254780928

254780928

histidyl-tRNA synthetase

GeneID in NCBI database:8209949Locus tag:CLIBASIA_04135
Protein GI in NCBI database:254780928Protein Accession:YP_003065341.1
Gene range:-(913350, 914840)Protein Length:496aa
Gene description:histidyl-tRNA synthetase
COG prediction:[J] Histidyl-tRNA synthetase
KEGG prediction:hisS; histidyl-tRNA synthetase (EC:6.1.1.21); K01892 histidyl-tRNA synthetase [EC:6.1.1.21]
SEED prediction:Histidyl-tRNA synthetase (EC 6.1.1.21)
Pathway involved in KEGG:Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, His
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED1 TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490------
MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI
cccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccEEEEccccEEHHHHHHcccccccccccccccccccccEEEEccccHHHHHHHHHHHHHHccccEEEEEEEcccccccccccccccEEEEEEEEEccccHHHHHHHHHHHHHHHHHccccccEEEEEEccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHcccccHHHHHHHHccccHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEEHHHHccccccccEEEEEEEccccccccccccccccccccccHHHHHHHHccccccEEEEEccHHHHHHHHHHcccccccccccccEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHHHHHHHccccEEEEEcHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcc
cccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHccccccccccEEcHHHHHHcccccccccccEEEcccccccEEEcccccHHHHHHHHHHHccccccccEEEEEcccEcccccccccEEEEEEcccHEccccccHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHcccHHHHHHHHHHHHHHHcHHHcccccccccEEccccccccHHHHccccccHHHHHHHHHHHcccHHHHHHHHHHHHccccccHHcHHHHHHHHHHHHHccccccEEEEcccHEcccccccccEEEEEEEEcccccccccccEEEEEcccccccHHHHccccccccHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccHHHHHHHHHHHHHHHHccccEEEcccccccHHHHHHHHHHccccEEEEEccHHHHccEEEEEccccccEHEEcHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccc
mgkktklraelprgfadcptkeIRIRNRILDSIRNIYenygfdpietplleysdslgkflpdedrpnkgvfslqdddgqwISLRYDLTAPLARYVaenfdtivfpcrtyrigpvfrnekhgpgrfrQFIQCdvdnvgssaetADAEMCMMMADTLEAVgikrndyhiginnRKILDGILEKiglhgddkLNERLIVLRAIDKLDKFGLQGVKLLLgegrtdnsgdftkganltsEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRksgynsnrikISSTIVRGLEYYtgcvyeailgfpvmnekqkpvvfgsvggggrydglvsrfkgqnvpatgfSIGISRLIVALKSLESSTNNIKEMGPVLITtmdhdsdslsKYQMYTQMLRTAGIRAEMflgssknfgnqlkyadrrncplaiiqgtgersrgmlQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI
mgkktklraelprgfadcptkeirirNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVfslqdddgqwISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLlgegrtdnsgdftkganltseqIDIMVSFLSIDLEKSMHELYELVKgtiagekgfNELVVISELvrksgynsnrikisstivrGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIiqgtgersrgmlqikdlakgkelsreiknneswrearvaqitipiselvsTVKKILQENKEEI
MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI
***********PRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMN*****VVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLES****IKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKI*Q******
MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI
*****KLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENK***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI
MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI
MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFLPDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISELVSTVKKILQENKEEI

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target496 histidyl-tRNA synthetase [Candidatus Liberibacter asiat
315122645495 histidyl-tRNA synthetase [Candidatus Liberibacter solan 1 0.0
222084995504 histidyl-tRNA synthetase protein [Agrobacterium radioba 1 0.0
327191139507 histidyl-tRNA synthetase protein [Rhizobium etli CNPAF5 1 1e-180
15888019507 histidyl-tRNA synthetase [Agrobacterium tumefaciens str 1 1e-173
325292059507 Histidyl-tRNA synthetase [Agrobacterium sp. H13-3] Leng 1 1e-173
190890528545 histidyl-tRNA synthetase [Rhizobium etli CIAT 652] Leng 1 1e-173
241203257506 histidyl-tRNA synthetase [Rhizobium leguminosarum bv. t 1 1e-172
209548071507 histidyl-tRNA synthetase [Rhizobium leguminosarum bv. t 1 1e-172
86356467552 histidyl-tRNA synthetase [Rhizobium etli CFN 42] Length 1 1e-172
116250651523 histidyl-tRNA synthetase [Rhizobium leguminosarum bv. v 1 1e-171
>gi|315122645|ref|YP_004063134.1| histidyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 495 Back     alignment and organism information
 Score =  877 bits (2266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 423/496 (85%), Positives = 459/496 (92%), Gaps = 1/496 (0%)

