254780916

254780916

putative sigma-54-dependent transcription regulator protein

GeneID in NCBI database:8209936Locus tag:CLIBASIA_04075
Protein GI in NCBI database:254780916Protein Accession:YP_003065329.1
Gene range:+(895380, 896828)Protein Length:482aa
Gene description:putative sigma-54-dependent transcription regulator protein
COG prediction:[T] Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains
KEGG prediction:atoC; putative sigma-54-dependent transcription regulator protein
SEED prediction:two component, sigma54 specific, transcriptional regulator, Fis family
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480--
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
ccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEcHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHHcccccEEEEEcccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccHHHHHHHHHHHHccccccEEEEEcccccHHHHHHHHHccccccccccccccccEEEccccEEEEEccccccHHHHHHHHHHHHccEEEEcccccEEEEEEEEEEEEcccHHHHHHcccccHHHHHHccccEEEEccHHHcHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccHHHcccccccccccccccccHHHccccccccccccHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHccccHHHHHHHHcccHHHHHHHHHHHccccccc
cccHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEcccHHHHHHHHccccEEEEccccccccHHHHHHHHHHHcccccEEEEEccccHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHccccccccEEEEEcccccHHHHHHHHccccccccccccccccEEEEcccccEEEcccccccHHHHHHHHHHHHcccEEEccccccEEEEEEEEEEccccHHHHHHcccccHHHHEHEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHccccccHHHHHHHHHHHHHHcccccccHHHccHHHHcccccccccccccccccccccccHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHcccHHHHHHHHHHcccccccc
mprkksldrhkrvliidkddEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNivdkipivpiiVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICAlregvvpsqenehCALDSLIAVSPAMIQVVDLARkagdcaipimiqgefgvgkKRLSRFIhesgkraffpffivncgmidqdkiEKFLfgdvdlqtKNSAQFLGKFIeanggtivleepdalplavQGRIYNfietgkieffdsrgairLDVRLIFLTeknllpqvkshvfrkdLYYRISVFLINISTlrsrsedipWLVHFFLQSFCTKNAIKQISISDKALSlltkypwidNVQELKNILLRAVIGLKDSHLTEDRFVLLLSRegkkerefhtetactcytegkssdtildnlsqesipaigqdgevrrlSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
mprkksldrhkrvliidkddeqiKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPimiqgefgvGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLteknllpqvkshvfrkdlyYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAViglkdshlteDRFVLLLsregkkerefhtetactcytegksSDTILDNLSQESipaigqdgevrrlSDIEKEIIGLAMKLYRAQMSEVarrlgigrstlyrkireynievdsl
MPRKKSLDRHKRVLiidkddeqikiikdHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKipivpiivQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
*************LIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSI***********************AVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCT**********DKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLL*******************************NL***********GEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNI*V***
*********HKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
*PRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVV*******CALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSRE*******************KSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVD**
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL
MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNVSDLSTISKIQVNVIFLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQLCDSIICALREGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVGKKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGGTIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFRKDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWIDNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACTCYTEGKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRSTLYRKIREYNIEVDSL

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

Original result of BLAST against C. L. asiaticus genome

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

Original result of PSI-BLAST first 2 iterations

IdentityAlignment graphLength Definition Round E-value
Target482 putative sigma-54-dependent transcription regulator pro
315122736494 putative sigma-54-dependent transcription regulator pro 1 1e-157
227823368514 sigma-54 dependent DNA-binding response regulator [Sino 1 9e-77
15966548513 putative sigma-54-dependent transcription regulator pro 1 2e-76
86359139513 sigma-54-dependent transcriptional regulator (activator 1 3e-76
150397881549 two component sigma54 specific Fis family transcription 1 2e-75
209550871514 Fis family transcriptional regulator [Rhizobium legumin 1 4e-75
190893375513 sigma-54-dependent transcriptional regulator (activator 1 1e-74
241206285515 two component, sigma54 specific, transcriptional regula 1 1e-73
116253805494 two-component response regulator [Rhizobium leguminosar 1 2e-71
332716497514 sigma 54 dependent transcriptional activator [Agrobacte 1 5e-71
>gi|315122736|ref|YP_004063225.1| putative sigma-54-dependent transcription regulator protein [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 494 Back     alignment and organism information
 Score =  558 bits (1438), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 295/496 (59%), Positives = 376/496 (75%), Gaps = 16/496 (3%)

Query: 1   MPRKKSLDRHKRVLIIDKDDEQIKIIKDHVESYGYDVFIVNV----SDLSTISKIQVNVI 56
           M  K+SLD  + +LIID+DDEQ  +IK+++ESYGYDVFI++V     DL  + KI+V+VI
Sbjct: 1   MHIKRSLDDRQGLLIIDQDDEQSNLIKEYMESYGYDVFIIDVLSQCPDLLVLDKIKVDVI 60

Query: 57  FLSLINCEDDKENILKNIVDKIPIVPIIVQTTQDNIKILNCFLYNRISKFFLNLVSRKQL 116
           FLSLIN  DDK  +L+ IV+K+P +PIIVQT  D +KIL   L +RI K F N VS++ L
Sbjct: 61  FLSLINFGDDKGKVLQTIVEKMPNIPIIVQTKHDELKILISSLQDRIPKCFFNPVSQEHL 120

Query: 117 CDSIICAL-REGVVPSQENEHCALDSLIAVSPAMIQVVDLARKAGDCAIPIMIQGEFGVG 175
             SI   L R+    ++E ++  LDSLIAVS  MIQV++LARKA  C IP+MI+GEFGVG
Sbjct: 121 FYSIRSILERKKNSSAEEQKYFTLDSLIAVSSEMIQVINLARKAVYCTIPVMIEGEFGVG 180

Query: 176 KKRLSRFIHESGKRAFFPFFIVNCGMIDQDKIEKFLFGDVDLQTKNSAQFLGKFIEANGG 235
           KK L+  IH SG RA FPF +VNCG+ DQDK+EK LFG VDLQ +NS  FLGKF+EANGG
Sbjct: 181 KKTLAHSIHASGSRASFPFVVVNCGISDQDKVEKDLFGKVDLQGENSTYFLGKFVEANGG 240

Query: 236 TIVLEEPDALPLAVQGRIYNFIETGKIEFFDSRGAIRLDVRLIFLTEKNLLPQVKSHVFR 295
           TI+LEEP AL L VQ +I +FIETGKIEF DSR A++LDVRLIF TEKNL  +VK+ VF 
Sbjct: 241 TILLEEPSALSLKVQRKILHFIETGKIEFDDSRNALKLDVRLIFATEKNLFQEVKNQVFS 300

