254780916

254780916

putative sigma-54-dependent transcription regulator protein

GeneID in NCBI database:8209936Locus tag:CLIBASIA_04075
Protein GI in NCBI database:254780916Protein Accession:YP_003065329.1
Gene range:+(895380, 896828)Protein Length:482aa
Gene description:putative sigma-54-dependent transcription regulator protein
COG prediction:[T] Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains
KEGG prediction:atoC; putative sigma-54-dependent transcription regulator protein
SEED prediction:two component, sigma54 specific, transcriptional regulator, Fis family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
ccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccccccccccccccEEEccccEEEEEccccccHHHHHHHHHHHHccEEEEcccccEEEEEEEEEEEEcccHHHHHHcccccHHHHHHccccEEEEccHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHcccccccccccccccccHHHccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHccccccc
cccHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEcccHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccccccccccccccEEEEcccccEEEcccccccHHHHHHHHHHHHcccEEEccccccEEEEEEEEEEccccHHHHHHcccccHHHHEHEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHcccccccc
mprkksldrhkrvliidkddEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNivdkipivpiiVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICAlregvvpsqenehCALDSLIAVSPAMIQVVDLARkagdcaipimiqgefgvgkKRLSRFIhesgkraffpffivncgmidqdkiEKFLfgdvdlqtKNSAQFLGKFIeanggtivleepdalplavQGRIYNfietgkieffdsrgairLDVRLIFLTeknllpqvkshvfrkdLYYRISVFLINISTlrsrsedipWLVHFFLQSFCTKNAIKQISISDKALSlltkypwidNVQELKNILLRAVIGLKDSHLTEDRFVLLLSRegkkerefhtetactcytegkssdtildnlsqesipaigqdgevrrlSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
mprkksldrhkrvliidkddeqiKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPimiqgefgvGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLteknllpqvkshvfrkdlyYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAViglkdshlteDRFVLLLsregkkerefhtetactcytegksSDTILDNLSQESipaigqdgevrrlSDIEKEIIGLAMKLYRAQMSEVarrlgigrstlyrkireynievdsl
MPRKKSLDRHKRVLiidkddeqikiikdHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKipivpiivQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
*************LIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSI***********************AVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCT**********DKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLL*******************************NL***********GEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNI*V***
*********HKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
*PRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVV*******CALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSRE*******************KSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target482 putative sigma-54-dependent transcription regulator pro
315122736494 putative sigma-54-dependent transcription regulator pro 1 1e-157
227823368514 sigma-54 dependent DNA-binding response regulator [Sino 1 9e-77
15966548513 putative sigma-54-dependent transcription regulator pro 1 2e-76
86359139513 sigma-54-dependent transcriptional regulator (activator 1 3e-76
150397881549 two component sigma54 specific Fis family transcription 1 2e-75
209550871514 Fis family transcriptional regulator [Rhizobium legumin 1 4e-75
190893375513 sigma-54-dependent transcriptional regulator (activator 1 1e-74
241206285515 two component, sigma54 specific, transcriptional regula 1 1e-73
116253805494 two-component response regulator [Rhizobium leguminosar 1 2e-71
332716497514 sigma 54 dependent transcriptional activator [Agrobacte 1 5e-71
>gi|315122736|ref|YP_004063225.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 494 Back     alignment and organism information
 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 295/496 (59%), Positives = 376/496 (75%), Gaps = 16/496 (3%)

Query: 1   MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNV----SDLSTISKIQVNVI 56
           M  K+SLD  + +LIID+DDEQ  +IK+++ESYGYDVFI++V     DL  + KI+V+VI
Sbjct: 1   MHIKRSLDDRQGLLIIDQDDEQSNLIKEYMESYGYDVFIIDVLSQCPDLLVLDKIKVDVI 60

Query: 57  FLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQL 116
           FLSLIN  DDK  +L+ IV+K+P +PIIVQT  D +KIL   L +RI K F N VS++ L
Sbjct: 61  FLSLINFGDDKGKVLQTIVEKMPNIPIIVQTKHDELKILISSLQDRIPKCFFNPVSQEHL 120