Query: 1   MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFL 60
           MGKKTK+RAELPRGFADCPT+EIRIRN+ILD+IR+IYE YGFDPIETPLLEYSD+LGKFL
Sbjct: 1   MGKKTKIRAELPRGFADCPTEEIRIRNKILDAIRDIYERYGFDPIETPLLEYSDALGKFL 60

Query: 61  PDEDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEKH 120
           PDEDRPN+GVFSLQDDD QWISLRYDLTAPLAR+VAE+ DTIVFP RTYRIGPVFRNEKH
Sbjct: 61  PDEDRPNQGVFSLQDDDSQWISLRYDLTAPLARHVAEHCDTIVFPYRTYRIGPVFRNEKH 120

Query: 121 GPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRNDYHIGINNRKILDGILE 180
           GPGRFRQFIQCDVDNVGSS ETADAEMCMMMADTLE  GIKRNDY +GINNRKILDGILE
Sbjct: 121 GPGRFRQFIQCDVDNVGSSKETADAEMCMMMADTLEYAGIKRNDYQVGINNRKILDGILE 180

Query: 181 KIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTSEQIDIM 240
           KIGL+GDDKLNERLIVLRAIDKLDKFG++GVKLLLGEGRTD+SGDFTKGANLT E+ID +
Sbjct: 181 KIGLNGDDKLNERLIVLRAIDKLDKFGMEGVKLLLGEGRTDDSGDFTKGANLTPEKIDTV 240

Query: 241 VSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISSTIVRGLE 300
           +SFLSID EKSM+ELYELVKG+ +GE GF EL+ ISELV KSGY+SNRIKISSTIVRGLE
Sbjct: 241 MSFLSIDCEKSMNELYELVKGSTSGETGFRELIAISELVSKSGYDSNRIKISSTIVRGLE 300

Query: 301 YYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIGISRLIV 360
           YYTGCVYEAIL FPV N+K++ V+FGSVGGGGRYDGLVSRFKGQN+PATGFSIGISRLIV
Sbjct: 301 YYTGCVYEAILRFPVKNKKKQTVIFGSVGGGGRYDGLVSRFKGQNIPATGFSIGISRLIV 360

Query: 361 ALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTAGIRAEMFLGSSKNFGNQ 420
           ALKSLE S  NI E GPVL+T MDHD DSL++YQMYTQMLR  GIR EMF GSSKNFGNQ
Sbjct: 361 ALKSLEDSAKNI-EKGPVLVTVMDHDIDSLNRYQMYTQMLRAEGIRTEMFQGSSKNFGNQ 419

Query: 421 LKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWREARVAQITIPISE 480
           LKYADRRNCPLAIIQG GERS+GMLQIKDL KGK+LS EIKNNE+WREARV Q  IPISE
Sbjct: 420 LKYADRRNCPLAIIQGEGERSKGMLQIKDLFKGKKLSHEIKNNETWREARVGQTMIPISE 479

