSKGKLILKFVGDDGQTIEK-EVFDSPGSGIAMA 179
           +PGW KPI IGRHA GDQY+ATDF     G   + F   DG + ++ EV++ P  G+ M 
Sbjct: 122 VPGWTKPITIGRHAHGDQYKATDFVVDRAGTFKIVFTPKDGSSAKQWEVYNFPAGGVGMG 181

Query: 180 MYNLDDSIRNFARAAMQYALARQLPLYLSTKDTILKSYDGRFKNIFNEIFEAEFKNQFDE 239
           MYN D+SI  FA +  QYA+ ++ PLY+STK+TILK+YDGRFK+IF EIFE  +K  FD+
Sbjct: 182 MYNTDESISGFAHSCFQYAIQKKWPLYMSTKNTILKAYDGRFKDIFQEIFEKHYKTDFDK 241

Query: 240 LGITYTHRLIDDMVASSIKWSGGYIWACKNYDGDVQSDIVAQGFGSLGLMTSVLITADGK 299
             I Y HRLIDDMVA  +K SGG++WACKNYDGDVQSDI+AQGFGSLGLMTSVL+  DGK
Sbjct: 242 YKIWYEHRLIDDMVAQVLKSSGGFVWACKNYDGDVQSDILAQGFGSLGLMTSVLVCPDGK 301

Query: 300 TMETEAAHGTVTRHYRQHQQGKETSTNSIASIFAWTRGLLHRAKLDENAELKKFAENLER 359
           T+E EAAHGTVTRHYR+HQ+G+ TSTN IASIFAWTRGL HR KLD N +L +FA+ LE+
Sbjct: 302 TIEAEAAHGTVTRHYREHQKGRPTSTNPIASIFAWTRGLEHRGKLDGNQDLIRFAQTLEK 361

Query: 360 VCIKTVEDGFMTKDLALLIG------PEQDWLSTTDFIEKISDNLRDALQK 404
           VC++TVE G MTKDLA  I         + +L+T+DF++ I  NL  AL +
Sbjct: 362 VCVETVESGAMTKDLAGCIHGLSNVKLNEHFLNTSDFLDTIKSNLDRALGR 412


