254780915

254780915

oligoendopeptidase F

GeneID in NCBI database:8209935Locus tag:CLIBASIA_04070
Protein GI in NCBI database:254780915Protein Accession:YP_003065328.1
Gene range:-(893296, 895176)Protein Length:626aa
Gene description:oligoendopeptidase F
COG prediction:[E] Oligoendopeptidase F
KEGG prediction:oligoendopeptidase F; K08602 oligoendopeptidase F [EC:3.4.24.-]
SEED prediction:Oligoendopeptidase F
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED2 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM1 TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620------
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
ccccccHHHHHHHHHHHHccHHHHHHcccHHHHHHccccccHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccHHHHHHHHHHcccccccccEEEEHHHHHHHHHcccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHccHHHHHHHHHHHHcccccccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHccccccHHHHHHHHHHHHHHHcccccccccccccccccccccEEcccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHcc
cccccccccccccEEEccccHHHHHHcccHHHccccccccHHHHcccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHccHHHHHHHHHHcHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccHHHcccccccccEccccccEEEccccHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccccHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccccHcccEcccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHccEEEEcccccccccccccccccccccEEEEEccccHcHHHHHHHHHcccHHHHHHccccccccccccEEEEEHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHccccEEEccccccEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHHHHHHccccccccHHHHHHHHHHHHHHHHHHcc
mtkypdyeffsNAFFRKalrssdmttmdsqenlgnlprwnledlypshdsqeisndmecieheSLAFKTRWEgnlahatnqkncHSLGAAIAEYERICELIGRIASYAMLSyncnlssptiRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQsyaqdpltlKYSAWIKNIRKIKKHLLSNDmecllsdtSQVGREALKRFFCENIESLRFKindqkipltkAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIAdsrhlsnnvEPYVIEALMQSVknyypktshRYYELKKKWLKLDTMYfwdrlaplpgtsqdiipfEVARDLVLQSYAKFSPQMSIIAEKffthnwidapqydgkgsgafahgtipsvhPYILLNYLGKPQDVMTLAHELGHgihfvlssetqgiltnnssltLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHterrstgdipthRINEIWLETqkeslgpafdlsdleygsfwmmvphfiESSFYVYAYAFGNCLVNSLydiyksntvdcFKEKYLNILRagnskhyselllplninlsdpnfwERGLQTVEKMIDDVEKM
mtkypdyeffsNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIEslrfkindqkiplTKAYKSFFDSDREVRKSAAKALshtfnksshifSFITntlakdeeiQDRWRKYEKiadsrhlsnnvEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHterrstgdipthRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
********FFSNAF***********************RWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKA**********VRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFD************LSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
***YPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM
MTKYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
315122737621 oligoendopeptidase F [Candidatus Liberibacter solanacea 1 0.0
227823369622 oligoendopeptidase F [Sinorhizobium fredii NGR234] Leng 1 1e-178
163758860601 putative oligoendopeptidase f protein [Hoeflea phototro 1 1e-178
241206286617 oligoendopeptidase, pepF/M3 family [Rhizobium leguminos 1 1e-177
222149716619 oligoendopeptidase F [Agrobacterium vitis S4] Length = 1 1e-177
306845298620 oligoendopeptidase, pepF/M3 family [Brucella sp. BO1] L 1 1e-176
254699397620 Neutral zinc metallopeptidase, zinc-binding region [Bru 1 1e-176
319781622610 oligoendopeptidase, pepF/M3 family [Mesorhizobium cicer 1 1e-176
225685947620 oligoendopeptidase, pepF/M3 family protein [Brucella me 1 1e-176
254720668620 Neutral zinc metallopeptidase, zinc-binding region [Bru 1 1e-176
>gi|315122737|ref|YP_004063226.1| oligoendopeptidase F [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 621 Back     alignment and organism information
 Score =  890 bits (2301), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 430/624 (68%), Positives = 512/624 (82%), Gaps = 8/624 (1%)

Query: 3   KYPDYEFFSNAFFRKALRSSDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEH 62
           K P  +F    FF   ++       DS E LG+LPRWNL+DLYPSHDS+EI  DME ++H
Sbjct: 6   KSPTDDFAPKIFFSPDIKK------DSTEYLGDLPRWNLKDLYPSHDSKEILTDMERLDH 59

Query: 63  ESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIASYAMLSYNCNLSSPTIR 122
           ESLAF+TRW+GNL +ATNQ     LGAAI+EYE++ +L GRI SYA L Y+ +LS  TI 
Sbjct: 60  ESLAFRTRWKGNLENATNQTGSTGLGAAISEYEKLSDLAGRIYSYAYLLYSTHLSDQTIC 119

Query: 123 KFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHLL 182
           KF+TD NAK+ D E+ LIFF LEIN LD  LLE+SY QD L LKYS WIKNIRK KKHLL
Sbjct: 120 KFHTDTNAKITDLEQRLIFFTLEINDLDNTLLEKSYNQDLLALKYSPWIKNIRKYKKHLL 179

Query: 183 SNDMECLLSDTSQVGREALKRFFCENIESLRFKINDQKIPLTKAYKSFFDSDREVRKSAA 242
           S+++ECL SDT+Q G EALK FF E +E+LRFK+NDQK+PL KA     + DR++R+S+ 
Sbjct: 180 SDELECLFSDTAQTGSEALKHFFSETLETLRFKVNDQKLPLEKASTLLLNPDRKIRESSG 239

Query: 243 KALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVK 302
           KA+S TF K+SHIFSFITNTLAKD EIQD+WRKYE ++DSRHLSN++EPYVIE+L+QSVK
Sbjct: 240 KAISKTFEKNSHIFSFITNTLAKDREIQDKWRKYENVSDSRHLSNDIEPYVIESLVQSVK 299

Query: 303 NYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM 362
           NYYPK SHRYY LKK+WLKLD MYFWDR APL  +S+ IIPFE ARD+ L SYAKFSPQM
Sbjct: 300 NYYPKISHRYYSLKKQWLKLDKMYFWDRSAPLLDSSEVIIPFEKARDITLASYAKFSPQM 359

Query: 363 SIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTLAHELGHGI 422
           S IAEKFF++NWIDAPQ +GKG GAF+HGT+PS HPYI LNY GK +DV TLAHELGHGI
Sbjct: 360 SEIAEKFFSNNWIDAPQCEGKGIGAFSHGTVPSSHPYISLNYSGKSRDVTTLAHELGHGI 419

Query: 423 HFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNS 482
           H VLS++ QG L  N+ L LAETASIFGE LTFDSL+ + S++ +RKILL +KIED L+S
Sbjct: 420 HQVLSAQ-QGALMANAPLILAETASIFGEALTFDSLIDSISNEHDRKILLTHKIEDSLSS 478

Query: 483 IVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVP 542
           I+RQI+FYDFEL++HTERR TG IP  RINEIWLETQKESLGPAF+L +  Y +FWMM+P
Sbjct: 479 IIRQIAFYDFELRIHTERR-TGSIPIQRINEIWLETQKESLGPAFELDNSGYDNFWMMIP 537

Query: 543 HFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKYLNILRAGNSKHYSELLLPLNIN 602
           HFI SSFYVY+Y+FGNCLVNSLY+IYKSNTVD F++KYLNILRAGNSK++SELL PLNI+
Sbjct: 538 HFIHSSFYVYSYSFGNCLVNSLYEIYKSNTVDQFQKKYLNILRAGNSKNHSELLQPLNID 597