Query: 481 LVSTVKKILQENKEEI 496
           LV+TVKK+LQEN EE+
Sbjct: 480 LVATVKKMLQENMEEV 495


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222084995|ref|YP_002543524.1| histidyl-tRNA synthetase protein [Agrobacterium radiobacter K84] Length = 504 Back     alignment and organism information
>gi|327191139|gb|EGE58183.1| histidyl-tRNA synthetase protein [Rhizobium etli CNPAF512] Length = 507 Back     alignment and organism information
>gi|15888019|ref|NP_353700.1| histidyl-tRNA synthetase [Agrobacterium tumefaciens str. C58] Length = 507 Back     alignment and organism information
>gi|325292059|ref|YP_004277923.1| Histidyl-tRNA synthetase [Agrobacterium sp. H13-3] Length = 507 Back     alignment and organism information
>gi|190890528|ref|YP_001977070.1| histidyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 545 Back     alignment and organism information
>gi|241203257|ref|YP_002974353.1| histidyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 506 Back     alignment and organism information
>gi|209548071|ref|YP_002279988.1| histidyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 507 Back     alignment and organism information
>gi|86356467|ref|YP_468359.1| histidyl-tRNA synthetase [Rhizobium etli CFN 42] Length = 552 Back     alignment and organism information
>gi|116250651|ref|YP_766489.1| histidyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 523 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target496 histidyl-tRNA synthetase [Candidatus Liberibacter asiat
PRK00037412 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed 1e-108
PLN02530487 PLN02530, PLN02530, histidine-tRNA ligase 2e-40
COG0124429 COG0124, HisS, Histidyl-tRNA synthetase [Translation, r 5e-97
TIGR00442397 TIGR00442, hisS, histidyl-tRNA synthetase 1e-101
KOG1936518 KOG1936, KOG1936, KOG1936, Histidyl-tRNA synthetase [Tr 9e-62
PRK12420423 PRK12420, PRK12420, histidyl-tRNA synthetase; Provision 2e-54
PLN02972763 PLN02972, PLN02972, Histidyl-tRNA synthetase 3e-51
PRK12292391 PRK12292, hisZ, ATP phosphoribosyltransferase regulator 4e-41
KOG10351351 KOG1035, KOG1035, KOG1035, eIF-2alpha kinase GCN2 [Tran 6e-16
cd00773261 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synt 5e-54
TIGR00443314 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltransfera 1e-41
COG3705390 COG3705, HisZ, ATP phosphoribosyltransferase involved i 3e-32
PRK12295373 PRK12295, hisZ, ATP phosphoribosyltransferase regulator 6e-17
PRK12421392 PRK12421, PRK12421, ATP phosphoribosyltransferase regul 9e-12
pfam00587170 pfam00587, tRNA-synt_2b, tRNA synthetase class II core 5e-21
CHL00201430 CHL00201, syh, histidine-tRNA synthetase; Provisional 1e-09
cd00768211 cd00768, class_II_aaRS-like_core, Class II tRNA amino-a 1e-06
pfam00152341 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K 2e-04
COG0441589 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, r 4e-04
cd00670235 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_ 4e-04
cd0085991 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon bind 3e-13
pfam0312993 pfam03129, HGTP_anticodon, Anticodon binding domain 7e-06
CHL00201430 CHL00201, syh, histidine-tRNA synthetase; Provisional 2e-10
KOG2324457 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Tran 0.001
cd00771298 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) c 0.004
>gnl|CDD|178812 PRK00037, hisS, histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178145 PLN02530, PLN02530, histidine-tRNA ligase Back     alignment and domain information
>gnl|CDD|30473 COG0124, HisS, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161881 TIGR00442, hisS, histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|37147 KOG1936, KOG1936, KOG1936, Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183519 PRK12420, PRK12420, histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|178555 PLN02972, PLN02972, Histidyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183410 PRK12292, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|36253 KOG1035, KOG1035, KOG1035, eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|73226 cd00773, HisRS-like_core, Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>gnl|CDD|161882 TIGR00443, hisZ_biosyn_reg, ATP phosphoribosyltransferase, regulatory subunit Back     alignment and domain information
>gnl|CDD|33500 COG3705, HisZ, ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183413 PRK12295, hisZ, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|183520 PRK12421, PRK12421, ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>gnl|CDD|144252 pfam00587, tRNA-synt_2b, tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>gnl|CDD|164576 CHL00201, syh, histidine-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|29813 cd00768, class_II_aaRS-like_core, Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>gnl|CDD|143920 pfam00152, tRNA-synt_2, tRNA synthetases class II (D, K and N) Back     alignment and domain information