Query: 296 KDLYYRISVFLINISTLRSRSEDIPWLVHFFLQSFCTKNAIKQISISDKALSLLTKYPWI 355
           KDLYY+IS+F   I TLRSR +DIPWL  FFL+ FC +N ++QI++S+KALS+LT Y W 
Sbjct: 301 KDLYYKISIFSCKIPTLRSRQDDIPWLARFFLKRFCLENNVQQINLSEKALSMLTHYKWT 360

Query: 356 DNVQELKNILLRAVIGLKDSHLTEDRFVLLLSREGKKEREFHTETACT----CYTE---- 407
           DNVQEL+NI+LR+V+G+KDS++TED F  LL   G +E+E ++ T+ T    C  +    
Sbjct: 361 DNVQELENIILRSVVGIKDSYITEDCFTSLLFEAGNQEKEINSNTSETFDIYCMQDENNN 420

Query: 408 -GKSSDTILDNLSQESIPAIGQDGEVRRLSDIEKEIIGLAMKLYRAQMSEVARRLGIGRS 466
             +SS+ +  ++S+ +I +I + GE+RRLSDIEKE+I LAMKLYR QMSEVARRLGIGRS
Sbjct: 421 IPQSSNYL--SISKGTIFSIDKYGEIRRLSDIEKEMIRLAMKLYREQMSEVARRLGIGRS 478

Query: 467 TLYRKIREYNIEVDSL 482
           TLYRKI+EYNIEVD+L
Sbjct: 479 TLYRKIKEYNIEVDTL 494



Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|227823368|ref|YP_002827340.1| sigma-54 dependent DNA-binding response regulator [Sinorhizobium fredii NGR234] Length = 514 Back     alignment and organism information
>gi|15966548|ref|NP_386901.1| putative sigma-54-dependent transcription regulator protein [Sinorhizobium meliloti 1021] Length = 513 Back     alignment and organism information
>gi|86359139|ref|YP_471031.1| sigma-54-dependent transcriptional regulator (activator) protein [Rhizobium etli CFN 42] Length = 513 Back     alignment and organism information
>gi|150397881|ref|YP_001328348.1| two component sigma54 specific Fis family transcriptional regulator [Sinorhizobium medicae WSM419] Length = 549 Back     alignment and organism information
>gi|209550871|ref|YP_002282788.1| Fis family transcriptional regulator [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 514 Back     alignment and organism information
>gi|190893375|ref|YP_001979917.1| sigma-54-dependent transcriptional regulator (activator) protein [Rhizobium etli CIAT 652] Length = 513 Back     alignment and organism information
>gi|241206285|ref|YP_002977381.1| two component, sigma54 specific, transcriptional regulator, Fis family [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 515 Back     alignment and organism information
>gi|116253805|ref|YP_769643.1| two-component response regulator [Rhizobium leguminosarum bv. viciae 3841] Length = 494 Back     alignment and organism information
>gi|332716497|ref|YP_004443963.1| sigma 54 dependent transcriptional activator [Agrobacterium sp. H13-3] Length = 514 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database part I

Original result of RPS-BLASTagainst CDD database part II

IdentityAlignment graphLength Definition E-value
Target482 putative sigma-54-dependent transcription regulator pro
COG3829560 COG3829, RocR, Transcriptional regulator containing PAS 9e-56
COG3604550 COG3604, FhlA, Transcriptional regulator containing GAF 7e-53
PRK11388638 PRK11388, PRK11388, DNA-binding transcriptional regulat 2e-45
COG3284606 COG3284, AcoR, Transcriptional activator of acetoin/gly 3e-43
COG3283511 COG3283, TyrR, Transcriptional regulator of aromatic am 2e-42
TIGR01817534 TIGR01817, nifA, Nif-specific regulatory protein 9e-41
TIGR02915445 TIGR02915, PEP_resp_reg, putative PEP-CTERM system resp 2e-40
COG1221403 COG1221, PspF, Transcriptional regulators containing an 2e-39
PRK10820520 PRK10820, PRK10820, DNA-binding transcriptional regulat 3e-39
TIGR02329526 TIGR02329, propionate_PrpR, propionate catabolism opero 4e-34
PRK05022509 PRK05022, PRK05022, anaerobic nitric oxide reductase tr 4e-31
PRK15424538 PRK15424, PRK15424, propionate catabolism operon regula 1e-26
PRK10365441 PRK10365, PRK10365, transcriptional regulatory protein 3e-43
TIGR01818463 TIGR01818, ntrC, nitrogen regulation protein NR(I) 3e-39
PRK11361457 PRK11361, PRK11361, acetoacetate metabolism regulatory 7e-39
COG2204464 COG2204, AtoC, Response regulator containing CheY-like 4e-74
PRK10923469 PRK10923, glnG, nitrogen regulation protein NR(I); Prov 2e-38
PRK15429686 PRK15429, PRK15429, formate hydrogenlyase transcription 5e-29
pfam00158168 pfam00158, Sigma54_activat, Sigma-54 interaction domain 6e-31
cd00009151 cd00009, AAA, The AAA+ (ATPases Associated with a wide 6e-08
PRK15115444 PRK15115, PRK15115, response regulator GlrR; Provisiona 6e-30
TIGR02974329 TIGR02974, phageshock_pspF, psp operon transcriptional 2e-25
PRK11608326 PRK11608, pspF, phage shock protein operon transcriptio 2e-20
COG4650531 COG4650, RtcR, Sigma54-dependent transcription regulato 9e-12
pfam0295442 pfam02954, HTH_8, Bacterial regulatory protein, Fis fam 4e-08
>gnl|CDD|33622 COG3829, RocR, Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|33404 COG3604, FhlA, Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|183114 PRK11388, PRK11388, DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>gnl|CDD|33094 COG3284, AcoR, Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>gnl|CDD|33093 COG3283, TyrR, Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162544 TIGR01817, nifA, Nif-specific regulatory protein Back     alignment and domain information
>gnl|CDD|163070 TIGR02915, PEP_resp_reg, putative PEP-CTERM system response regulator Back     alignment and domain information
>gnl|CDD|31414 COG1221, PspF, Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182758 PRK10820, PRK10820, DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>gnl|CDD|162808 TIGR02329, propionate_PrpR, propionate catabolism operon regulatory protein PrpR Back     alignment and domain information
>gnl|CDD|179916 PRK05022, PRK05022, anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>gnl|CDD|185322 PRK15424, PRK15424, propionate catabolism operon regulatory protein PrpR; Provisional Back     alignment and domain information
>gnl|CDD|182412 PRK10365, PRK10365, transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>gnl|CDD|162545 TIGR01818, ntrC, nitrogen regulation protein NR(I) Back     alignment and domain information
>gnl|CDD|183099 PRK11361, PRK11361, acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>gnl|CDD|32386 COG2204, AtoC, Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|182842 PRK10923, glnG, nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>gnl|CDD|185327 PRK15429, PRK15429, formate hydrogenlyase transcriptional activator FhlA; Provisional Back     alignment and domain information
>gnl|CDD|143926 pfam00158, Sigma54_activat, Sigma-54 interaction domain Back     alignment and domain information
>gnl|CDD|99707 cd00009, AAA, The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>gnl|CDD|185070 PRK15115, PRK15115, response regulator GlrR; Provisional Back     alignment and domain information
>gnl|CDD|163093 TIGR02974, phageshock_pspF, psp operon transcriptional activator PspF Back     alignment and domain information
>gnl|CDD|183227 PRK11608, pspF, phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>gnl|CDD|34269 COG4650, RtcR, Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>gnl|CDD|145879 pfam02954, HTH_8, Bacterial regulatory protein, Fis family Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