Query: 603 LSDPNFWERGLQTVEKMIDDVEKM 626
           LSDPNFW RGLQ VE+MIDD+E+M
Sbjct: 598 LSDPNFWNRGLQAVERMIDDLEQM 621


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823369|ref|YP_002827341.1| oligoendopeptidase F [Sinorhizobium fredii NGR234] Length = 622 Back     alignment and organism information
>gi|163758860|ref|ZP_02165947.1| putative oligoendopeptidase f protein [Hoeflea phototrophica DFL-43] Length = 601 Back     alignment and organism information
>gi|241206286|ref|YP_002977382.1| oligoendopeptidase, pepF/M3 family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 617 Back     alignment and organism information
>gi|222149716|ref|YP_002550673.1| oligoendopeptidase F [Agrobacterium vitis S4] Length = 619 Back     alignment and organism information
>gi|306845298|ref|ZP_07477873.1| oligoendopeptidase, pepF/M3 family [Brucella sp. BO1] Length = 620 Back     alignment and organism information
>gi|254699397|ref|ZP_05161225.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella suis bv. 5 str. 513] Length = 620 Back     alignment and organism information
>gi|319781622|ref|YP_004141098.1| oligoendopeptidase, pepF/M3 family [Mesorhizobium ciceri biovar biserrulae WSM1271] Length = 610 Back     alignment and organism information
>gi|225685947|ref|YP_002733919.1| oligoendopeptidase, pepF/M3 family protein [Brucella melitensis ATCC 23457] Length = 620 Back     alignment and organism information
>gi|254720668|ref|ZP_05182479.1| Neutral zinc metallopeptidase, zinc-binding region [Brucella sp. 83/13] Length = 620 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
TIGR02290587 TIGR02290, M3_fam_3, oligoendopeptidase, pepF/M3 family 1e-145
TIGR00181591 TIGR00181, pepF, oligoendopeptidase F 4e-75
COG1164598 COG1164, COG1164, Oligoendopeptidase F [Amino acid tran 1e-124
cd06459427 cd06459, M3B_Oligoendopeptidase_F, Peptidase family M3B 1e-108
pfam01432448 pfam01432, Peptidase_M3, Peptidase family M3 2e-32
TIGR02289549 TIGR02289, M3_not_pepF, oligoendopeptidase, M3 family 1e-16
cd06258365 cd06258, Peptidase_M3_like, The peptidase M3-like famil 8e-12
COG0339683 COG0339, Dcp, Zn-dependent oligopeptidases [Amino acid 8e-06
pfam0843970 pfam08439, Peptidase_M3_N, Oligopeptidase F 2e-04
cd06457458 cd06457, M3A_MIP, Peptidase M3 mitochondrial intermedia 0.004
>gnl|CDD|162797 TIGR02290, M3_fam_3, oligoendopeptidase, pepF/M3 family Back     alignment and domain information
>gnl|CDD|161749 TIGR00181, pepF, oligoendopeptidase F Back     alignment and domain information
>gnl|CDD|31358 COG1164, COG1164, Oligoendopeptidase F [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|107215 cd06459, M3B_Oligoendopeptidase_F, Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3 Back     alignment and domain information
>gnl|CDD|144870 pfam01432, Peptidase_M3, Peptidase family M3 Back     alignment and domain information
>gnl|CDD|131342 TIGR02289, M3_not_pepF, oligoendopeptidase, M3 family Back     alignment and domain information
>gnl|CDD|107211 cd06258, Peptidase_M3_like, The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases Back     alignment and domain information
>gnl|CDD|30687 COG0339, Dcp, Zn-dependent oligopeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|149486 pfam08439, Peptidase_M3_N, Oligopeptidase F Back     alignment and domain information
>gnl|CDD|107214 cd06457, M3A_MIP, Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3 Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
TIGR02290600 M3_fam_3 oligoendopeptidase, pepF/M3 family; InterPro: 100.0
TIGR00181611 pepF oligoendopeptidase F; InterPro: IPR004438 Metallop 100.0
COG1164598 Oligoendopeptidase F [Amino acid transport and metaboli 100.0
COG0339683 Dcp Zn-dependent oligopeptidases [Amino acid transport 100.0
PRK10280681 dipeptidyl carboxypeptidase II; Provisional 100.0
PRK10911680 oligopeptidase A; Provisional 100.0
TIGR02289553 M3_not_pepF oligoendopeptidase, M3 family; InterPro: IP 100.0
KOG2090704 consensus 100.0
cd06459427 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopept 100.0
pfam01432448 Peptidase_M3 Peptidase family M3. This is the Thimet ol 100.0
cd06455472 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-pep 100.0
cd06457458 M3A_MIP Peptidase M3 mitochondrial intermediate peptida 100.0
cd06461477 M2_ACE Peptidase family M2 Angiotensin converting enzym 99.85
pfam02074494 Peptidase_M32 Carboxypeptidase Taq (M32) metallopeptida 99.82
cd06460396 M32_Taq Peptidase family M32 is a subclass of metalloca 99.75
COG2317497 Zn-dependent carboxypeptidase [Amino acid transport and 99.65
cd06456422 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl 100.0
cd06258365 Peptidase_M3_like The peptidase M3-like family, also ca 100.0
KOG2089718 consensus 100.0
pfam01401595 Peptidase_M2 Angiotensin-converting enzyme. Members of 99.92
KOG3690646 consensus 99.74
pfam0843970 Peptidase_M3_N Oligopeptidase F. This domain is found t 98.23
COG2856213 Predicted Zn peptidase [Amino acid transport and metabo 96.13
KOG2719428 consensus 93.4
cd04272220 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, 92.4
cd04283182 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, ha 91.38
pfam06114121 DUF955 Domain of unknown function (DUF955). Family of b 91.02
pfam05960536 DUF885 Bacterial protein of unknown function (DUF885). 95.9
pfam01400192 Astacin Astacin (Peptidase family M12A). The members of 92.61
cd04280180 ZnMc_astacin_like Zinc-dependent metalloprotease, astac 91.84
smart00235140 ZnMc Zinc-dependent metalloprotease. Neutral zinc metal 91.71
cd04282230 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like 90.56
pfam10460366 Peptidase_M30 Peptidase M30. This family contains the m 92.38
pfam04298222 Zn_peptidase_2 Putative neutral zinc metallopeptidase. 91.75
cd00203167 ZnMc Zinc-dependent metalloprotease. This super-family 92.0
>TIGR02290 M3_fam_3 oligoendopeptidase, pepF/M3 family; InterPro: IPR011977 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>TIGR00181 pepF oligoendopeptidase F; InterPro: IPR004438 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>COG1164 Oligoendopeptidase F [Amino acid transport and metabolism] Back     alignment and domain information
>COG0339 Dcp Zn-dependent oligopeptidases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK10280 dipeptidyl carboxypeptidase II; Provisional Back     alignment and domain information
>PRK10911 oligopeptidase A; Provisional Back     alignment and domain information
>TIGR02289 M3_not_pepF oligoendopeptidase, M3 family; InterPro: IPR011976 Metalloproteases are the most diverse of the four main types of protease, with more than 50 families identified to date Back     alignment and domain information
>KOG2090 consensus Back     alignment and domain information
>cd06459 M3B_Oligoendopeptidase_F Peptidase family M3B Oligopeptidase F (PepF; Pz-peptidase B; EC 3 Back     alignment and domain information
>pfam01432 Peptidase_M3 Peptidase family M3 Back     alignment and domain information
>cd06455 M3A_TOP Peptidase M3 Thimet oligopeptidase (TOP; PZ-peptidase; endo-oligopeptidase A; endopeptidase 24 Back     alignment and domain information
>cd06457 M3A_MIP Peptidase M3 mitochondrial intermediate peptidase (MIP; EC 3 Back     alignment and domain information
>cd06461 M2_ACE Peptidase family M2 Angiotensin converting enzyme (ACE, EC 3 Back     alignment and domain information
>pfam02074 Peptidase_M32 Carboxypeptidase Taq (M32) metallopeptidase Back     alignment and domain information
>cd06460 M32_Taq Peptidase family M32 is a subclass of metallocarboxypeptidases which are distributed mainly in bacteria and archaea, and contain a HEXXH motif that coordinates a divalent cation such as Zn2+ or Co2+, so far only observed in the active site of neutral metallopeptidases but not in carboxypeptidases Back     alignment and domain information
>COG2317 Zn-dependent carboxypeptidase [Amino acid transport and metabolism] Back     alignment and domain information
>cd06456 M3A_DCP_Oligopeptidase_A Peptidase family M3 dipeptidyl carboxypeptidase (DCP; Dcp II; peptidyl dipeptidase; EC 3 Back     alignment and domain information
>cd06258 Peptidase_M3_like The peptidase M3-like family, also called neurolysin-like family, is part of the "zincins" metallopeptidases, and includes M3, M2 and M32 families of metallopeptidases Back     alignment and domain information
>KOG2089 consensus Back     alignment and domain information
>pfam01401 Peptidase_M2 Angiotensin-converting enzyme Back     alignment and domain information
>KOG3690 consensus Back     alignment and domain information
>pfam08439 Peptidase_M3_N Oligopeptidase F Back     alignment and domain information
>COG2856 Predicted Zn peptidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG2719 consensus Back     alignment and domain information
>cd04272 ZnMc_salivary_gland_MPs Zinc-dependent metalloprotease, salivary_gland_MPs Back     alignment and domain information
>cd04283 ZnMc_hatching_enzyme Zinc-dependent metalloprotease, hatching enzyme-like subfamily Back     alignment and domain information
>pfam06114 DUF955 Domain of unknown function (DUF955) Back     alignment and domain information
>pfam05960 DUF885 Bacterial protein of unknown function (DUF885) Back     alignment and domain information
>pfam01400 Astacin Astacin (Peptidase family M12A) Back     alignment and domain information
>cd04280 ZnMc_astacin_like Zinc-dependent metalloprotease, astacin_like subfamily or peptidase family M12A, a group of zinc-dependent proteolytic enzymes with a HExxH zinc-binding site/active site Back     alignment and domain information
>smart00235 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information
>cd04282 ZnMc_meprin Zinc-dependent metalloprotease, meprin_like subfamily Back     alignment and domain information
>pfam10460 Peptidase_M30 Peptidase M30 Back     alignment and domain information
>pfam04298 Zn_peptidase_2 Putative neutral zinc metallopeptidase Back     alignment and domain information
>cd00203 ZnMc Zinc-dependent metalloprotease Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
2qr4_A587 Crystal Structure Of Oligoendopeptidase-F From Ente 1e-110
3ce2_A618 Crystal Structure Of Putative Peptidase From Chlamy 1e-104
3ahm_A564 Pz Peptidase A Length = 564 2e-70
2h1j_A567 3.1 A X-Ray Structure Of Putative Oligoendopeptidas 1e-68
2o36_A674 Crystal Structure Of Engineered Thimet Oligopeptida 9e-39
1s4b_P674 Crystal Structure Of Human Thimet Oligopeptidase Le 1e-38
1y79_1680 Crystal Structure Of The E.Coli Dipeptidyl Carboxyp 2e-38
1i1i_P681 Neurolysin (Endopeptidase 24.16) Crystal Structure 5e-32
2o3e_A678 Crystal Structure Of Engineered Neurolysin With Thi 9e-32
2xyd_A610 Human Angiotenisn Converting Enzyme N-Domain In Com 3e-04
3nxq_A629 Angiotensin Converting Enzyme N Domain Glycsoylatio 5e-04
2c6n_A612 Structure Of Human Somatic Angiontensin-I Convertin 0.001
>gi|157836284|pdb|2QR4|A Chain A, Crystal Structure Of Oligoendopeptidase-F From Enterococcus Faecium Length = 587 Back     alignment and structure
 Score =  403 bits (1036), Expect = e-110,   Method: Composition-based stats.
 Identities = 134/586 (22%), Positives = 255/586 (43%), Gaps = 17/586 (2%)