>gnl|CDD|30790 COG0441, ThrS, Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29810 cd00670, Gly_His_Pro_Ser_Thr_tRS_core, Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>gnl|CDD|29799 cd00859, HisRS_anticodon, HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>gnl|CDD|145985 pfam03129, HGTP_anticodon, Anticodon binding domain Back     alignment and domain information
>gnl|CDD|164576 CHL00201, syh, histidine-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|37535 KOG2324, KOG2324, KOG2324, Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|29816 cd00771, ThrRS_core, Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 496 histidyl-tRNA synthetase [Candidatus Liberibacter asiat
COG0124429 HisS Histidyl-tRNA synthetase [Translation, ribosomal s 100.0
CHL00201424 syh histidine-tRNA synthetase; Provisional 100.0
KOG1936518 consensus 100.0
PRK00037417 hisS histidyl-tRNA synthetase; Reviewed 100.0
KOG10351351 consensus 100.0
PRK12325438 prolyl-tRNA synthetase; Provisional 100.0
PRK00413639 thrS threonyl-tRNA synthetase; Reviewed 100.0
PRK12304604 thrS threonyl-tRNA synthetase; Reviewed 100.0
PRK04483634 threonyl-tRNA synthetase; Validated 100.0
PRK12305576 thrS threonyl-tRNA synthetase; Reviewed 100.0
PRK09194570 prolyl-tRNA synthetase; Provisional 100.0
PRK03772642 threonyl-tRNA synthetase; Validated 100.0
PRK12444639 threonyl-tRNA synthetase; Reviewed 100.0
TIGR00418595 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The 100.0
PRK03991613 threonyl-tRNA synthetase; Validated 99.97
COG0441589 ThrS Threonyl-tRNA synthetase [Translation, ribosomal s 99.95
TIGR00389606 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR00231 99.92
PRK08661478 prolyl-tRNA synthetase; Provisional 99.89
PRK04173460 glycyl-tRNA synthetase; Provisional 99.89
COG0423558 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ri 99.88
KOG2324457 consensus 99.87
KOG1637560 consensus 99.83
TIGR00408 533 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 99.74
KOG2298599 consensus 99.53
KOG4163551 consensus 99.22
PRK12420421 histidyl-tRNA synthetase; Provisional 100.0
PRK12421391 ATP phosphoribosyltransferase regulatory subunit; Provi 100.0
TIGR00442446 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The 100.0
TIGR00409620 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 99.94
COG0442500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 99.89
PRK12292388 hisZ ATP phosphoribosyltransferase regulatory subunit; 100.0
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 100.0
TIGR00443414 hisS_second histidyl-tRNA synthetase 2, putative; Inter 100.0
PRK12295373 hisZ ATP phosphoribosyltransferase regulatory subunit; 100.0
cd00773261 HisRS-like_core Class II Histidinyl-tRNA synthetase (Hi 100.0
PRK12293281 hisZ ATP phosphoribosyltransferase regulatory subunit; 100.0
PRK12294272 hisZ ATP phosphoribosyltransferase regulatory subunit; 99.74
pfam00587170 tRNA-synt_2b tRNA synthetase class II core domain (G, H 99.96
cd00779255 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II 99.76
cd00772264 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core 99.73
cd00771298 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II co 99.71
cd00778261 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) clas 99.67
cd00768211 class_II_aaRS-like_core Class II tRNA amino-acyl synthe 99.64
cd00670235 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA s 99.58
cd00770297 SerRS_core Seryl-tRNA synthetase (SerRS) class II core 99.09
cd00774254 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like cla 99.09
PRK09537420 pylS pyrolysyl-tRNA synthetase; Reviewed 98.8
TIGR02367453 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 Py 98.62
COG0172429 SerS Seryl-tRNA synthetase [Translation, ribosomal stru 98.54
PRK05431422 seryl-tRNA synthetase; Provisional 98.44
PRK04172501 pheS phenylalanyl-tRNA synthetase subunit alpha; Provis 98.39
COG2269322 Truncated, possibly inactive, lysyl-tRNA synthetase (cl 98.26
COG1190502 LysU Lysyl-tRNA synthetase (class II) [Translation, rib 98.24
COG0016335 PheS Phenylalanyl-tRNA synthetase alpha subunit [Transl 98.14
PTZ00326505 phenylalanyl-tRNA synthetase; Provisional 98.07
KOG2509455 consensus 97.86
TIGR00414460 serS seryl-tRNA synthetase; InterPro: IPR002317 The ami 96.84
TIGR00468362 pheS phenylalanyl-tRNA synthetase, alpha subunit; Inter 95.07
cd0085991 HisRS_anticodon HisRS Histidyl-anticodon binding domain 99.72
cd0086091 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain 99.59
pfam0312993 HGTP_anticodon Anticodon binding domain. This domain is 99.59
cd0073894 HGTP_anticodon HGTP anticodon binding domain, as found 99.52
cd00858121 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain. 99.43
cd0086194 ProRS_anticodon_short ProRS Prolyl-anticodon binding do 99.22
cd00862202 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding dom 99.11
cd02426128 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DN 98.98
COG0442 500 ProS Prolyl-tRNA synthetase [Translation, ribosomal str 96.16
COG0173585 AspS Aspartyl-tRNA synthetase [Translation, ribosomal s 98.96