Original result of HHsearch against CDD database

IdentityAlignment graphLength Definition Probability
Target 482 putative sigma-54-dependent transcription regulator pro
COG2204464 AtoC Response regulator containing CheY-like receiver, 100.0
TIGR01818471 ntrC nitrogen regulation protein NR(I); InterPro: IPR01 100.0
PRK11361457 acetoacetate metabolism regulatory protein AtoC; Provis 100.0
TIGR02915451 PEP_resp_reg putative PEP-CTERM system response regulat 100.0
PRK10923469 glnG nitrogen regulation protein NR(I); Provisional 100.0
PRK10365441 transcriptional regulatory protein ZraR; Provisional 100.0
TIGR01817574 nifA Nif-specific regulatory protein; InterPro: IPR0101 100.0
COG3829560 RocR Transcriptional regulator containing PAS, AAA-type 100.0
PRK05022510 anaerobic nitric oxide reductase transcription regulato 100.0
COG3604550 FhlA Transcriptional regulator containing GAF, AAA-type 100.0
PRK10820513 DNA-binding transcriptional regulator TyrR; Provisional 100.0
TIGR02974349 phageshock_pspF psp operon transcriptional activator Ps 100.0
PRK11388639 DNA-binding transcriptional regulator DhaR; Provisional 100.0
PRK11608325 pspF phage shock protein operon transcriptional activat 100.0
COG3284606 AcoR Transcriptional activator of acetoin/glycerol meta 100.0
COG3283511 TyrR Transcriptional regulator of aromatic amino acids 100.0
COG1221403 PspF Transcriptional regulators containing an AAA-type 100.0
COG4650531 RtcR Sigma54-dependent transcription regulator containi 100.0
PRK00080328 ruvB Holliday junction DNA helicase RuvB; Reviewed 98.98
TIGR00635305 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR 98.7
COG2255332 RuvB Holliday junction resolvasome, helicase subunit [D 98.61
TIGR02329658 propionate_PrpR propionate catabolism operon regulatory 100.0
pfam00158168 Sigma54_activat Sigma-54 interaction domain. 100.0
cd00009151 AAA The AAA+ (ATPases Associated with a wide variety of 99.5
pfam07724168 AAA_2 AAA domain (Cdc48 subfamily). This Pfam entry inc 99.48
PRK13407334 bchI magnesium chelatase subunit I; Provisional 99.43
pfam07726131 AAA_3 ATPase family associated with various cellular ac 99.36
pfam07728139 AAA_5 AAA domain (dynein-related subfamily). This Pfam 99.35
CHL00081347 chlI Mg-protoporyphyrin IX chelatase 99.2
pfam00493327 MCM MCM2/3/5 family. 99.14
COG0714329 MoxR-like ATPases [General function prediction only] 99.11
pfam01078207 Mg_chelatase Magnesium chelatase, subunit ChlI. Magnesi 99.09
COG1239423 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] 99.05
smart00350509 MCM minichromosome maintenance proteins. 98.95
TIGR02640265 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR0 98.69
PRK09862506 putative ATP-dependent protease; Provisional 98.63
COG0606490 Predicted ATPase with chaperone activity [Posttranslati 98.47
PRK13531 498 regulatory ATPase RavA; Provisional 98.44
pfam00004131 AAA ATPase family associated with various cellular acti 98.42
COG1223368 Predicted ATPase (AAA+ superfamily) [General function p 98.13
KOG0733802 consensus 98.08
PHA02244383 ATPase-like protein 98.02
PRK11034 758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 98.0
KOG0727408 consensus 97.98
smart00382148 AAA ATPases associated with a variety of cellular activ 97.94
PRK08116262 hypothetical protein; Validated 97.8
PRK07952242 DNA replication protein DnaC; Validated 97.59
PRK08181269 transposase; Validated 97.57
PRK06526254 transposase; Provisional 97.55
KOG0736953 consensus 97.52
PRK12377248 putative replication protein; Provisional 97.49
PRK06835330 DNA replication protein DnaC; Validated 97.46
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639 774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 97.43
KOG0739439 consensus 97.38
pfam01695178 IstB IstB-like ATP binding protein. This protein contai 97.36
PRK09183258 transposase/IS protein; Provisional 97.34
pfam05673248 DUF815 Protein of unknown function (DUF815). This famil 97.28
PRK09112352 DNA polymerase III subunit delta'; Validated 97.05
KOG0726440 consensus 96.99
COG0542 786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 96.95
KOG0742630 consensus 96.95
KOG0740428 consensus 96.9
KOG0477854 consensus 96.89
PRK07471363 DNA polymerase III subunit delta'; Validated 96.82
PRK06921265 hypothetical protein; Provisional 96.82
KOG0730 693 consensus 96.81
TIGR01243 980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.8
TIGR01243980 CDC48 AAA family ATPase, CDC48 subfamily; InterPro: IPR 96.76
COG1484254 DnaC DNA replication protein [DNA replication, recombin 96.7
PRK08939306 primosomal protein DnaI; Reviewed 96.34
KOG0735952 consensus 96.14
KOG0651388 consensus 95.9
PRK07132303 DNA polymerase III subunit delta'; Validated 95.53
COG2607287 Predicted ATPase (AAA+ superfamily) [General function p 95.18
PRK11331459 5-methylcytosine-specific restriction enzyme subunit Mc 94.72
pfam03969361 AFG1_ATPase AFG1-like ATPase. This family of proteins c 94.17
cd04158169 ARD1 ARD1 subfamily. ARD1 (ADP-ribosylation factor doma 93.04
PRK06090319 DNA polymerase III subunit delta'; Validated 93.01
smart00177175 ARF ARF-like small GTPases; ARF, ADP-ribosylation facto 92.89
cd00878158 Arf_Arl Arf (ADP-ribosylation factor)/Arl (Arf-like) sm 92.47
cd04151158 Arl1 Arl1 subfamily. Arl1 (Arf-like 1) localizes to the 92.28
cd04155173 Arl3 Arl3 subfamily. Arl3 (Arf-like 3) is an Arf family 91.94
cd04153174 Arl5_Arl8 Arl5/Arl8 subfamily. Arl5 (Arf-like 5) and Ar 91.91
cd04156160 ARLTS1 ARLTS1 subfamily. ARLTS1 (Arf-like tumor suppres 91.17
KOG0479 818 consensus 91.09
cd04150159 Arf1_5_like Arf1-Arf5-like subfamily. This subfamily co 91.08
cd03227162 ABC_Class2 ABC-type Class 2 contains systems involved i 90.88
cd04152183 Arl4_Arl7 Arl4/Arl7 subfamily. Arl4 (Arf-like 4) is hig 90.33