Query: 47  SHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELIGRIAS 106
           S   QE       +  E      + +G L      +       AI    R+      I  
Sbjct: 2   SLSDQEFDEKYLELSEELKQ-SEKHKGTLD-----QGASQFLNAIEFVLRVYRQTEVIYV 55

Query: 107 YAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLK 166
           YA L  + +  +   +  Y   ++  +   + + +F  EI  L +  + Q + ++P    
Sbjct: 56  YAHLKNDQDTGNTDYQALYARASSLFSKVSEAVSWFEPEILQLSDDQIWQYFKEEPKLEV 115

Query: 167 YSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKIND------QK 220
           Y  +I+ I   + H+LS + E LL+   ++   +   F   N   L F   +       +
Sbjct: 116 YRHYIQQIVDNRAHVLSAEQESLLAGAGEIFDASSDTFAVLNNADLVFPTIEGENGEIVQ 175

Query: 221 IPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIA 280
           +      +    +DR VR++A K L   + +  + F+    T  K    + + R Y    
Sbjct: 176 LSHGVYGQLLESTDRRVREAAFKGLYSVYEQFRNTFASTLGTHIKGHNFKAKVRNYSSAR 235

Query: 281 DSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLPGTSQD 340
           ++   +N++   V + L+    N +    HRY EL+K+ L+++ ++ +D   P+ G +  
Sbjct: 236 EASLSNNHIPESVYDTLVDV-VNKHLPLLHRYXELRKRLLEVEKLHXYDLYTPVLGEAPI 294

Query: 341 IIPFEVARDLVLQSYAKFSPQMSIIAEKFFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYI 400
              +E A++  L++      +   I EK F+  WID  +  GK SGA++ G+    +PYI
Sbjct: 295 TFTYEEAKEKALEALKPXGEEYXAIVEKAFSERWIDVVENKGKRSGAYSSGSYD-TNPYI 353

Query: 401 LLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQ 460
           LLN+      + TL HE GH +H   +   Q  +  + S+ LAE AS   E +  + LL+
Sbjct: 354 LLNWHDTLDQLFTLVHEXGHSVHSYFTRSNQPYVYGDYSIFLAEIASTTNENILTEYLLE 413

Query: 461 AASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQK 520
                  R  +L + ++    ++ RQ  F +FE   HTE      + +  +++ + +   
Sbjct: 414 TEKDPRVRAYVLNHYLDGFKGTVFRQTQFAEFEHFXHTEDEKGVPLTSEYLSDSYGKLNA 473

Query: 521 ESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVDCFKEKY 580
           +  GPA +  D E    W  +PHF   ++YV+ Y+ G    ++L     +   +   E Y
Sbjct: 474 KYYGPAVE-EDPEIKFEWSRIPHFY-YNYYVFQYSTGFSAASALAKKILNQEPEAL-ENY 530

Query: 581 LNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           L  L+AGNS +  E+     ++ +   + E      E+ ++++E++
Sbjct: 531 LAYLKAGNSDYPVEVXKKAGVDXTQAAYIEDAXSXFEQRLNELEEL 576


>gi|170292518|pdb|3CE2|A Chain A, Crystal Structure Of Putative Peptidase From Chlamydophila Abortus Length = 618 Back     alignment and structure
>gi|304445741|pdb|3AHM|A Chain A, Pz Peptidase A Length = 564 Back     alignment and structure
>gi|110590500|pdb|2H1J|A Chain A, 3.1 A X-Ray Structure Of Putative Oligoendopeptidase F: Crystals Grown By Microfluidic Seeding Length = 567 Back     alignment and structure
>gi|126031348|pdb|2O36|A Chain A, Crystal Structure Of Engineered Thimet Oligopeptidase With Neurolysin Specificity In Neurotensin Cleavage Site Length = 674 Back     alignment and structure
>gi|51247327|pdb|1S4B|P Chain P, Crystal Structure Of Human Thimet Oligopeptidase Length = 674 Back     alignment and structure
>gi|67463890|pdb|1Y79|1 Chain 1, Crystal Structure Of The E.Coli Dipeptidyl Carboxypeptidase Dcp In Complex With A Peptidic Inhibitor Length = 680 Back     alignment and structure
>gi|13399624|pdb|1I1I|P Chain P, Neurolysin (Endopeptidase 24.16) Crystal Structure Length = 681 Back     alignment and structure
>gi|126031353|pdb|2O3E|A Chain A, Crystal Structure Of Engineered Neurolysin With Thimet Oligopeptidase Specificity For Neurotensin Cleavage Site Length = 678 Back     alignment and structure
>gi|332639414|pdb|2XYD|A Chain A, Human Angiotenisn Converting Enzyme N-Domain In Complex With Phosphinic Tripeptide Length = 610 Back     alignment and structure
>gi|306440676|pdb|3NXQ|A Chain A, Angiotensin Converting Enzyme N Domain Glycsoylation Mutant (Ndom389) In Complex With Rxp407 Length = 629 Back     alignment and structure
>gi|93278981|pdb|2C6N|A Chain A, Structure Of Human Somatic Angiontensin-I Converting Enzyme N Domain With Lisinopril Length = 612 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
3ce2_A618 Putative peptidase; structural genomics, unknown functi 3e-95
2qr4_A587 Peptidase M3B, oligoendopeptidase F; structural genomic 2e-89
3ahn_A564 Oligopeptidase, PZ peptidase A; hydrolase; HET: 3A1; 1. 9e-81
2h1n_A567 Oligoendopeptidase F; structural genomics, protein stru 6e-64
1j36_A607 ANCE, angiotensin converting enzyme; hydrolase; HET: LP 4e-45
2x96_A598 Angiotensin converting enzyme; hydrolase, ACE inhibitor 1e-44
1uze_A589 Angiotensin converting enzyme; metalloprotease, inhibit 1e-44
1r42_A615 Angiotensin I converting enzyme 2; zinc metallopeptidas 5e-41
3nxq_A629 Angiotensin-converting enzyme; dicarboxy zinc metallope 3e-32
2c6n_A612 Angiotensin-converting enzyme, somatic isoform; hydrola 8e-30
2o3e_A678 Neurolysin; thermolysin-like domain, substrate-binding 4e-04
2o36_A674 ThiMet oligopeptidase; thermolysin-like domain, substra 0.001
3dwc_A505 TCMCP-1, metallocarboxypeptidase; cowrin family of meta 0.002
>3ce2_A Putative peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.60A {Chlamydophila abortus S26} Length = 618 Back     alignment and structure
 Score =  344 bits (883), Expect = 3e-95
 Identities = 138/597 (23%), Positives = 250/597 (41%), Gaps = 16/597 (2%)

Query: 37  PRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYER 96
             W++  LY +  + +   D++    ++    T W    A      N  SL + +     
Sbjct: 22  DCWDITPLYLNRKAWKA--DLDSFGLKTDGSPT-WPALQATQYQLDNSESLLSLLTTLFS 78

Query: 97  ICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQ 156
           I   + ++  YA L+++ ++++         I      F +   +    + +L E+L+ Q
Sbjct: 79  IERKLNKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQ 138

Query: 157 SYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIESLRFKI 216
            +   P    Y  +++ I ++  H  +   E +L+        A K F   +   + F  
Sbjct: 139 -HLSAPCLAPYRFYLEKIFRLSIHTGTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQ 197