Query: 117 CDSIICAL-REGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVG 175
             SI   L R+    ++E ++  LDSLIAVS  MIQV++LARKA  C IP+MI+GEFGVG
Sbjct: 121 FYSIRSILERKKNSSAEEQKYFTLDSLIAVSSEMIQVINLARKAVYCTIPVMIEGEFGVG 180

Query: 176 KKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGG 235
           KK L+  IH SG RA FPF +VNCG+ DQDK+EK LFG VDLQ +NS  FLGKF+EANGG
Sbjct: 181 KKTLAHSIHASGSRASFPFVVVNCGISDQDKVEKDLFGKVDLQGENSTYFLGKFVEANGG 240

Query: 236 TIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFR 295
           TI+LEEP AL L VQ +I +FIETGKIEF DSR A++LDVRLIF TEKNL  +VK+ VF 
Sbjct: 241 TILLEEPSALSLKVQRKILHFIETGKIEFDDSRNALKLDVRLIFATEKNLFQEVKNQVFS 300

Query: 296 KDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWI 355
           KDLYY+IS+F   I TLRSR +DIPWL  FFL+ FC +N ++QI++S+KALS+LT Y W 
Sbjct: 301 KDLYYKISIFSCKIPTLRSRQDDIPWLARFFLKRFCLENNVQQINLSEKALSMLTHYKWT 360

Query: 356 DNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACT----CYTE---- 407
           DNVQEL+NI+LR+V+G+KDS++TED F  LL   G +E+E ++ T+ T    C  +    
Sbjct: 361 DNVQELENIILRSVVGIKDSYITEDCFTSLLFEAGNQEKEINSNTSETFDIYCMQDENNN 420

Query: 408 -GKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRS 466
             +SS+ +  ++S+ +I +I + GE+RRLSDIEKE+I LAMKLYR QMSEVARRLGIGRS
Sbjct: 421 IPQSSNYL--SISKGTIFSIDKYGEIRRLSDIEKEMIRLAMKLYREQMSEVARRLGIGRS 478