TIGR02154226 PhoB phosphate regulon transcriptional regulatory prote 99.94
PRK00742345 chemotaxis-specific methylesterase; Provisional 99.83
PRK12555340 chemotaxis-specific methylesterase; Provisional 99.79
COG2201350 CheB Chemotaxis response regulator containing a CheY-li 99.52
COG3706435 PleD Response regulator containing a CheY-like receiver 98.59
PRK11288501 araG L-arabinose transporter ATP-binding protein; Provi 91.86
PRK10693337 response regulator of RpoS; Provisional 99.92
PRK10046225 dpiA two-component response regulator DpiA; Provisional 99.91
PRK09468239 ompR osmolarity response regulator; Provisional 99.91
PRK11083229 DNA-binding response regulator CreB; Provisional 99.9
PRK09581457 pleD response regulator PleD; Reviewed 99.9
PRK09836226 DNA-binding transcriptional activator CusR; Provisional 99.89
PRK10161229 transcriptional regulator PhoB; Provisional 99.89
PRK10336219 DNA-binding transcriptional regulator QseB; Provisional 99.89
CHL00148240 orf27 Ycf27; Reviewed 99.89
PRK10430239 DNA-binding transcriptional activator DcuR; Provisional 99.88
pfam00072111 Response_reg Response regulator receiver domain. This d 99.88
PRK10610129 chemotaxis regulatory protein CheY; Provisional 99.88
PRK11517223 transcriptional regulatory protein YedW; Provisional 99.88
PRK10529225 DNA-binding transcriptional activator KdpE; Provisional 99.88
PRK09390202 fixJ response regulator FixJ; Provisional 99.87
PRK10701240 DNA-binding transcriptional regulator RstA; Provisional 99.87
PRK11173237 two-component response regulator; Provisional 99.87
PRK10643222 DNA-binding transcriptional regulator BasR; Provisional 99.87
cd00156113 REC Signal receiver domain; originally thought to be un 99.86
PRK10955232 DNA-binding transcriptional regulator CpxR; Provisional 99.86
PRK10710240 DNA-binding transcriptional regulator BaeR; Provisional 99.86
PRK10766224 DNA-binding transcriptional regulator TorR; Provisional 99.86
PRK13557538 histidine kinase; Provisional 99.86
PRK10816223 DNA-binding transcriptional regulator PhoP; Provisional 99.86
COG0745229 OmpR Response regulators consisting of a CheY-like rece 99.86
COG4566202 TtrR Response regulator [Signal transduction mechanisms 99.85
TIGR01387219 cztR_silR_copR heavy metal response regulator; InterPro 99.85
PRK13856241 two-component response regulator VirG; Provisional 99.85
COG4753475 Response regulator containing CheY-like receiver domain 99.85
PRK10841947 hybrid sensory kinase in two-component regulatory syste 99.85
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 99.84
PRK099591197 hybrid sensory histidine kinase in two-component regula 99.84
PRK13435141 response regulator; Provisional 99.82
PRK11466912 hybrid sensory histidine kinase TorS; Provisional 99.82
PRK11091779 aerobic respiration control sensor protein ArcB; Provis 99.8
COG3437360 Response regulator containing a CheY-like receiver doma 99.77
COG4565224 CitB Response regulator of citrate/malate metabolism [T 99.76
TIGR02875270 spore_0_A sporulation transcription factor Spo0A; Inter 99.74
PRK10403215 transcriptional regulator NarP; Provisional 99.73
PRK10651216 transcriptional regulator NarL; Provisional 99.72
PRK13837831 two-component VirA-like sensor kinase; Provisional 99.72
PRK09958204 DNA-binding transcriptional activator EvgA; Provisional 99.71
COG3706435 PleD Response regulator containing a CheY-like receiver 99.71
PRK09483216 response regulator; Provisional 99.7
PRK09935210 transcriptional regulator FimZ; Provisional 99.68
COG3947361 Response regulator containing CheY-like receiver and SA 99.67
COG2197211 CitB Response regulator containing a CheY-like receiver 99.65
KOG0519786 consensus 99.64
COG4567182 Response regulator consisting of a CheY-like receiver d 99.63
PRK10840216 transcriptional regulator RcsB; Provisional 99.62
PRK10360196 DNA-binding transcriptional activator UhpA; Provisional 99.57
PRK11697239 putative two-component response-regulatory protein YehT 99.56
COG0784130 CheY FOG: CheY-like receiver [Signal transduction mecha 99.55
TIGR029561052 TMAO_torS TMAO reductase sytem sensor TorS; InterPro: I 99.55
PRK09191261 two-component response regulator; Provisional 99.55
PRK13558 674 bacterio-opsin activator; Provisional 99.48
PRK10100216 DNA-binding transcriptional regulator CsgD; Provisional 99.37
COG3707194 AmiR Response regulator with putative antiterminator ou 99.15
PRK11475205 DNA-binding transcriptional activator BglJ; Provisional 99.0
COG3279244 LytT Response regulator of the LytR/AlgR family [Transc 98.99
PRK09581457 pleD response regulator PleD; Reviewed 98.52
pfam06490109 FleQ Flagellar regulatory protein FleQ. This domain is 98.48
PRK11107920 hybrid sensory histidine kinase BarA; Provisional 98.39
TIGR01815726 TrpE-clade3 anthranilate synthase; InterPro: IPR010112 96.51
COG1204 766 Superfamily II helicase [General function prediction on 93.94
cd02068127 radical_SAM_B12_BD B12 binding domain_like associated w 93.41
TIGR02538577 type_IV_pilB type IV-A pilus assembly ATPase PilB; Inte 91.68
cd02067119 B12-binding B12 binding domain (B12-BD). This domain bi 90.93
TIGR02902 532 spore_lonB ATP-dependent protease LonB; InterPro: IPR01 99.81
PRK13342417 recombination factor protein RarA; Reviewed 99.34
PRK10865857 protein disaggregation chaperone; Provisional 99.27
CHL00095823 clpC Clp protease ATP binding subunit 99.26
PRK13341 726 recombination factor protein RarA/unknown domain fusion 99.25
TIGR03345852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 99.25
TIGR03346852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 99.23
PRK00440318 rfc replication factor C small subunit; Reviewed 99.16
COG0542786 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ 99.13