Query: 217 ND----QKIPLTKAYKSFF--DSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
                    PL+ A  S +   +DRE+RK++  A    ++   H F+ + N   +     
Sbjct: 198 ATDSEGNSHPLSHALASLYMQSTDRELRKTSYLAQCERYHSYRHTFANLLNGKIQAHVFY 257

Query: 271 DRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDR 330
            + ++Y     +    NN+   V   L+  VK        +Y+ +K++ L L   +F+D 
Sbjct: 258 AKNKRYNSCLQAALYHNNIPTTVYTNLIDIVKKNSS-LITKYFSIKQRCLNLKDFHFYDV 316

Query: 331 LAPLPGTSQDIIPFEVARDLVLQSYAKFSPQM-SIIAEKFFTHNWIDAPQYDGKGSGAFA 389
            APL  + +    F+ A DL+  S +    +    + +   T  W+D  +   K SGA++
Sbjct: 317 YAPLSQSKEKKYTFQEAVDLIYTSLSPLGTEYIDTLKQGLTTQGWVDKYENLNKRSGAYS 376

Query: 390 HGTIPSVHPYILLNYLGKPQDVMTLAHELGHGIHFVLSSETQGILTNNSSLTLAETASIF 449
            G     HPY+LLNY G   DV  +AHE GH +H   S + Q        + LAE AS  
Sbjct: 377 SG-CYDSHPYVLLNYTGTLYDVSVIAHEGGHSMHSYFSRKHQPFHDAQYPIFLAEIASTL 435

Query: 450 GETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFELKLHTERRSTGDIPTH 509
            E L  DS+L+ + SKEE+  +L   ++ + +++ RQ+ F  FE  +H        +   
Sbjct: 436 NEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEYDIHHAAEHGVPLTEE 495

Query: 510 RINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYK 569
            ++  +   Q E  G             W  +PHF   +FYVY YA G        +   
Sbjct: 496 YLSSTYKNLQNEFYGEIITFDV-LSNIEWARIPHFY-YNFYVYQYATGIIAALCFLEKIL 553

Query: 570 SNTVDCFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM 626
           +N  D     YLN L++G S    E+L    +++      ++    +EK I ++  +
Sbjct: 554 NNE-DNALNSYLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSL 609


>2qr4_A Peptidase M3B, oligoendopeptidase F; structural genomics, PSI-2, protein structure initiative; 2.50A {Enterococcus faecium DO} Length = 587 Back     alignment and structure
>3ahn_A Oligopeptidase, PZ peptidase A; hydrolase; HET: 3A1; 1.80A {Geobacillus SP} PDB: 3ahm_A* 2h1n_A 2h1j_A Length = 564 Back     alignment and structure
>2h1n_A Oligoendopeptidase F; structural genomics, protein structure initiative, midwest center for structural genomics, MCSG, PSI; 3.00A {Geobacillus stearothermophilus} PDB: 2h1j_A Length = 567 Back     alignment and structure
>1j36_A ANCE, angiotensin converting enzyme; hydrolase; HET: LPR; 2.40A {Drosophila melanogaster} SCOP: d.92.1.5 PDB: 1j37_A* 1j38_A Length = 607 Back     alignment and structure
>2x96_A Angiotensin converting enzyme; hydrolase, ACE inhibitor, zinc metallopeptidase; HET: RX3 EPE NAG BMA MAN; 1.85A {Drosophila melanogaster} PDB: 2x8z_A* 2x90_A* 2x91_A* 2x8y_A* 2x97_A* 2xhm_A* 2x94_A* 2x92_A* 2x93_A* 2x95_A* 1j36_A* 1j37_A* 1j38_A Length = 598 Back     alignment and structure
>1uze_A Angiotensin converting enzyme; metalloprotease, inhibitor, enalaprilat, zinc dependant peptidase, anti-hypertensive drug; HET: EAL; 1.82A {Homo sapiens} SCOP: d.92.1.5 PDB: 1o8a_A* 1o86_A* 1uzf_A* 2oc2_A* 2iux_A* 2iul_A* 3bkk_A* 3bkl_A* Length = 589 Back     alignment and structure
>1r42_A Angiotensin I converting enzyme 2; zinc metallopeptidase domain, native or open conformation, chloride ION binding site; HET: NAG; 2.20A {Homo sapiens} SCOP: d.92.1.5 PDB: 1r4l_A* 2ajf_A* 3d0g_A* 3d0h_A* 3d0i_A* Length = 615 Back     alignment and structure
>3nxq_A Angiotensin-converting enzyme; dicarboxy zinc metallopeptidase, hydrolase, hydrolase-hydrol inhibitor complex; HET: RX4 NAG FUC BMA P6G PG4; 1.99A {Homo sapiens} PDB: 2c6n_A* 2c6f_A* Length = 629 Back     alignment and structure
>2c6n_A Angiotensin-converting enzyme, somatic isoform; hydrolase, angiotensin-I converting enzyme, N domain, zinc metallopeptidase, metalloprotease; HET: NAG NDG LPR; 3.0A {Homo sapiens} PDB: 2c6f_A* Length = 612 Back     alignment and structure
>2o3e_A Neurolysin; thermolysin-like domain, substrate-binding channel, hydrolase; 2.20A {Rattus norvegicus} PDB: 1i1i_P Length = 678 Back     alignment and structure
>2o36_A ThiMet oligopeptidase; thermolysin-like domain, substrate-binding channel, hydrolase; 1.95A {Homo sapiens} PDB: 1s4b_P Length = 674 Back     alignment and structure
>3dwc_A TCMCP-1, metallocarboxypeptidase; cowrin family of metallocarboxypeptidases, hydrolase; 2.10A {Trypanosoma cruzi} Length = 505 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
3ce2_A618 Putative peptidase; structural genomics, unknown functi 100.0
2qr4_A587 Peptidase M3B, oligoendopeptidase F; structural genomic 100.0
2o3e_A678 Neurolysin; thermolysin-like domain, substrate-binding 100.0
2o36_A674 ThiMet oligopeptidase; thermolysin-like domain, substra 100.0
3ahn_A564 Oligopeptidase, PZ peptidase A; hydrolase; HET: 3A1; 1. 100.0
1y79_1680 Peptidyl-dipeptidase DCP; hinge bending, carboxypeptida 100.0
1uze_A589 Angiotensin converting enzyme; metalloprotease, inhibit 100.0
3nxq_A629 Angiotensin-converting enzyme; dicarboxy zinc metallope 100.0
2x96_A598 Angiotensin converting enzyme; hydrolase, ACE inhibitor 100.0
1r42_A615 Angiotensin I converting enzyme 2; zinc metallopeptidas 100.0
3dwc_A505 TCMCP-1, metallocarboxypeptidase; cowrin family of meta 99.95
1ka2_A499 M32 carboxypeptidase; hexxh motif, M32 family, metallop 99.9
3hq2_A501 Bacillus subtilis M32 carboxypeptidase; hydrolase, meta 99.88
3hoa_A509 Thermostable carboxypeptidase 1; proline-rich loop, hyd 99.79
3iuk_A562 Uncharacterized protein; PF05960.1, DUF885, M32 carboxy 96.85
3o0y_A609 Lipoprotein; structural genomics, PSI2, MCSG, protein s 95.39
1j7n_A776 Lethal factor precursor; anthrax, lethal toxin, zinc me 94.31
3lqb_A199 Hatching enzyme, LOC792177 protein; hydrolase, metallop 93.27
3edh_A201 Bone morphogenetic protein 1; vicinal disulfide, altern 92.79
3lq0_A235 Proastacin; metallopeptidase, zymogen activation, proen 91.86
3g5c_A 510 ADAM 22; alpha/beta fold, cross-linked domain, alternat 91.64
1c7k_A132 NCNP, zinc endoprotease; alpha and beta protein, metall 91.6
1kuf_A203 Atrolysin E, metalloproteinase; alpha/beta protein, hyd 91.31
3k7l_A422 Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2. 90.76
2w15_A202 Zinc metalloproteinase BAP1; hydrolase inhibitor comple 90.09
1atl_A202 Atrolysin C; metalloendopeptidase; HET: MTJ; 1.80A {Cro 93.05
1qua_A197 Acutolysin-C, hemorrhagin III; metalloprotease, hemorrh 92.99
3b8z_A217 Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40 90.08
>3ce2_A Putative peptidase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.60A {Chlamydophila abortus S26} Back     alignment and structure
Probab=100.00  E-value=0  Score=855.25  Aligned_cols=596  Identities=23%  Similarity=0.358  Sum_probs=547.6