>2qfy_A Isocitrate dehydrogenase [NADP]; rossmann fold, oxidoreductase; HET: AKG; 2.10A {Saccharomyces cerevisiae} PDB: 2qfw_A* 2qfx_A* 2qfv_A* Length = 427 Back     alignment and structure
>2uxq_A Isocitrate dehydrogenase native; psychrophilic, cold adaptation, thermal stability, oxidoreductase; HET: SO4 PEG; 1.75A {Desulfotalea psychrophila} PDB: 2uxr_A* Length = 402 Back     alignment and structure
>1zor_A Isocitrate dehydrogenase; wild type enzyme, CIS-proline, thermostable, oxidoreductase; 2.24A {Thermotoga maritima MSB8} Length = 399 Back     alignment and structure
>1hqs_A Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tricarboxylic acid cycle, oxidoreductase, protein phosphorylation, NADP; HET: CME CIT; 1.55A {Bacillus subtilis} SCOP: c.77.1.1 Length = 423 Back     alignment and structure
>3dms_A Isocitrate dehydrogenase [NADP]; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.65A {Burkholderia pseudomallei} PDB: 1pb1_A* 1ai3_A* 1ika_A* 1ai2_A* 1p8f_A* 1pb3_A 1sjs_A 3icd_A 4icd_A* 5icd_A* 9icd_A* 1bl5_A* 1cw7_A* 1idd_A 1ide_A* 1hj6_A* 7icd_A 8icd_A* 6icd_A 1cw1_A* ... Length = 427 Back     alignment and structure
>1tyo_A Isocitrate dehydrogenase; enzyme-ethenonadp complex, oxidoreductase; HET: ENP; 2.15A {Aeropyrum pernix} PDB: 1v94_A 1xgv_A 1xkd_A* Length = 435 Back     alignment and structure
>2e0c_A 409AA long hypothetical NADP-dependent isocitrate dehydrogenase; homedimer, oxidoreductase; 2.00A {Sulfolobus tokodaii str} PDB: 2dht_A 2e5m_A* Length = 409 Back     alignment and structure
>1v53_A 3-isopropylmalate dehydrogenase; IPMDH, HOMO dimer, X-RAY analysis, oxidoreductase; 2.85A {Bacillus coagulans} SCOP: c.77.1.1 PDB: 2ayq_A 1v5b_A Length = 366 Back     alignment and structure
>1vlc_A 3-isopropylmalate dehydrogenase; TM0556, structural genomics, JCSG, PSI, protein structure initiative, joint center for structural genomics; 1.90A {Thermotoga maritima} SCOP: c.77.1.1 Length = 366 Back     alignment and structure
>2d4v_A Isocitrate dehydrogenase; alpha and beta protein, isocitrate/isopropylmalate dehydrogenase-like fold, oxidoreductase; HET: FLC NAD; 1.90A {Acidithiobacillus thiooxidans} Length = 429 Back     alignment and structure
>1a05_A IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, leucine biosynthesis; HET: IPM; 2.00A {Thiobacillus ferrooxidans} SCOP: c.77.1.1 Length = 358 Back     alignment and structure
>1g2u_A IPMDH, 3-isopropylmalate dehydrogenase; beta-barrel, NAD binding, oxidoreductase; 2.10A {Thermus thermophilus HB8} SCOP: c.77.1.1 PDB: 1osj_A 1gc8_A 1xaa_A 1osi_A 1hex_A 1xab_A 2ztw_A* 1gc9_A 1ipd_A 1wal_A 1dpz_A 1dr0_A 1dr8_A 1idm_A 1xac_A 1xad_A Length = 345 Back     alignment and structure
>3flk_A Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, magnesium, manganese, NAD, oxidoreductase; HET: NAD; 2.00A {Pseudomonas putida} PDB: 3fmx_X* Length = 364 Back     alignment and structure
>2iv0_A Isocitrate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, domain swapping, phosphorylation, aromatic cluster, NADP; 2.5A {Archaeoglobus fulgidus} Length = 412 Back     alignment and structure
>1cnz_A IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); oxidoreductase, leucine biosynthetic pathway, NAD-dependant enzyme; 1.76A {Salmonella typhimurium} SCOP: c.77.1.1 PDB: 1cm7_A Length = 363 Back     alignment and structure
>1wpw_A 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A {Sulfolobus tokodaii} SCOP: c.77.1.1 Length = 336 Back     alignment and structure
>2d1c_A Isocitrate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAP CIT; 1.80A {Thermus thermophilus HB8} Length = 496 Back     alignment and structure
>1x0l_A Homoisocitrate dehydrogenase; oxidoreductase, decarboxylating dehydrogenase, lysine biosynthesis; 1.85A {Thermus thermophilus} Length = 333 Back     alignment and structure
>1itw_A Isocitrate dehydrogenase; greece KEY motif, oxidoreductase; HET: ICT; 1.95A {Azotobacter vinelandii} SCOP: c.77.1.2 PDB: 1j1w_A* Length = 741 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target412 isocitrate dehydrogenase [Candidatus Liberibacter asiat
2qfy_A427 Isocitrate dehydrogenase [NADP]; rossmann fold, oxidore 100.0
1lwd_A413 Isocitrate dehydrogenase; tricarboxylic acid cycle, oxi 100.0
2uxq_A402 Isocitrate dehydrogenase native; psychrophilic, cold ad 100.0
1zor_A399 Isocitrate dehydrogenase; wild type enzyme, CIS-proline 100.0
1hqs_A423 Isocitrate dehydrogenase; glyoxylate bypass, bsidh, tri 100.0
2d1c_A 496 Isocitrate dehydrogenase; structural genomics, NPPSFA, 100.0
1x0l_A333 Homoisocitrate dehydrogenase; oxidoreductase, decarboxy 100.0
2d4v_A429 Isocitrate dehydrogenase; alpha and beta protein, isoci 100.0
2iv0_A412 Isocitrate dehydrogenase; oxidoreductase, tricarboxylic 100.0
2e0c_A409 409AA long hypothetical NADP-dependent isocitrate dehyd 100.0
1cnz_A363 IPMDH, IMDH, protein (3-isopropylmalate dehydrogenase); 100.0
1v53_A366 3-isopropylmalate dehydrogenase; IPMDH, HOMO dimer, X-R 100.0
3dms_A427 Isocitrate dehydrogenase [NADP]; structural genomics, s 100.0
1tyo_A435 Isocitrate dehydrogenase; enzyme-ethenonadp complex, ox 100.0
3flk_A364 Tartrate dehydrogenase/decarboxylase; cytoplasm, lyase, 100.0
1vlc_A366 3-isopropylmalate dehydrogenase; TM0556, structural gen 100.0
1a05_A358 IPMDH, IMDH, 3-isopropylmalate dehydrogenase; oxidoredu 100.0
1wpw_A336 3-isopropylmalate dehydrogenase; oxidoreductase; 2.80A 100.0
1w0d_A337 3-isopropylmalate dehydrogenase; oxidoreductase, leucin 100.0
1g2u_A345 IPMDH, 3-isopropylmalate dehydrogenase; beta-barrel, NA 100.0
3blx_B354 Isocitrate dehydrogenase [NAD] subunit 2; TCA cycle, ox 100.0
3blx_A349 Isocitrate dehydrogenase [NAD] subunit 1; TCA cycle, ox 100.0
1itw_A741 Isocitrat