COG2256 436 MGS1 ATPase related to the helicase subunit of the Holl 99.12
pfam05496234 RuvB_N Holliday junction DNA helicase ruvB N-terminus. 99.02
PRK12402337 replication factor C small subunit 2; Reviewed 98.98
PRK08903227 hypothetical protein; Validated 98.85
PRK04195403 replication factor C large subunit; Provisional 98.84
TIGR03420226 DnaA_homol_Hda DnaA regulatory inactivator Hda. Members 98.84
PRK03992390 proteasome-activating nucleotidase; Provisional 98.82
CHL00176 631 ftsH cell division protein; Validated 98.82
TIGR02442 688 Cob-chelat-sub cobaltochelatase subunit; InterPro: IPR0 98.78
TIGR01241 505 FtsH_fam ATP-dependent metallopeptidase HflB; InterPro: 98.77
PRK05642234 DNA replication initiation factor; Validated 98.68
PRK08084235 DNA replication initiation factor; Provisional 98.67
pfam00308219 Bac_DnaA Bacterial dnaA protein. 98.66
COG1222406 RPT1 ATP-dependent 26S proteasome regulatory subunit [P 98.63
PRK08727233 hypothetical protein; Validated 98.62
PRK10733 644 hflB ATP-dependent metalloprotease; Reviewed 98.61
PRK05563 541 DNA polymerase III subunits gamma and tau; Validated 98.59
PRK06645 507 DNA polymerase III subunits gamma and tau; Validated 98.59
KOG1051898 consensus 98.56
PRK00411394 cdc6 cell division control protein 6; Reviewed 98.55
PRK07270 557 DNA polymerase III subunits gamma and tau; Validated 98.52
PRK00149447 dnaA chromosomal replication initiation protein; Review 98.47
PRK06893229 DNA replication initiation factor; Validated 98.44
TIGR01242364 26Sp45 26S proteasome subunit P45 family; InterPro: IPR 98.43
TIGR02928383 TIGR02928 orc1/cdc6 family replication initiation prote 98.42
KOG0731 774 consensus 98.42
PRK07003 816 DNA polymerase III subunits gamma and tau; Validated 98.41
PRK12422455 chromosomal replication initiation protein; Provisional 98.4
TIGR02397363 dnaX_nterm DNA polymerase III, subunits gamma and tau; 98.35
PRK06305 462 DNA polymerase III subunits gamma and tau; Validated 98.33
PRK07764 775 DNA polymerase III subunits gamma and tau; Validated 98.33
PRK08451 523 DNA polymerase III subunits gamma and tau; Validated 98.31
KOG0733 802 consensus 98.31
KOG2028554 consensus 98.3
CHL00095 823 clpC Clp protease ATP binding subunit 98.29
PRK08853 717 DNA polymerase III subunits gamma and tau; Validated 98.28
TIGR03015269 pepcterm_ATPase putative secretion ATPase, PEP-CTERM lo 98.28
PRK10865 857 protein disaggregation chaperone; Provisional 98.27
PRK06647 560 DNA polymerase III subunits gamma and tau; Validated 98.25
PRK06674 563 DNA polymerase III subunits gamma and tau; Validated 98.25
PRK07994 643 DNA polymerase III subunits gamma and tau; Validated 98.24
) from Escherichia coli. ClpA is an ATP-dependent chaperone and part of the ClpAP protease that participates in regulatory protein degradation and the dissolution and degradation of protein aggregates . ClpA recognises sequences in specific proteins, which it then unfolds in an ATP-dependent manner and transports into the degradation chamber of the associated ClpP protein , . A small adaptor-like protein, ClpS, modulates the activity of ClpA and is an important regulatory factor for this protein . It protects ClpA from autodegradation and appears to redirect its activity away from soluble proteins and toward aggregated proteins.." target="_blank" href="http://www.ncbi.nlm.nih.gov/Structure/cdd/cddsrv.cgi?uid=TIGR02639">TIGR02639774 ClpA ATP-dependent Clp protease ATP-binding subunit Clp 98.23
PRK09111 600 DNA polymerase III subunits gamma and tau; Validated 98.21
PRK08691 704 DNA polymerase III subunits gamma and tau; Validated 98.2
COG0593408 DnaA ATPase involved in DNA replication initiation [DNA 98.2
TIGR03346 852 chaperone_ClpB ATP-dependent chaperone ClpB. Members of 98.18
TIGR03345 852 VI_ClpV1 type VI secretion ATPase, ClpV1 family. Member 98.11
KOG0734 752 consensus 98.11
PRK08770 663 DNA polymerase III subunits gamma and tau; Validated 98.07
PRK09087226 hypothetical protein; Validated 98.03
PRK05896 613 DNA polymerase III subunits gamma and tau; Validated 98.01
PRK07133 718 DNA polymerase III subunits gamma and tau; Validated 97.96
COG0465 596 HflB ATP-dependent Zn proteases [Posttranslational modi 97.88
PRK06872 696 DNA polymerase III subunits gamma and tau; Provisional 97.88
PRK05648 705 DNA polymerase III subunits gamma and tau; Reviewed 97.85
KOG0989346 consensus 97.8
PRK12323 721 DNA polymerase III subunits gamma and tau; Provisional 97.68
KOG0729435 consensus 97.36
COG2812 515 DnaX DNA polymerase III, gamma/tau subunits [DNA replic 97.16
PTZ00112650 origin recognition complex 1 protein; Provisional 96.74
KOG0652424 consensus 96.6
pfam05621302 TniB Bacterial TniB protein. This family consists of se 96.55
KOG0991333 consensus 94.01
KOG0741744 consensus 92.5
KOG2170344 consensus 90.25
TIGR02903 616 spore_lon_C ATP-dependent protease, Lon family; InterPr 99.77
TIGR02880284 cbbX_cfxQ CbbX protein; InterPro: IPR000470 Proteins in 97.74
TIGR02030340 BchI-ChlI magnesium chelatase ATPase subunit I; InterPr 97.71
COG3267269 ExeA Type II secretory pathway, component ExeA (predict 97.21
PRK13765 637 ATP-dependent protease Lon; Provisional 99.5
CHL00195491 ycf46 Ycf46; Provisional 99.07
PRK13406 584 bchD magnesium chelatase subunit D; Provisional 98.91
CHL00181287 cbbX CbbX; Provisional 98.82
PRK10787 784 DNA-binding ATP-dependent protease La; Provisional 98.8
TIGR00763 941 lon ATP-dependent protease La; InterPro: IPR004815 Prot 98.78
COG1067 647 LonB Predicted ATP-dependent protease [Posttranslationa 98.74
KOG0730693 consensus 98.68
KOG0480764 consensus 98.61
COG1241682 MCM2 Predicted ATPase involved in replication control, 98.51
TIGR02881261 spore_V_K stage V sporulation protein K; InterPro: IPR0 98.24
KOG2004 906 consensus 98.23