Q ss_pred             CHHHCCCCHHHCCCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             01321878443424776793572788892789999999999999999997423310233499899999999999999999
Q gi|254780915|r   22 SDMTTMDSQENLGNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATNQKNCHSLGAAIAEYERICELI  101 (626)
Q Consensus        22 ~~~~~~~~r~~~~~~~~WdL~~ly~~~~~~e~~~dl~~~~~~i~~~~~~~~~~l~~~~~~~~~~~l~~~l~~~e~i~~~l  101 (626)
                      ..++++|+|++||++|+|||++||+|.++|+  .+++.++..+..+. .+++.........++++|.++|..+|++...+
T Consensus         7 ~~~~~~~~r~~i~~~~~WdL~~ly~~~~~~~--~~~~~~~~~~~~~~-~~~~~~~~~~~l~s~~~l~~~l~~~e~i~~~l   83 (618)
T 3ce2_A            7 FNKQQVRPRSEISPQDCWDITPLYLNRKAWK--ADLDSFGLKTDGSP-TWPALQATQYQLDNSESLLSLLTTLFSIERKL   83 (618)
T ss_dssp             ----CCCCGGGSCGGGSCCCTTTCSSHHHHH--HHHHHTCCC---CC-SCSTTCGGGCCTTCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHCCCCCCCCCCCCCCCCCHHHCCCHHHHH--HHHHHHHHHHHHHH-HHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHH
T ss_conf             2225698801299222768466479858999--99999999999899-88998753323699999999999999999999


Q ss_pred             HHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHC
Q ss_conf             99999998642057991899999999999999999988741698871998999999846900111179999999742331
Q gi|254780915|r  102 GRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQSYAQDPLTLKYSAWIKNIRKIKKHL  181 (626)
Q Consensus       102 ~rv~~ya~l~~s~dt~d~~~~~~~~~~~~~~s~~~~~l~~~~~e~~~l~e~~l~~~~~~~~~l~~y~~~~~~l~~~~~~~  181 (626)
                      +++++|++|..++|++|++++++.++++++.+++++.++++++++.+++++.+..++. ++.++.|++++.++++.++|.
T Consensus        84 ~~l~~Ya~l~~s~dt~d~~~~~~~~~~~~l~s~~~~~l~~~~~el~~l~e~~~~~~l~-~~~L~~y~~~l~~~~~~~~~~  162 (618)
T 3ce2_A           84 NKLYVYAHLTHDQDITNQEGIADLKSITHLHTLFAEETSWVQPALTSLSESLIAQHLS-APCLAPYRFYLEKIFRLSIHT  162 (618)
T ss_dssp             HHHHHHHHHHHHHCTTCHHHHHHHHHHHHHHHHHHHHTTTHHHHHHTSCHHHHHHHHH-CSTTGGGHHHHHHHHTTGGGC
T ss_pred             HHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH-CHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999778844488899999999999999999999999999998489999999861-915345489999999888741


Q ss_pred             CCHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHH----HHHCCCCCHH--HHHHHHHCCCHHHHHHHHHHHHHHHHHCCCC
Q ss_conf             716799876630010003677777764444332----2100347523--3213541888767999999999986505421
Q gi|254780915|r  182 LSNDMECLLSDTSQVGREALKRFFCENIESLRF----KINDQKIPLT--KAYKSFFDSDREVRKSAAKALSHTFNKSSHI  255 (626)
Q Consensus       182 l~~~~E~~l~~~~~~~~~~~~~~~~~~~~~~~~----~~~~~~~~~~--~~~~~l~~~dr~~Rk~a~~a~~~~~~~~~~~  255 (626)
                      +++.+|++++..+..++.++..+.....++..+    ...|+..+++  ....++.++||++|+++|+++.+++.+++.+
T Consensus       163 ls~~~E~~l~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~G~~~~L~~~~~~~~~~s~Dr~~R~~a~~a~~~~~~~~~~~  242 (618)
T 3ce2_A          163 GTPGEEKILASAFTPLEVASKAFSSLSDSEIPFGQATDSEGNSHPLSHALASLYMQSTDRELRKTSYLAQCERYHSYRHT  242 (618)
T ss_dssp             CCHHHHHHHHHHTTGGGHHHHHHHHHHHTTSCCCEEECSSCCEEECCHHHHHHHHTCSCHHHHHHHHHHHHHHHHTTHHH
T ss_pred             CCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCEEEECCHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             11235899998524321078999998763555331015688178604766765401889999999999999999855688


Q ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCCCHHHHHHHHHHHHHCCHHHHHHHHHHHHHHCCCCCCCHHHHHHCCC
Q ss_conf             69999998666788654278999889762222589899999999876306289999999999870887531234440256
Q gi|254780915|r  256 FSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYYELKKKWLKLDTMYFWDRLAPLP  335 (626)
Q Consensus       256 ~a~il~~iv~~r~e~A~llGy~s~~~~~l~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~lg~~~l~~wD~~~~~~  335 (626)
                      ++.+++++++.|.+.|+++||+|++++++..+++++.+++.+...+.. ..|..+++...+++.+|++.+++||+++|.+
T Consensus       243 ~a~il~~~v~~r~~~A~~~gy~~~~~~~l~~~~~~~~~~~~l~~~~~~-~~~~~~~~~~~~~~~lg~~~l~~~D~~~~~~  321 (618)
T 3ce2_A          243 FANLLNGKIQAHVFYAKNKRYNSCLQAALYHNNIPTTVYTNLIDIVKK-NSSLITKYFSIKQRCLNLKDFHFYDVYAPLS  321 (618)
T ss_dssp             HHHHHHHHHHHHHHHHHHTTCSSHHHHHHTTTTCCHHHHHHHHHHHHT-THHHHHHHHHHHHHHHTCSSCBGGGTTCCSC
T ss_pred             HHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHCCHHHHHHHHHHHHHH-HHHHHHHHHHHHHHHCCCCCCCCCCCCCCCC
T ss_conf             999999999889999987699988999998732227899999999998-5678999999999870811043341257787


Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHHCCCCCHHCCCCCCCCCCCCCCCCCCCCEEECCCCCCHHHHHHH
Q ss_conf             554777998999999998666632899999998-6424850201037998743547666777510103653324679999
Q gi|254780915|r  336 GTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEK-FFTHNWIDAPQYDGKGSGAFAHGTIPSVHPYILLNYLGKPQDVMTL  414 (626)
Q Consensus       336 ~~~~~~~~~ee~~~~v~~~~~~~~~e~~~~~~~-~~~~~~iD~~~r~gKr~GA~~~~~~~~~~~~I~~N~~~~~~dv~TL  414 (626)
                      ....+.+++++++++|..++.+++++|.+.+.. +.+++|+|+++|+||+|||||++.+ .++|+|+|||+++++||.||
T Consensus       322 ~~~~~~~~~~ea~~~v~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~K~~ga~~~~~~-~~~p~I~~N~~~~~~dv~TL  400 (618)
T 3ce2_A          322 QSKEKKYTFQEAVDLIYTSLSPLGTEYIDTLKQGLTTQGWVDKYENLNKRSGAYSSGCY-DSHPYVLLNYTGTLYDVSVI  400 (618)
T ss_dssp             C--CCCCCHHHHHHHHHHHTGGGHHHHHHHHHHHHHTSCCEECSCCTTCCCSCEEECCT-TSCCEEECCCCSSHHHHHHH
T ss_pred             CCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCCHHHHCCCCCCCCCCCCCCCC-CCCCEEEECCCCCCCCHHHH
T ss_conf             66668899999999998888886699999999765301102201336788886657777-88870220467764208899


Q ss_pred             HHHHHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99845899999612568776578005999886888999999998413899899999999986206999999999999999
Q gi|254780915|r  415 AHELGHGIHFVLSSETQGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLNSIVRQISFYDFEL  494 (626)
Q Consensus       415 ~HE~GHa~H~~ls~~~~~~~~~~~~~~~aE~~S~~~E~~~~~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~q~~~~~fe~  494 (626)
                      |||||||+|++++++++|+.++++|+++||+|||+||+|+++|++++..+++.+..++..++.+...++++|++++.||+
T Consensus       401 ~HE~GHa~H~~l~~~~~~~~~~~~~~~~aE~~S~~~E~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~fe~  480 (618)
T 3ce2_A          401 AHEGGHSMHSYFSRKHQPFHDAQYPIFLAEIASTLNEMLLMDSMLKESDSKEEKITILTRCLDTIFSTLFRQVLFASFEY  480 (618)
T ss_dssp             HHHHHHHHHHHHHHHHSCGGGCSCCGGGTTHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHTHHHHHHHHHHH
T ss_pred             HHHCCHHHHHHHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98517799999984136620367870899997766778899888765389999999999999999999999999999999