Query: 467 TLYRKIREYNIEVDSL 482
           TLYRKI+EYNIEVD+L
Sbjct: 479 TLYRKIKEYNIEVDTL 494


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823368|ref|YP_002827340.1| sigma-54 dependent DNA-binding response regulator [Sinorhizobium fredii NGR234] Length = 514 Back     alignment and organism information
>gi|15966548|ref|NP_386901.1| putative sigma-54-dependent transcription regulator protein [Sinorhizobium meliloti 1021] Length = 513 Back     alignment and organism information
>gi|86359139|ref|YP_471031.1| sigma-54-dependent transcriptional regulator (activator) protein [Rhizobium etli CFN 42] Length = 513 Back     alignment and organism information
>gi|150397881|ref|YP_001328348.1| two component sigma54 specific Fis family transcriptional regulator [Sinorhizobium medicae WSM419] Length = 549 Back     alignment and organism information
>gi|209550871|ref|YP_002282788.1| Fis family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 514 Back     alignment and organism information
>gi|190893375|ref|YP_001979917.1| sigma-54-dependent transcriptional regulator (activator) protein [Rhizobium etli CIAT 652] Length = 513 Back     alignment and organism information
>gi|241206285|ref|YP_002977381.1| two component, sigma54 specific, transcriptional regulator, Fis family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 515 Back     alignment and organism information
>gi|116253805|ref|YP_769643.1| two-component response regulator [Rhizobium leguminosarum bv. viciae 3841] Length = 494 Back     alignment and organism information
>gi|332716497|ref|YP_004443963.1| sigma 54 dependent transcriptional activator [Agrobacterium sp. H13-3] Length = 514 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target482 putative sigma-54-dependent transcription regulator pro
COG3829560 COG3829, RocR, Transcriptional regulator containing PAS 9e-56
COG3604550 COG3604, FhlA, Transcriptional regulator containing GAF 7e-53
PRK11388638 PRK11388, PRK11388, DNA-binding transcriptional regulat 2e-45
COG3284606 COG3284, AcoR, Transcriptional activator of acetoin/gly 3e-43
COG3283511 COG3283, TyrR, Transcriptional regulator of aromatic am 2e-42
TIGR01817534 TIGR01817, nifA, Nif-specific regulatory protein 9e-41
TIGR02915445 TIGR02915, PEP_resp_reg, putative PEP-CTERM system resp 2e-40
COG1221403 COG1221, PspF, Transcriptional regulators containing an 2e-39
PRK10820520 PRK10820, PRK10820, DNA-binding transcriptional regulat 3e-39
TIGR02329526 TIGR02329, propionate_PrpR, propionate catabolism opero 4e-34
PRK05022509 PRK05022, PRK05022, anaerobic nitric oxide reductase tr 4e-31
PRK15424538 PRK15424, PRK15424, propionate catabolism operon regula 1e-26
PRK10365441 PRK10365, PRK10365, transcriptional regulatory protein 3e-43
TIGR01818463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 3e-39
PRK11361457 PRK11361, PRK11361, acetoacetate metabolism regulatory 7e-39
COG2204464 COG2204, AtoC, Response regulator containing CheY-like 4e-74
PRK10923469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 2e-38
PRK15429686 PRK15429, PRK15429, formate hydrogenlyase transcription 5e-29
pfam00158168 pfam00158, Sigma54_activat, Sigma-54 interaction domain 6e-31
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 6e-08
PRK15115444 PRK15115, PRK15115, response regulator GlrR; Provisiona 6e-30
TIGR02974329 TIGR02974, phageshock_pspF, psp operon transcriptional 2e-25
PRK11608326 PRK11608, pspF, phage shock protein operon transcriptio 2e-20
COG4650531 COG4650, RtcR, Sigma54-dependent transcription regulato 9e-12
pfam0295442 pfam02954, HTH_8, Bacterial regulatory protein, Fis fam 4e-08
>gnl|CDD|33622 COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33404 COG3604, FhlA, Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183114 PRK11388, PRK11388, DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>gnl|CDD|33094 COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>gnl|CDD|33093 COG3283, TyrR, Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162544 TIGR01817, nifA, Nif-specific regulatory protein Back     alignment and domain information
>gnl|CDD|163070 TIGR02915, PEP_resp_reg, putative PEP-CTERM system response regulator Back     alignment and domain information
>gnl|CDD|31414 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182758 PRK10820, PRK10820, DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>gnl|CDD|162808 TIGR02329, propionate_PrpR, propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>gnl|CDD|179916 PRK05022, PRK05022, anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>gnl|CDD|185322 PRK15424, PRK15424, propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|185327 PRK15429, PRK15429, formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>gnl|CDD|143926 pfam00158, Sigma54_activat, Sigma-54 interaction domain Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|163093 TIGR02974, phageshock_pspF, psp operon transcriptional activator PspF Back     alignment and domain information
>gnl|CDD|183227 PRK11608, pspF, phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>gnl|CDD|34269 COG4650, RtcR, Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|145879 pfam02954, HTH_8, Bacterial regulatory protein, Fis family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 482 putative sigma-54-dependent transcription regulator pro
COG2204464 AtoC Response regulator containing CheY-like receiver, 100.0
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 100.0
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 100.0
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 100.0
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 100.0
PRK10365441 transcriptional regulatory protein ZraR; Provisional 100.0
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 100.0
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 100.0
PRK05022510 anaerobic nitric oxide reductase transcription regulato 100.0
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 100.0
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 100.0
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 100.0