TIGR02031 705 BchD-ChlD magnesium chelatase ATPase subunit D; InterPr 98.2
COG0464494 SpoVK ATPases of the AAA+ class [Posttranslational modi 98.11
PRK06620214 hypothetical protein; Validated 97.87
KOG0737386 consensus 97.78
KOG0738491 consensus 97.73
KOG1969 877 consensus 97.55
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA 97.44
KOG0728404 consensus 96.95
PRK05629331 hypothetical protein; Validated 96.02
KOG0481729 consensus 94.62
PRK06585343 holA DNA polymerase III subunit delta; Reviewed 94.16
TIGR01420350 pilT_fam twitching motility protein; InterPro: IPR00632 92.6
PRK11034758 clpA ATP-dependent Clp protease ATP-binding subunit; Pr 99.36
TIGR02418553 acolac_catab acetolactate synthase, catabolic; InterPro 93.89
PRK0190577 DNA-binding protein Fis; Provisional 99.15
PRK0043098 fis DNA-binding protein Fis; Provisional 99.14
pfam0295442 HTH_8 Bacterial regulatory protein, Fis family. 99.0
COG290198 Fis Factor for inversion stimulation Fis, transcription 98.8
TIGR02040453 PpsR-CrtJ transcriptional regulator PpsR; InterPro: IPR 98.64
COG4567182 Response regulator consisting of a CheY-like receiver d 98.07
COG2508421 Regulator of polyketide synthase expression [Signal tra 96.52
PRK11477385 carbohydrate diacid transcriptional activator CdaR; Pro 94.94
PRK05657328 RNA polymerase sigma factor RpoS; Validated 92.99
PRK13413200 mpi multiple promoter invertase; Provisional 92.59
COG134299 Predicted DNA-binding proteins [General function predic 91.9
cd0056942 HTH_Hin_like Helix-turn-helix domain of Hin and related 91.88
pfam02001100 DUF134 Protein of unknown function DUF134. This family 91.67
COG3835376 CdaR Sugar diacid utilization regulator [Transcription 91.66
pfam09862113 DUF2089 Protein of unknown function(DUF2089). This doma 91.35
smart00344108 HTH_ASNC helix_turn_helix ASNC type. AsnC: an autogenou 90.54
COG165479 BirA Biotin operon repressor [Transcription] 90.28
PRK04841903 transcriptional regulator MalT; Provisional 90.25
pfam0632264 Phage_NinH Phage NinH protein. This family consists of 90.16
COG0466 782 Lon ATP-dependent Lon protease, bacterial type [Posttra 98.62
PRK05574336 holA DNA polymerase III subunit delta; Reviewed 96.6
PRK07914320 hypothetical protein; Reviewed 96.15
PRK05342411 clpX ATP-dependent protease ATP-binding subunit ClpX; P 98.54
KOG0478804 consensus 98.27
KOG0745564 consensus 98.24
COG1219408 ClpX ATP-dependent protease Clp, ATPase subunit [Posttr 98.07
PTZ00111 916 DNA replication licensing factor MCM4; Provisional 97.76
COG0470325 HolB ATPase involved in DNA replication [DNA replicatio 97.46
PRK05564313 DNA polymerase III subunit delta'; Validated 97.19
KOG0744423 consensus 97.03
PRK07940395 DNA polymerase III subunit delta'; Validated 96.5
PRK04132 863 replication factor C small subunit; Provisional 96.42
KOG0482721 consensus 96.19
PRK07399314 DNA polymerase III subunit delta'; Validated 96.01
PRK08058329 DNA polymerase III subunit delta'; Validated 95.94
pfam05729165 NACHT NACHT domain. This NTPase domain is found in apop 95.76
KOG1808 1856 consensus 95.74
PRK05707328 DNA polymerase III subunit delta'; Validated 94.81
PRK05917290 DNA polymerase III subunit delta'; Validated 94.65
COG5022 1463 Myosin heavy chain [Cytoskeleton] 94.37
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cyt 94.22
COG1373398 Predicted ATPase (AAA+ superfamily) [General function p 94.21
PRK08769319 DNA polymerase III subunit delta'; Validated 94.08
KOG1051 898 consensus 93.97
KOG0735 952 consensus 93.93
PRK06871324 DNA polymerase III subunit delta'; Validated 93.85
TIGR01193710 bacteriocin_ABC ABC-type bacteriocin transporter; Inter 93.71
pfam05707183 Zot Zonular occludens toxin (Zot). This family consists 93.48
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter nucle 92.9
KOG2543438 consensus 90.97
smart0044855 REC cheY-homologous receiver domain. CheY regulates the 98.52
PRK05637208 anthranilate synthase component II; Provisional 93.43
TIGR00382452 clpX ATP-dependent Clp protease, ATP-binding subunit Cl 98.45
PRK05201442 hslU ATP-dependent protease ATP-binding subunit; Provis 98.26
TIGR00764 662 lon_rel ATP-dependent protease, putative; InterPro: IPR 95.95
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 95.81
COG1220444 HslU ATP-dependent protease HslVU (ClpYQ), ATPase subun 94.83
pfam03215 490 Rad17 Rad17 cell cycle checkpoint protein. 94.4
KOG2680454 consensus 91.97
KOG1942456 consensus 91.23
TIGR00368505 TIGR00368 Mg chelatase homolog; InterPro: IPR004482 Thi 98.21
KOG0732 1080 consensus 97.46
TIGR02688470 TIGR02688 conserved hypothetical protein TIGR02688; Int 96.34
cd02024187 NRK1 Nicotinamide riboside kinase (NRK) is an enzyme in 93.21
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 97.06
pfam08298358 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.76
KOG0741 744 consensus 96.54
smart00763361 AAA_PrkA PrkA AAA domain. This is a family of PrkA bact 96.07
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette 96.06
COG5271 4600 MDN1 AAA ATPase containing von Willebrand factor type A 95.79
TIGR00390463 hslU heat shock protein HslVU, ATPase subunit HslU; Int 95.75
pfam00437283 GSPII_E Type II/IV secretion system protein. This famil 95.07
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. Myosin 94.93
TIGR00634 605 recN DNA repair protein RecN; InterPro: IPR004604 DNA r 94.35
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 94.29
TIGR02525374 plasmid_TraJ plasmid transfer ATPase TraJ; InterPro: IP 94.27
TIGR02782315 TrbB_P P-type conjugative transfer ATPase TrbB; InterPr 94.26
cd01130186 VirB11-like_ATPase Type IV secretory pathway component 94.23
PRK13633281 cobalt transporter ATP-binding subunit; Provisional 93.94