Q ss_pred             HHHHHHHCCCCCCHHHHHHHHHHHHHHHCCCCCCCCCCCCCCEEECCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCCCH
Q ss_conf             99721201689998999999999999860776345887888500152541066752589999999999999999956733
Q gi|254780915|r  495 KLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMVPHFIESSFYVYAYAFGNCLVNSLYDIYKSNTVD  574 (626)
Q Consensus       495 ~~h~~~~~~~~~t~~~l~~~~~~~~~~~~g~~~~~~~~~~~~~w~~~~H~y~~~fY~y~Y~~~~~~a~~l~~~~~~~~~~  574 (626)
                      ++|..+.+++++|+++++++|.+++++|+|+.+++++ ..+++|++||||| .|||||+|+||+|+|+++|.+++++| +
T Consensus       481 ~~~~~~~~~~~lt~~~~~~~~~~l~~~~~g~~~~~~~-~~~~~W~~~~Hf~-~~fY~y~Y~~~~l~a~~l~~~~~~~~-~  557 (618)
T 3ce2_A          481 DIHHAAEHGVPLTEEYLSSTYKNLQNEFYGEIITFDV-LSNIEWARIPHFY-YNFYVYQYATGIIAALCFLEKILNNE-D  557 (618)
T ss_dssp             HHHHHHHTTCCCCHHHHHHHHHHHHHHHHTTTCBCCT-TGGGGGGGSCGGG-CSSCTHHHHHHHHHHHHHHHHHHTTC-T
T ss_pred             HHHHHHHHCCCCCHHHHHHHHHHHHHHHCCCCCCCCC-CCCCEEEECCCEE-ECCCCHHHHHHHHHHHHHHHHHHHCC-H
T ss_conf             9998586268999999999999999997199777788-7687231225076-68708699999999999999999788-8


Q ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHCCCCCCCHHHHHHHHHHHHHHHHHHHCC
Q ss_conf             2899999998326999979999970889899889999999999999998609
Q gi|254780915|r  575 CFKEKYLNILRAGNSKHYSELLLPLNINLSDPNFWERGLQTVEKMIDDVEKM  626 (626)
Q Consensus       575 ~~~~~y~~~L~~Ggs~~~~el~k~~G~d~~~~~~~~~~~~~~~~~i~~~e~l  626 (626)
                      .++++|+++|+.|||++|.|++|.+|+|+++++||+.+++.++++|+|+|+|
T Consensus       558 ~~~~~y~~~L~~Ggs~~~~el~~~~G~d~~~~~~~~~~~~~~~~~i~e~~~l  609 (618)
T 3ce2_A          558 NALNSYLNFLKSGGSDFPLEILKKSGLDMGTVEPIQKAFCFIEKKIQELSSL  609 (618)
T ss_dssp             THHHHHHHHHTTTTSSCHHHHHHHTTCCTTSSHHHHHHHHHHHHHHHHHHTT
T ss_pred             HHHHHHHHHHHCCCCCCHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9999999997271899999999984989887699999999999999999998



>2qr4_A Peptidase M3B, oligoendopeptidase F; structural genomics, PSI-2, protein structure initiative; 2.50A {Enterococcus faecium DO} Back     alignment and structure
>2o3e_A Neurolysin; thermolysin-like domain, substrate-binding channel, hydrolase; 2.20A {Rattus norvegicus} PDB: 1i1i_P Back     alignment and structure
>2o36_A ThiMet oligopeptidase; thermolysin-like domain, substrate-binding channel, hydrolase; 1.95A {Homo sapiens} PDB: 1s4b_P Back     alignment and structure
>3ahn_A Oligopeptidase, PZ peptidase A; hydrolase; HET: 3A1; 1.80A {Geobacillus SP} PDB: 3ahm_A* 2h1n_A 2h1j_A Back     alignment and structure
>1y79_1 Peptidyl-dipeptidase DCP; hinge bending, carboxypeptidase, neurolysin, ACE, hydrolase; HET: TRP; 2.00A {Escherichia coli} Back     alignment and structure
>1uze_A Angiotensin converting enzyme; metalloprotease, inhibitor, enalaprilat, zinc dependant peptidase, anti-hypertensive drug; HET: EAL; 1.82A {Homo sapiens} SCOP: d.92.1.5 PDB: 1o8a_A* 1o86_A* 1uzf_A* 2oc2_A* 2iux_A* 2iul_A* 3bkk_A* 3bkl_A* 3l3n_A* Back     alignment and structure
>3nxq_A Angiotensin-converting enzyme; dicarboxy zinc metallopeptidase, hydrolase, hydrolase-hydrol inhibitor complex; HET: RX4 NAG FUC BMA P6G PG4; 1.99A {Homo sapiens} PDB: 2c6n_A* 2c6f_A* Back     alignment and structure
>2x96_A Angiotensin converting enzyme; hydrolase, ACE inhibitor, zinc metallopeptidase; HET: RX3 EPE NAG BMA MAN; 1.85A {Drosophila melanogaster} PDB: 2x8z_A* 2x90_A* 2x91_A* 2x8y_A* 2x97_A* 2xhm_A* 2x94_A* 2x92_A* 2x93_A* 2x95_A* 1j36_A* 1j37_A* 1j38_A Back     alignment and structure
>1r42_A Angiotensin I converting enzyme 2; zinc metallopeptidase domain, native or open conformation, chloride ION binding site; HET: NAG; 2.20A {Homo sapiens} SCOP: d.92.1.5 PDB: 1r4l_A* 2ajf_A* 3kbh_A* 3d0g_A* 3d0h_A* 3d0i_A* Back     alignment and structure
>3dwc_A TCMCP-1, metallocarboxypeptidase; cowrin family of metallocarboxypeptidases, hydrolase; 2.10A {Trypanosoma cruzi} Back     alignment and structure
>1ka2_A M32 carboxypeptidase; hexxh motif, M32 family, metallopeptidase; 2.20A {Pyrococcus furiosus} SCOP: d.92.1.5 PDB: 1k9x_A 1ka4_A Back     alignment and structure
>3hq2_A Bacillus subtilis M32 carboxypeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc; 2.90A {Bacillus subtilis} Back     alignment and structure
>3hoa_A Thermostable carboxypeptidase 1; proline-rich loop, hydrolase; 2.10A {Thermus thermophilus HB27} PDB: 1wgz_A Back     alignment and structure
>3iuk_A Uncharacterized protein; PF05960.1, DUF885, M32 carboxypeptidase-like fold, PSI, MCSG, structural genomics; 1.85A {Arthrobacter aurescens TC1} Back     alignment and structure
>3o0y_A Lipoprotein; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, lipid protein; 1.70A {Colwellia psychrerythraea} Back     alignment and structure
>1j7n_A Lethal factor precursor; anthrax, lethal toxin, zinc metalloprotease, mapkk, MEK; 2.30A {Bacillus anthracis} SCOP: d.92.1.14 d.92.1.14 d.166.1.1 PDB: 1jky_A 1pwp_A* 1pwq_A* 1pwv_A 1zxv_A* 1pwu_A* 1pww_A 1yqy_A* Back     alignment and structure
>3lqb_A Hatching enzyme, LOC792177 protein; hydrolase, metalloprotease, astacin, metal- protease; 1.10A {Danio rerio} Back     alignment and structure
>3edh_A Bone morphogenetic protein 1; vicinal disulfide, alternative splicing, calcium, chondrogenesis, cleavage on PAIR of basic residues, cytokine; 1.25A {Homo sapiens} PDB: 3edg_A 3edi_A Back     alignment and structure
>3lq0_A Proastacin; metallopeptidase, zymogen activation, proenzyme, protease, Z disulfide bond, hydrolase, metal-binding, metalloprotease,; 1.45A {Astacus astacus} PDB: 1iab_A 1iaa_A 1ast_A 1iac_A 1iad_A 1iae_A 1qji_A* 1qjj_A Back     alignment and structure
>3g5c_A ADAM 22; alpha/beta fold, cross-linked domain, alternative splicing, cell adhesion, cleavage on PAIR of basic residues, EGF-like domain; HET: NAG; 2.36A {Homo sapiens} Back     alignment and structure
>1c7k_A NCNP, zinc endoprotease; alpha and beta protein, metalloproteinase, hydrolase; 1.00A {Streptomyces caespitosus} SCOP: d.92.1.1 PDB: 1kuh_A Back     alignment and structure
>1kuf_A Atrolysin E, metalloproteinase; alpha/beta protein, hydrolase; 1.35A {Protobothrops mucrosquamatus} SCOP: d.92.1.9 PDB: 1kui_A 1kuk_A 1kug_A 1wni_A Back     alignment and structure
>3k7l_A Atragin; SVMP, metalloprotease, hydrolase; HET: NAG; 2.50A {Naja atra} Back     alignment and structure
>2w15_A Zinc metalloproteinase BAP1; hydrolase inhibitor complex, metal-binding, zinc-depending, metalloprotease, metalloproteinase/inhibitor complex; HET: WR2; 1.05A {Bothrops asper} PDB: 2w12_A* 2w13_A* 2w14_A* 1nd1_A 3gbo_A Back     alignment and structure
>1atl_A Atrolysin C; metalloendopeptidase; HET: MTJ; 1.80A {Crotalus atrox} SCOP: d.92.1.9 PDB: 1htd_A 1dth_A* 2aig_P* 3aig_A* 4aig_A* 1iag_A Back     alignment and structure
>1qua_A Acutolysin-C, hemorrhagin III; metalloprotease, hemorrhagic toxin, snake venom proteinase; 2.20A {Deinagkistrodon acutus} SCOP: d.92.1.9 Back     alignment and structure
>3b8z_A Protein adamts-5; alpha/beta, hydrolase; HET: 294; 1.40A {Homo sapiens} PDB: 3hyg_A* 3hy9_A* 3hy7_A* 3ljt_A* Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
d1j36a_598 d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Fruit 2e-48
d1uzea_579 d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human 8e-47
d2ajfa1597 d.92.1.5 (A:19-615) Angiotensin converting enzyme 2, AC 5e-42
d1i1ip_665 d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet o 5e-04
d1s4bp_654 d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet o 6e-04
>d1j36a_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 598 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Neurolysin-like
domain: Angiotensin converting enzyme, ACE
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
 Score =  188 bits (477), Expect = 2e-48
 Identities = 67/556 (12%), Positives = 139/556 (25%), Gaps = 66/556 (11%)