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 100.0
PRK11608325 pspF phage shock protein operon transcriptional activat 100.0
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 100.0
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 100.0
COG1221403 PspF Transcriptional regulators containing an AAA-type 100.0
COG4650531 RtcR Sigma54-dependent transcription regulator containi 100.0
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.98
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 98.7
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 98.61
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 100.0
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 100.0
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.5
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.48
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.43
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.36
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.35
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.2
pfam00493327 MCM MCM2/3/5 family. 99.14
COG0714329 MoxR-like ATPases [General function prediction only] 99.11
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 99.09
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 99.05
smart00350509 MCM minichromosome maintenance proteins. 98.95
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 98.69
PRK09862506 putative ATP-dependent protease; Provisional 98.63
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 98.47
PRK13531 498 regulatory ATPase RavA; Provisional 98.44
pfam00004131 AAA ATPase family associated with various cellular acti 98.42
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.13
KOG0733802 consensus 98.08
PHA02244383 ATPase-like protein 98.02
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.0
KOG0727408 consensus 97.98
smart00382148 AAA ATPases associated with a variety of cellular activ 97.94
PRK08116262 hypothetical protein; Validated 97.8
PRK07952242 DNA replication protein DnaC; Validated 97.59
PRK08181269 transposase; Validated 97.57
PRK06526254 transposase; Provisional 97.55
KOG0736953 consensus 97.52
PRK12377248 putative replication protein; Provisional 97.49
PRK06835330 DNA replication protein DnaC; Validated 97.46
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.43
KOG0739439 consensus 97.38
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.36
PRK09183258 transposase/IS protein; Provisional 97.34
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 97.28
PRK09112352 DNA polymerase III subunit delta'; Validated 97.05
KOG0726440 consensus 96.99
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 96.95
KOG0742630 consensus 96.95
KOG0740428 consensus 96.9
KOG0477854 consensus 96.89
PRK07471363 DNA polymerase III subunit delta'; Validated 96.82
PRK06921265 hypothetical protein; Provisional 96.82
KOG0730 693 consensus 96.81
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.8
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.76
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.7
PRK08939306 primosomal protein DnaI; Reviewed 96.34
KOG0735952 consensus 96.14
KOG0651388 consensus 95.9
PRK07132303 DNA polymerase III subunit delta'; Validated 95.53
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 95.18
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 94.72
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 94.17
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 93.04
PRK06090319 DNA polymerase III subunit delta'; Validated 93.01
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 92.89
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 92.47
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 92.28
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 91.94
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 91.91
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 91.17
KOG0479 818 consensus 91.09
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 91.08
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 90.88
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 90.33
TIGR02154226 PhoB phosphate regulon transcriptional regulatory prote 99.94
PRK00742345 chemotaxis-specific methylesterase; Provisional 99.83
PRK12555340 chemotaxis-specific methylesterase; Provisional 99.79
COG2201350 CheB Chemotaxis response regulator containing a CheY-li 99.52
COG3706435 PleD Response regulator containing a CheY-like receiver 98.59
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 91.86
PRK10693337 response regulator of RpoS; Provisional 99.92
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.91
PRK09468239 ompR osmolarity response regulator; Provisional 99.91
PRK11083229 DNA-binding response regulator CreB; Provisional 99.9
PRK09581457 pleD response regulator PleD; Reviewed 99.9
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 99.89
PRK10161229 transcriptional regulator PhoB; Provisional 99.89
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.89
CHL00148240 orf27 Ycf27; Reviewed 99.89
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 99.88
pfam00072111 Response_reg Response regulator receiver domain. This d 99.88
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.88
PRK11517223 transcriptional regulatory protein YedW; Provisional 99.88
PRK10529225 DNA-binding transcriptional activator KdpE; Provisional 99.88
PRK09390202 fixJ response regulator FixJ; Provisional 99.87
PRK10701240 DNA-binding transcriptional regulator RstA; Provisional 99.87
PRK11173237 two-component response regulator; Provisional 99.87
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 99.87
cd00156113 REC Signal receiver domain; originally thought to be un 99.86
PRK10955232 DNA-binding transcriptional regulator CpxR; Provisional 99.86
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 99.86
PRK10766224 DNA-binding transcriptional regulator TorR; Provisional 99.86
PRK13557538 histidine kinase; Provisional 99.86
PRK10816223 DNA-binding transcriptional regulator PhoP; Provisional 99.86
COG0745229 OmpR Response regulators consisting of a CheY-like rece 99.86