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. Myos 93.93
TIGR02173173 cyt_kin_arch cytidylate kinase, putative; InterPro: IPR 93.86
COG3910233 Predicted ATPase [General function prediction only] 93.69
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII myosins 93.67
PRK07261171 topology modulation protein; Provisional 93.25
PTZ00014 821 myosin A; Provisional 93.1
PRK13833323 conjugal transfer protein TrbB; Provisional 92.95
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular motor. Mu 92.93
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. Myosin 92.86
PRK08118167 topology modulation protein; Reviewed 92.81
PRK13900332 type IV secretion system ATPase VirB11; Provisional 92.79
KOG1970 634 consensus 92.6
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. Myos 92.57
cd01124187 KaiC KaiC is a circadian clock protein primarily found 92.45
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC transpor 92.35
PRK09302501 circadian clock protein KaiC; Reviewed 92.21
PRK13851343 type IV secretion system protein VirB11; Provisional 92.18
PRK13894320 conjugal transfer ATPase TrbB; Provisional 92.07
pfam06745231 KaiC KaiC. This family represents a conserved region wi 91.61
PRK10419266 nikE nickel transporter ATP-binding protein; Provisiona 91.55
TIGR02769267 nickel_nikE nickel import ATP-binding protein NikE; Int 91.26
PRK13768253 GTPase; Provisional 91.25
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transport s 91.21
PRK03839180 putative kinase; Provisional 91.04
cd01379 653 MYSc_type_III Myosin motor domain, type III myosins. My 91.01
COG4178604 ABC-type uncharacterized transport system, permease and 91.0
pfam06068395 TIP49 TIP49 C-terminus. This family consists of the C-t 90.82
cd04160167 Arfrp1 Arfrp1 subfamily. Arfrp1 (Arf-related protein 1) 90.79
KOG0924 1042 consensus 90.75
COG1123539 ATPase components of various ABC-type transport systems 90.74
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Provisi 90.67
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter; InterPro: I 90.45
pfam00063 679 Myosin_head Myosin head (motor domain). 90.36
TIGR02203603 MsbA_lipidA lipid A export permease/ATP-binding protein 90.35
PRK10869 553 recombination and repair protein; Provisional 90.3
TIGR02788328 VirB11 P-type DNA transfer ATPase VirB11; InterPro: IPR 90.28
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transport s 90.25
COG0563178 Adk Adenylate kinase and related kinases [Nucleotide tr 90.05
PRK13566724 anthranilate synthase; Provisional 96.49
PRK11131 1295 ATP-dependent RNA helicase HrpA; Provisional 95.57
PRK01172 674 ski2-like helicase; Provisional 94.91
PRK02362 736 ski2-like helicase; Provisional 92.78
COG4172534 ABC-type uncharacterized transport system, duplicated A 92.74
PRK00254 717 ski2-like helicase; Provisional 91.22
pfam03709111 OKR_DC_1_N Orn/Lys/Arg decarboxylase, N-terminal domain 96.1
PRK13409590 putative ATPase RIL; Provisional 94.98
pfam02310121 B12-binding B12 binding domain. This domain binds to B1 94.22
COG0512191 PabA Anthranilate/para-aminobenzoate synthases componen 92.88
COG1224450 TIP49 DNA helicase TIP49, TBP-interacting protein [Tran 95.36
TIGR01842556 type_I_sec_PrtD type I secretion system ATPase; InterPr 94.74
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific type X 94.55
PRK06762166 hypothetical protein; Provisional 93.6
COG4615546 PvdE ABC-type siderophore export system, fused ATPase a 93.52
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, DevA 92.7
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. In v 91.63
PRK04328250 hypothetical protein; Provisional 90.89
PRK09361224 radB DNA repair and recombination protein RadB; Provisi 90.76
COG0467260 RAD55 RecA-superfamily ATPases implicated in signal tra 90.45
COG1493308 HprK Serine kinase of the HPr protein, regulates carboh 94.6
PRK05428308 HPr kinase/phosphorylase; Provisional 92.76
TIGR01846703 type_I_sec_HlyB type I secretion system ATPase; InterPr 92.32
KOG2035351 consensus 91.83
pfam07693301 KAP_NTPase KAP family P-loop domain. The KAP (after Kid 91.02
>COG2204 AtoC Response regulator containing CheY-like receiver, AAA-type ATPase, and DNA-binding domains [Signal transduction mechanisms] Back     alignment and domain information
>TIGR01818 ntrC nitrogen regulation protein NR(I); InterPro: IPR010114 This entry represents Nitrogen regulatory protein C (NtrC), which is a bacterial enhancer-binding protein that activates the transcription of genes encoding enzymes required for nitrogen metabolism Back     alignment and domain information
>PRK11361 acetoacetate metabolism regulatory protein AtoC; Provisional Back     alignment and domain information
>TIGR02915 PEP_resp_reg putative PEP-CTERM system response regulator; InterPro: IPR014264 Members of this protein family share full-length homology with (but do not include) the acetoacetate metabolism regulatory protein AtoC (see Q06065 from SWISSPROT) Back     alignment and domain information
>PRK10923 glnG nitrogen regulation protein NR(I); Provisional Back     alignment and domain information
>PRK10365 transcriptional regulatory protein ZraR; Provisional Back     alignment and domain information
>TIGR01817 nifA Nif-specific regulatory protein; InterPro: IPR010113 This entry represents NifA, a DNA-binding regulatory protein for nitrogen fixation Back     alignment and domain information
>COG3829 RocR Transcriptional regulator containing PAS, AAA-type ATPase, and DNA-binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK05022 anaerobic nitric oxide reductase transcription regulator; Provisional Back     alignment and domain information