Query: 91  IAEYERICELIGRIASYAMLSYNCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLD 150
           +    +       + + A  +Y   ++    +K   +I+A+LA F K +     +     
Sbjct: 7   LENLNKELAKRTNVETEAAWAYRSAITDENEKK-KNEISAELAKFMKEVASDTTKFQWRS 65

Query: 151 EALLEQSYAQDPLTLKYSAWIKNIRKIKKHLLSNDMECLLSDTSQVGREALKRFFCENIE 210
               +       LT    A +      +     + ME   +   +V            ++
Sbjct: 66  YQSEDLKRQFKALTKLGYAALPEDDYAELLDTLSAMESNFA-KVKVCDYKDSTKCDLALD 124

Query: 211 SLRFKINDQKIPLTKAYKSFFDSDREVRKSAAKALSHTFNKSSHIFSFITNTLAKDEEIQ 270
               ++         +     +      +                +  +    AK     
Sbjct: 125 PEIEEVI--------SKSRDHEELAYYWREFYDKAGTAVRSQFERYVELNTKAAKLNNFT 176

Query: 271 DR---WRKYEKIADSRHLSNNVEPYVIEALMQSVKNYYPKTSHRYY--------ELKKKW 319
                W    +         ++   +     Q       +    Y          +    
Sbjct: 177 SGAEAWLDEYEDDTFEQQLEDIFADIRPLYQQIHGYVRFRLRKHYGDAVVSETGPIPMHL 236

Query: 320 LKLDTMYFWDRLAPLPGTSQDIIPFEVARDLVLQSYAKFSPQMSIIAEKFFTH------- 372
           L       W  +A +     +    +V+ ++  Q+Y     +M  + + FFT        
Sbjct: 237 LGNMWAQQWSEIADIVSPFPEKPLVDVSAEMEKQAY--TPLKMFQMGDDFFTSMNLTKLP 294

Query: 373 -----NWIDAPQYDGKGSGAFAHGTI--PSVHPYILLNYLGKPQDVMTLAHELGHGIHFV 425
                  I     DG+     A            I          + T+ HELGH  +F+
Sbjct: 295 QDFWDKSIIEKPTDGRDLVCHASAWDFYLIDDVRIKQCTRVTQDQLFTVHHELGHIQYFL 354

Query: 426 LSSET----QGILTNNSSLTLAETASIFGETLTFDSLLQAASSKEERKILLANKIEDMLN 481
                    +          + +  S+   T      +              N++     
Sbjct: 355 QYQHQPFVYRTGANPGFHEAVGDVLSLSVSTPKHLEKIGLLKDYVRDDEARINQLFLTAL 414

Query: 482 SIVRQISFYDFELKLHTERRSTGDIPTHRINEIWLETQKESLGPAFDLSDLEYGSFWMMV 541
             +  + F     K        G++     N  + + + E  G    +   E        
Sbjct: 415 DKIVFLPFAFTMDKYR-WSLFRGEVDKANWNCAFWKLRDEYSGIEPPVVRSEKDFDAPAK 473

Query: 542 PHFIESSFY-------VYAYAF--GNCLVNSLY------------DIYKSNTVDCFKEKY 580
            H      Y       +  + F    C+    Y            DIY S         +
Sbjct: 474 YHISADVEYLRYLVSFIIQFQFYKSACIKAGQYDPDNVELPLDNCDIYGSARAG---AAF 530

Query: 581 LNILRAGNSKHYSELL 596
            N+L  G SK + + L
Sbjct: 531 HNMLSMGASKPWPDAL 546


>d1uzea_ d.92.1.5 (A:) Angiotensin converting enzyme, ACE {Human (Homo sapiens) [TaxId: 9606]} Length = 579 Back     information, alignment and structure
>d2ajfa1 d.92.1.5 (A:19-615) Angiotensin converting enzyme 2, ACE2 {Human (Homo sapiens) [TaxId: 9606]} Length = 597 Back     information, alignment and structure
>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 665 Back     information, alignment and structure
>d1s4bp_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Human (Homo sapiens) [TaxId: 9606]} Length = 654 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target626 oligoendopeptidase F [Candidatus Liberibacter asiaticus
d1i1ip_665 Neurolysin (endopeptidase 24.16, thimet oligopeptidase) 100.0
d1s4bp_654 Neurolysin (endopeptidase 24.16, thimet oligopeptidase) 100.0
d2ajfa1597 Angiotensin converting enzyme 2, ACE2 {Human (Homo sapi 100.0
d1uzea_579 Angiotensin converting enzyme, ACE {Human (Homo sapiens 100.0
d1j36a_598 Angiotensin converting enzyme, ACE {Fruit fly (Drosophi 100.0
d1k9xa_497 Thermostable carboxypeptidase 1 {Archaeon Pyrococcus fu 99.85
d1uzea_579 Angiotensin converting enzyme, ACE {Human (Homo sapiens 96.66
d1j7na2223 Anthrax toxin lethal factor, N- and C-terminal domains 95.9
d1asta_200 Astacin {European fresh water crayfish (Astacus astacus 93.98
d1atla_200 Snake venom metalloprotease {Western diamonback rattles 92.9
d1quaa_197 Snake venom metalloprotease {Chinese five-pace snake (A 92.05
d1kufa_201 Snake venom metalloprotease {Taiwan habu (Trimeresurus 91.43
d1bswa_197 Snake venom metalloprotease {Five-pace snake (Agkistrod 91.33
d1nd1a_202 Snake venom metalloprotease {Terciopelo (Bothrops asper 90.82
d1r55a_203 ADAM33 {Human (Homo sapiens) [TaxId: 9606]} 90.79
d1hfca_157 Fibroblast collagenase (MMP-1) {Human (Homo sapiens) [T 90.25
d1epwa3533 Botulinum neurotoxin {Clostridium botulinum, serotype B 90.56
>d1i1ip_ d.92.1.5 (P:) Neurolysin (endopeptidase 24.16, thimet oligopeptidase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Zincin-like
superfamily: Metalloproteases ("zincins"), catalytic domain
family: Neurolysin-like
domain: Neurolysin (endopeptidase 24.16, thimet oligopeptidase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=100.00  E-value=0  Score=540.07  Aligned_cols=544  Identities=15%  Similarity=0.124  Sum_probs=382.5

Q ss_pred             CCCCCCCHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCC-CCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             24776793572788892789999999999999999997423310233-49989999999999999999999999998642
Q gi|254780915|r   34 GNLPRWNLEDLYPSHDSQEISNDMECIEHESLAFKTRWEGNLAHATN-QKNCHSLGAAIAEYERICELIGRIASYAMLSY  112 (626)
Q Consensus        34 ~~~~~WdL~~ly~~~~~~e~~~dl~~~~~~i~~~~~~~~~~l~~~~~-~~~~~~l~~~l~~~e~i~~~l~rv~~ya~l~~  112 (626)
                      ...+|||+++=       ++.+..+.       ...+.+..+..|.. ..+.++|+|+|.++++++..++++...+.+..
T Consensus         9 ~~~~~w~~tPe-------~i~~~~~~-------~i~~~~~~id~I~~~~~~~~Tfen~i~~ld~~~~~l~~~~~~~~~l~   74 (665)
T d1i1ip_           9 RNVLRWDLSPE-------QIKTRTEQ-------LIAQTKQVYDTVGTIALKEVTYENCLQVLADIEVTYIVERTMLDFPQ   74 (665)
T ss_dssp             TCCCCSCCCHH-------HHHHHHHH-------HHHHHHHHHHHHTTSCGGGCCTTTTHHHHHHHHHHHHHHHHHHHSHH
T ss_pred             CCCCCCCCCHH-------HHHHHHHH-------HHHHHHHHHHHHHCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             88687768889-------99999999-------99999999999974898999999999999997779999999999987