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.85
TIGR01387219 cztR_silR_copR heavy metal response regulator; InterPro 99.85
PRK13856241 two-component response regulator VirG; Provisional 99.85
COG4753475 Response regulator containing CheY-like receiver domain 99.85
PRK10841947 hybrid sensory kinase in two-component regulatory syste 99.85
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 99.84
PRK099591197 hybrid sensory histidine kinase in two-component regula 99.84
PRK13435141 response regulator; Provisional 99.82
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 99.82
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.8
COG3437360 Response regulator containing a CheY-like receiver doma 99.77
COG4565224 CitB Response regulator of citrate/malate metabolism [T 99.76
TIGR02875270 spore_0_A sporulation transcription factor Spo0A; Inter 99.74
PRK10403215 transcriptional regulator NarP; Provisional 99.73
PRK10651216 transcriptional regulator NarL; Provisional 99.72
PRK13837831 two-component VirA-like sensor kinase; Provisional 99.72
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.71
COG3706435 PleD Response regulator containing a CheY-like receiver 99.71
PRK09483216 response regulator; Provisional 99.7
PRK09935210 transcriptional regulator FimZ; Provisional 99.68
COG3947361 Response regulator containing CheY-like receiver and SA 99.67
COG2197211 CitB Response regulator containing a CheY-like receiver 99.65
KOG0519786 consensus 99.64
COG4567182 Response regulator consisting of a CheY-like receiver d 99.63
PRK10840216 transcriptional regulator RcsB; Provisional 99.62
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.57
PRK11697239 putative two-component response-regulatory protein YehT 99.56
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.55
TIGR029561052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 99.55
PRK09191261 two-component response regulator; Provisional 99.55
PRK13558 674 bacterio-opsin activator; Provisional 99.48
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.37
COG3707194 AmiR Response regulator with putative antiterminator ou 99.15
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.0
COG3279244 LytT Response regulator of the LytR/AlgR family [Transc 98.99
PRK09581457 pleD response regulator PleD; Reviewed 98.52
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.48
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 98.39
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 96.51
COG1204 766 Superfamily II helicase [General function prediction on 93.94
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 93.41
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 91.68
cd02067119 B12-binding B12 binding domain (B12-BD). This domain bi 90.93
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.81
PRK13342417 recombination factor protein RarA; Reviewed 99.34
PRK10865857 protein disaggregation chaperone; Provisional 99.27
CHL00095823 clpC Clp protease ATP binding subunit 99.26
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.25
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.25
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.23
PRK00440318 rfc replication factor C small subunit; Reviewed 99.16
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.13
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.12
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.02
PRK12402337 replication factor C small subunit 2; Reviewed 98.98
PRK08903227 hypothetical protein; Validated 98.85
PRK04195403 replication factor C large subunit; Provisional 98.84
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.84
PRK03992390 proteasome-activating nucleotidase; Provisional 98.82
CHL00176 631 ftsH cell division protein; Validated 98.82
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 98.78
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.77
PRK05642234 DNA replication initiation factor; Validated 98.68
PRK08084235 DNA replication initiation factor; Provisional 98.67
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.66
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.63
PRK08727233 hypothetical protein; Validated 98.62
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.61
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 98.59
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 98.59
KOG1051898 consensus 98.56
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.55
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 98.52
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.47
PRK06893229 DNA replication initiation factor; Validated 98.44
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.43
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.42
KOG0731 774 consensus 98.42
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 98.41
PRK12422455 chromosomal replication initiation protein; Provisional 98.4
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.35
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 98.33
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.33
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 98.31
KOG0733 802 consensus 98.31
KOG2028554 consensus 98.3
CHL00095 823 clpC Clp protease ATP binding subunit 98.29
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 98.28
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.28
PRK10865 857 protein disaggregation chaperone; Provisional 98.27
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.25
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 98.25
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 98.24
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.23
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 98.21
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 98.2
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.2
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.18
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.11
KOG0734 752 consensus 98.11
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.07
PRK09087226 hypothetical protein; Validated 98.03