>COG3604 FhlA Transcriptional regulator containing GAF, AAA-type ATPase, and DNA binding domains [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK10820 DNA-binding transcriptional regulator TyrR; Provisional Back     alignment and domain information
>TIGR02974 phageshock_pspF psp operon transcriptional activator PspF; InterPro: IPR014317 Members of this protein are PspF, the sigma-54-dependent transcriptional activator of the phage shock protein (psp) operon, found in Escherichia coli and numerous other species Back     alignment and domain information
>PRK11388 DNA-binding transcriptional regulator DhaR; Provisional Back     alignment and domain information
>PRK11608 pspF phage shock protein operon transcriptional activator; Provisional Back     alignment and domain information
>COG3284 AcoR Transcriptional activator of acetoin/glycerol metabolism [Secondary metabolites biosynthesis, transport, and catabolism / Transcription] Back     alignment and domain information
>COG3283 TyrR Transcriptional regulator of aromatic amino acids metabolism [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>COG1221 PspF Transcriptional regulators containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>COG4650 RtcR Sigma54-dependent transcription regulator containing an AAA-type ATPase domain and a DNA-binding domain [Transcription / Signal transduction mechanisms] Back     alignment and domain information
>PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed Back     alignment and domain information
>TIGR00635 ruvB Holliday junction DNA helicase RuvB; InterPro: IPR004605 All proteins in this family for which functions are known are 5'-3' DNA helicases that, as part of a complex with RuvA homologs serve as a 5'-3' Holliday junction helicase Back     alignment and domain information
>COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02329 propionate_PrpR propionate catabolism operon regulatory protein PrpR; InterPro: IPR012704 At least five distinct pathways exist for the catabolism of propionate by way of propionyl-CoA Back     alignment and domain information
>pfam00158 Sigma54_activat Sigma-54 interaction domain Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>pfam07724 AAA_2 AAA domain (Cdc48 subfamily) Back     alignment and domain information
>PRK13407 bchI magnesium chelatase subunit I; Provisional Back     alignment and domain information
>pfam07726 AAA_3 ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>pfam07728 AAA_5 AAA domain (dynein-related subfamily) Back     alignment and domain information
>CHL00081 chlI Mg-protoporyphyrin IX chelatase Back     alignment and domain information
>pfam00493 MCM MCM2/3/5 family Back     alignment and domain information
>COG0714 MoxR-like ATPases [General function prediction only] Back     alignment and domain information
>pfam01078 Mg_chelatase Magnesium chelatase, subunit ChlI Back     alignment and domain information
>COG1239 ChlI Mg-chelatase subunit ChlI [Coenzyme metabolism] Back     alignment and domain information
>smart00350 MCM minichromosome maintenance proteins Back     alignment and domain information
>TIGR02640 gas_vesic_GvpN gas vesicle protein GvpN; InterPro: IPR013462 The GvpN protein is associated with the production of gas vesicles produced in some prokaryotes to give cells buoyancy , Back     alignment and domain information
>PRK09862 putative ATP-dependent protease; Provisional Back     alignment and domain information
>COG0606 Predicted ATPase with chaperone activity [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13531 regulatory ATPase RavA; Provisional Back     alignment and domain information
>pfam00004 AAA ATPase family associated with various cellular activities (AAA) Back     alignment and domain information
>COG1223 Predicted ATPase (AAA+ superfamily) [General function prediction only] Back     alignment and domain information
>KOG0733 consensus Back     alignment and domain information
>PHA02244 ATPase-like protein Back     alignment and domain information
>PRK11034 clpA ATP-dependent Clp protease ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0727 consensus Back     alignment and domain information
>smart00382 AAA ATPases associated with a variety of cellular activities Back     alignment and domain information
>PRK08116 hypothetical protein; Validated Back     alignment and domain information
>PRK07952 DNA replication protein DnaC; Validated Back     alignment and domain information
>PRK08181 transposase; Validated Back     alignment and domain information
>PRK06526 transposase; Provisional Back     alignment and domain information
>KOG0736 consensus Back     alignment and domain information
>PRK12377 putative replication protein; Provisional Back     alignment and domain information
>PRK06835 DNA replication protein DnaC; Validated Back     alignment and domain information
>TIGR02639 ClpA ATP-dependent Clp protease ATP-binding subunit ClpA; InterPro: IPR013461 Proteins in this entry are related to ClpA () from Escherichia coli Back     alignment and domain information
>KOG0739 consensus Back     alignment and domain information
>pfam01695 IstB IstB-like ATP binding protein Back     alignment and domain information
>PRK09183 transposase/IS protein; Provisional Back     alignment and domain information
>pfam05673 DUF815 Protein of unknown function (DUF815) Back     alignment and domain information
>PRK09112 DNA polymerase III subunit delta'; Validated Back     alignment and domain information
>KOG0726 consensus Back     alignment and domain information
>COG0542 clpA ATP-binding subunits of Clp protease and DnaK/DnaJ chaperones [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0742 consensus Back     alignment and domain information
>KOG0740 consensus Back     alignment and domain information
>KOG0477 consensus Back