Q ss_pred             CCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHH---HHCCCCHHHHHHHHHHHHHHHHHCCCHHHHHH
Q ss_conf             057991899999999999999999988741698871998999999---84690011117999999974233171679987
Q gi|254780915|r  113 NCNLSSPTIRKFYTDINAKLADFEKVLIFFALEINTLDEALLEQS---YAQDPLTLKYSAWIKNIRKIKKHLLSNDMECL  189 (626)
Q Consensus       113 s~dt~d~~~~~~~~~~~~~~s~~~~~l~~~~~e~~~l~e~~l~~~---~~~~~~l~~y~~~~~~l~~~~~~~l~~~~E~~  189 (626)
                      +++ +|+++++...++.++++++.+.+........++.. ..+.-   -..++..+-....+.+..+...+.-.+..+++
T Consensus        75 ~v~-~d~~~r~a~~~~~~~l~~~~~~i~~n~~Ly~~l~~-l~~~~~~~~L~~E~~rlle~~l~df~~sG~~L~~~~r~r~  152 (665)
T d1i1ip_          75 HVS-SDREVRAASTEADKKLSRFDIEMSMREDVFQRIVH-LQETCDLEKIKPEARRYLEKSIKMGKRNGLHLSEHIRNEI  152 (665)
T ss_dssp             HHC-SCHHHHHHHHHHHHHHHHHHHHHHTCHHHHHHHHH-HHHHSCTTSSCHHHHHHHHHHHHHHHHTTTTSCHHHHHHH
T ss_pred             HCC-CCHHHHHHHHHHHHHHHHHHHHHHCCHHHHHHHHH-HHCCCCCCCCCHHHHHHHHHHHHHHHHCCCCCCHHHHHHH
T ss_conf             059-99999999999999999999986368999999999-9738664469999999999999999975888996788999


Q ss_pred             HHHHHHH-------------------------CCCHHHHHHHHHHHHHHHHHHCCCCC---HHHHHHHHHCCCHHHHHHH
Q ss_conf             6630010-------------------------00367777776444433221003475---2332135418887679999
Q gi|254780915|r  190 LSDTSQV-------------------------GREALKRFFCENIESLRFKINDQKIP---LTKAYKSFFDSDREVRKSA  241 (626)
Q Consensus       190 l~~~~~~-------------------------~~~~~~~~~~~~~~~~~~~~~~~~~~---~~~~~~~l~~~dr~~Rk~a  241 (626)
                      .......                         .+.+......    ..+....+...+   ....+.+.+++||++|+++
T Consensus       153 ~~l~~els~l~~~F~~nl~~~~~~~~~~~~~L~Glp~~~~~~----~~~~~~~~~~itl~~p~~~~~l~~~~~~~lR~~~  228 (665)
T d1i1ip_         153 KSMKKRMSELCIDFNKNLNEDDTSLVFSKAELGALPDDFIDS----LEKTDEDKYKVTLKYPHYFPVMKKCCVPETRRKM  228 (665)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHCCCEEEECTGGGTTCCHHHHHT----SCBCSSSCEEEESSHHHHHHHHHHCCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHCCCCCCCHHHHCCCCHHHHHH----HHHHCCCCCEEECCCCCCCHHHHHCCCHHHHHHH
T ss_conf             999999998899999975120145205676633798799999----9871688716644666642155426757899999


Q ss_pred             HHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHCCC-CHHHHHHHHHHHHHCCHHHHHHHHHHHH---
Q ss_conf             999999865054216999999866678865427899988976222258-9899999999876306289999999999---
Q gi|254780915|r  242 AKALSHTFNKSSHIFSFITNTLAKDEEIQDRWRKYEKIADSRHLSNNV-EPYVIEALMQSVKNYYPKTSHRYYELKK---  317 (626)
Q Consensus       242 ~~a~~~~~~~~~~~~a~il~~iv~~r~e~A~llGy~s~~~~~l~~~~~-~~~~~~~l~~~~~~~~~~~~~~~~~~~~---  317 (626)
                      |.|+.+++.   ..|..++.+|+++|.+.|+++||+||++++|..+|+ +++.+..++..+.....|.+.+......   
T Consensus       229 ~~a~~~r~~---~~N~~~l~~il~lR~e~A~LLGf~s~A~~~L~~kMA~spe~V~~FL~~L~~~~~p~a~~E~~~L~~~~  305 (665)
T d1i1ip_         229 EMAFHTRCK---QENTAILQQLLPLRAQVAKLLGYNTHADFVLELNTAKSTSRVAAFLDDLSQKLKPLGEAEREFILSLK  305 (665)
T ss_dssp             HHHHTTTTH---HHHHHHHHHHHHHHHHHHHHHTCSSHHHHHHTTSTTCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCC---CHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             998732242---02679999999999989986388979999887650376788999999999971444699999999998


Q ss_pred             -HHC------CCCCCCHHHHHHCCC-----------CCCCCCCCHHHHHHHHHHHHHH-HHHHHHHHH------------
Q ss_conf             -870------887531234440256-----------5547779989999999986666-328999999------------
Q gi|254780915|r  318 -KWL------KLDTMYFWDRLAPLP-----------GTSQDIIPFEVARDLVLQSYAK-FSPQMSIIA------------  366 (626)
Q Consensus       318 -~~l------g~~~l~~wD~~~~~~-----------~~~~~~~~~ee~~~~v~~~~~~-~~~e~~~~~------------  366 (626)
                       +..      +.++|.|||+.++..           .+..++||.+.+.+++...+.. ||..+.+..            
T Consensus       306 ~~~~~~~~~~~~~~l~pWD~~Yy~~k~r~~~~~~d~~~l~~YFpl~~vl~gl~~l~~~Lfgi~~~~~~~~~~wh~dV~~~  385 (665)
T d1i1ip_         306 KKECEERGFEYDGKINAWDLHYYMTQTEELKYSVDQESLKEYFPIEVVTEGLLSIYQELLGLSFEQVPDAHVWNKSVSLY  385 (665)
T ss_dssp             HHHHHTTTCCCCSSCCHHHHHHHHHHHHHHHSCCCHHHHGGGCBHHHHHHHHHHHHHHHHTEEEEECTTCCCSSTTCEEE
T ss_pred             HHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHEEEEECCCCCCCCCCCEEE
T ss_conf             77655337776566673317888888776421233101245563788999999999998500345555677760402699


Q ss_pred             -------HHHHHCCCCCHHCCCCCCCCCCCCCCCCC----------CCCEEECCCCC---------CHHHHHHHHHHHHH
Q ss_conf             -------98642485020103799874354766677----------75101036533---------24679999998458
Q gi|254780915|r  367 -------EKFFTHNWIDAPQYDGKGSGAFAHGTIPS----------VHPYILLNYLG---------KPQDVMTLAHELGH  420 (626)
Q Consensus       367 -------~~~~~~~~iD~~~r~gKr~GA~~~~~~~~----------~~~~I~~N~~~---------~~~dv~TL~HE~GH  420 (626)
                             ...++..|+|+|+|+||++||||++++++          +.+.++|||+.         ++++|+||||||||
T Consensus       386 ~v~d~~~~~~lG~~YlDl~~R~~K~~~a~~~~~~~~~~~~~~~~q~P~~~lv~Nf~~p~~~~p~lls~~ev~TLFHEfGH  465 (665)
T d1i1ip_         386 TVKDKATGEVLGQFYLDLYPREGKYNHAACFGLQPGCLLPDGSRMMSVAALVVNFSQPVAGRPSLLRHDEVRTYFHEFGH  465 (665)
T ss_dssp             EEEETTTCCEEEEEEEECSCCTTSCCSCEEEEEECCCBCTTSCBCCEEEEEECCCCCCCTTSCCBCCHHHHHHHHHHHHH
T ss_pred             EEEECCCCCEEEEEEEECCCCCCCCCCCEEEEECCCCCCCCCCCCCEEEEEEEECCCCCCCCCCCCCHHHHHHHHHHHHH
T ss_conf             99842564404568776266854467786764025732356565531677752036898999774445668646988899


Q ss_pred             HHHHHHHC-CCCCCCCCCCHHHHHHHHHHHHHHHHH----------HHHHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99999612-568776578005999886888999999----------9984138998999999999862069999999999
Q gi|254780915|r  421 GIHFVLSS-ETQGILTNNSSLTLAETASIFGETLTF----------DSLLQAASSKEERKILLANKIEDMLNSIVRQISF  489 (626)
Q Consensus       421 a~H~~ls~-~~~~~~~~~~~~~~aE~~S~~~E~~~~----------~~~~~~~~~~~~~~~ll~~~~~~~~~~~~~q~~~  489 (626)
                      |+|+++++ +++.++|+++++||||+|||+||+|||          ||.+++++|+++..+++..+.++.+..+.+|+.+
T Consensus       466 alH~lls~~~y~~lsGt~v~~DfvE~pSql~E~~~~~~~vL~~~a~h~~tge~lp~~l~~