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 98.01
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.96
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 97.88
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 97.88
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.85
KOG0989346 consensus 97.8
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 97.68
KOG0729435 consensus 97.36
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 97.16
PTZ00112650 origin recognition complex 1 protein; Provisional 96.74
KOG0652424 consensus 96.6
pfam05621302 TniB Bacterial TniB protein. This family consists of se 96.55
KOG0991333 consensus 94.01
KOG0741744 consensus 92.5
KOG2170344 consensus 90.25
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.77
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 97.74
TIGR02030340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 97.71
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 97.21
PRK13765 637 ATP-dependent protease Lon; Provisional 99.5
CHL00195491 ycf46 Ycf46; Provisional 99.07
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.91
CHL00181287 cbbX CbbX; Provisional 98.82
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.8
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.78
COG1067 647 LonB Predicted ATP-dependent protease [Posttranslationa 98.74
KOG0730693 consensus 98.68
KOG0480764 consensus 98.61
COG1241682 MCM2 Predicted ATPase involved in replication control, 98.51
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.24
KOG2004 906 consensus 98.23
TIGR02031 705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 98.2
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.11
PRK06620214 hypothetical protein; Validated 97.87
KOG0737386 consensus 97.78
KOG0738491 consensus 97.73
KOG1969 877 consensus 97.55
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 97.44
KOG0728404 consensus 96.95
PRK05629331 hypothetical protein; Validated 96.02
KOG0481729 consensus 94.62
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 94.16
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 92.6
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.36
TIGR02418553 acolac_catab acetolactate synthase, catabolic; InterPro 93.89
PRK0190577 DNA-binding protein Fis; Provisional 99.15
PRK0043098 fis DNA-binding protein Fis; Provisional 99.14
pfam0295442 HTH_8 Bacterial regulatory protein, Fis family. 99.0
COG290198 Fis Factor for inversion stimulation Fis, transcription 98.8
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.64
COG4567182 Response regulator consisting of a CheY-like receiver d 98.07
COG2508421 Regulator of polyketide synthase expression [Signal tra 96.52
PRK11477385 carbohydrate diacid transcriptional activator CdaR; Pro 94.94
PRK05657328 RNA polymerase sigma factor RpoS; Validated 92.99
PRK13413200 mpi multiple promoter invertase; Provisional 92.59
COG134299 Predicted DNA-binding proteins [General function predic 91.9
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and related 91.88
pfam02001100 DUF134 Protein of unknown function DUF134. This family 91.67
COG3835376 CdaR Sugar diacid utilization regulator [Transcription 91.66
pfam09862113 DUF2089 Protein of unknown function(DUF2089). This doma 91.35
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 90.54
COG165479 BirA Biotin operon repressor [Transcription] 90.28
PRK04841903 transcriptional regulator MalT; Provisional 90.25
pfam0632264 Phage_NinH Phage NinH protein. This family consists of 90.16
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.62
PRK05574336 holA DNA polymerase III subunit delta; Reviewed 96.6
PRK07914320 hypothetical protein; Reviewed 96.15
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.54
KOG0478804 consensus 98.27
KOG0745564 consensus 98.24
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 98.07
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 97.76
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 97.46
PRK05564313 DNA polymerase III subunit delta'; Validated 97.19
KOG0744423 consensus 97.03
PRK07940395 DNA polymerase III subunit delta'; Validated 96.5
PRK04132 863 replication factor C small subunit; Provisional 96.42
KOG0482721 consensus 96.19
PRK07399314 DNA polymerase III subunit delta'; Validated 96.01
PRK08058329 DNA polymerase III subunit delta'; Validated 95.94
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.76
KOG1808 1856 consensus 95.74
PRK05707328 DNA polymerase III subunit delta'; Validated 94.81
PRK05917290 DNA polymerase III subunit delta'; Validated 94.65
COG5022 1463 Myosin heavy chain [Cytoskeleton] 94.37
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.22
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 94.21
PRK08769319 DNA polymerase III subunit delta'; Validated 94.08
KOG1051 898 consensus 93.97
KOG0735 952 consensus 93.93
PRK06871324 DNA polymerase III subunit delta'; Validated 93.85
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 93.71
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 93.48
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 92.9
KOG2543438 consensus 90.97
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 98.52
PRK05637208 anthranilate synthase component II; Provisional 93.43
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.45
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.26
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 95.95
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 95.81
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 94.83
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 94.4
KOG2680454 consensus 91.97
KOG1942456 consensus 91.23
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 98.21
KOG0732 1080 consensus 97.46
TIGR02688470 TIGR02688 conserved hypothetical protein TIGR02688; Int 96.34
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 93.21
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 97.06
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.76
KOG0741 744 consensus 96.54
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.07
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.06
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 95.79
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 95.75
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.07
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. Myosin 94.93
TIGR00634 605 recN DNA repair protein RecN; InterPro: IPR004604 DNA r 94.35
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 94.29
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 94.27
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 94.26
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 94.23
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 93.94
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. Myos 93.93
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 93.86
COG3910233 Predicted ATPase [General function prediction only] 93.69
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII myosins 93.67
PRK07261171 topology modulation protein; Provisional 93.25
PTZ00014 821 myosin A; Provisional 93.1
PRK13833323 conjugal transfer protein TrbB; Provisional 92.95
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular motor. Mu 92.93
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. Myosin 92.86
PRK08118167 topology modulation protein; Reviewed 92.81
PRK13900332 type IV secretion system ATPase VirB11; Provisional 92.79
KOG1970 634 consensus 92.6
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. Myos 92.57
cd01124187 KaiC KaiC is a circadian clock protein primarily found 92.45
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 92.35
PRK09302501 circadian clock protein KaiC; Reviewed 92.21
PRK13851343 type IV secretion system protein VirB11; Provisional 92.18
PRK13894320 conjugal transfer ATPase TrbB; Provisional 92.07
pfam06745231 KaiC KaiC. This family represents a conserved region wi 91.61
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 91.55
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 91.26
PRK13768253 GTPase; Provisional 91.25
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 91.21
PRK03839180 putative kinase; Provisional 91.04
cd01379 653 MYSc_type_III Myosin motor domain, type III myosins. My 91.01
COG4178604 ABC-type uncharacterized transport system, permease and 91.0
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 90.82
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 90.79
KOG0924 1042 consensus 90.75
COG1123539 ATPase components of various ABC-type transport systems 90.74
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 90.67
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 90.45
pfam00063 679 Myosin_head Myosin head (motor domain). 90.36
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 90.35
PRK10869 553 recombination and repair protein; Provisional 90.3
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 90.28
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 90.25
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 90.05
PRK13566724 anthranilate synthase; Provisional 96.49
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 95.57
PRK01172 674 ski2-like helicase; Provisional 94.91
PRK02362 736 ski2-like helicase; Provisional 92.78
COG4172534 ABC-type uncharacterized transport system, duplicated A 92.74
PRK00254 717 ski2-like helicase; Provisional 91.22
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 96.1
PRK13409590 putative ATPase RIL; Provisional 94.98
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 94.22
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 92.88
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 95.36
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 94.74
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific type X 94.55
PRK06762166 hypothetical protein; Provisional 93.6
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 93.52
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.7
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. In v 91.63
PRK04328250 hypothetical protein; Provisional 90.89
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 90.76
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 90.45
COG1493308 HprK Serine kinase of the HPr protein, regulates carboh 94.6
PRK05428308 HPr kinase/phosphorylase; Provisional 92.76
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 92.32
KOG2035351 consensus 91.83
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 91.02
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT) Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein; InterPro: IPR010113 This entry represents NifA, a DNA-binding regulatory protein for nitrogen fixation Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF; InterPro: IPR014317 Members of this protein are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, found in Escherichia coli and numerous other species Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR; InterPro: IPR012704 At least five distinct pathways exist for the catabolism of propionate by way of propionyl-CoA Back     alignment and domain information
>pfam00158 Sigma54_activat Sigma-54 interaction domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily) Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>pfam07728 AAA_5 AAA domain (dynein-related subfamily) Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>pfam00493 MCM MCM2/3/5 family Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462 The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>pfam00004 AAA ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0727 consensus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0736 consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>KOG0739 consensus Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>pfam05673 DUF815 Protein of unknown function (DUF815) Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0726 consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus Back     alignment and domain information
>KOG0740 consensus Back     alignment and domain information
>KOG0477 consensus Back     alignment and domain information