cd00775329 LysRS_core Lys_tRNA synthetase (LysRS) class II core do 98.95
PRK00484491 lysS lysyl-tRNA synthetase; Reviewed 98.94
cd00776322 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II c 98.8
TIGR00459653 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 98.7
COG0017435 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation 98.64
pfam00152341 tRNA-synt_2 tRNA synthetases class II (D, K and N). 98.48
pfam01409243 tRNA-synt_2d tRNA synthetases class II core domain (F). 98.45
cd00496218 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) a 98.42
PRK09350325 lysyl-tRNA synthetase; Provisional 98.41
PRK12820706 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl 98.38
PRK06462332 asparagine synthetase A; Reviewed 98.33
PRK12445505 lysyl-tRNA synthetase; Reviewed 98.28
cd00669269 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class I 98.28
KOG1885560 consensus 98.24
PRK05159434 aspC aspartyl-tRNA synthetase; Provisional 98.24
PRK029831099 lysS lysyl-tRNA synthetase; Provisional 98.2
PRK00476587 aspS aspartyl-tRNA synthetase; Validated 98.13
KOG2411628 consensus 98.07
cd00777280 AspRS_core Asp tRNA synthetase (aspRS) class II core do 98.07
PRK03932462 asnC asparaginyl-tRNA synthetase; Validated 97.86
KOG0556533 consensus 97.76
PRK00488338 pheS phenylalanyl-tRNA synthetase subunit alpha; Valida 97.72
cd00769198 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) be 97.44
KOG0554446 consensus 96.49
TIGR00458466 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 96.29
TIGR00457495 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 T 95.74
TIGR00462330 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR0 95.64
TIGR00472848 pheT_bact phenylalanyl-tRNA synthetase, beta subunit; I 91.43
PRK06253527 O-phosphoseryl-tRNA synthetase; Reviewed 98.01
TIGR00470558 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR 95.17
PRK00629786 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewe 96.33
CHL00192702 syfB phenylalanyl-tRNA synthetase beta chain; Provision 96.06
COG0072650 PheT Phenylalanyl-tRNA synthetase beta subunit [Transla 93.51
KOG2784483 consensus 96.26
COG3705390 HisZ ATP phosphoribosyltransferase involved in histidin 95.23
COG2024536 Phenylalanyl-tRNA synthetase alpha subunit (archaeal ty 91.74
>COG0124 HisS Histidyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>CHL00201 syh histidine-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1936 consensus Back     alignment and domain information
>PRK00037 hisS histidyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG1035 consensus Back     alignment and domain information
>PRK12325 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00413 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12304 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK04483 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12305 thrS threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK09194 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK03772 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>PRK12444 threonyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00418 thrS threonyl-tRNA synthetase; InterPro: IPR002320 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK03991 threonyl-tRNA synthetase; Validated Back     alignment and domain information
>COG0441 ThrS Threonyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00389 glyS_dimeric glycyl-tRNA synthetase; InterPro: IPR002315 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK08661 prolyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK04173 glycyl-tRNA synthetase; Provisional Back     alignment and domain information
>COG0423 GRS1 Glycyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2324 consensus Back     alignment and domain information
>KOG1637 consensus Back     alignment and domain information
>TIGR00408 proS_fam_I prolyl-tRNA synthetase; InterPro: IPR004499 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG2298 consensus Back     alignment and domain information
>KOG4163 consensus Back     alignment and domain information
>PRK12420 histidyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12421 ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>TIGR00442 hisS histidyl-tRNA synthetase; InterPro: IPR015807 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00409 proS_fam_II prolyl-tRNA synthetase; InterPro: IPR004500 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK12292 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00443 hisS_second histidyl-tRNA synthetase 2, putative; InterPro: IPR004517 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK12295 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>cd00773 HisRS-like_core Class II Histidinyl-tRNA synthetase (HisRS)-like catalytic core domain Back     alignment and domain information
>PRK12293 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>PRK12294 hisZ ATP phosphoribosyltransferase regulatory subunit; Provisional Back     alignment and domain information
>pfam00587 tRNA-synt_2b tRNA synthetase class II core domain (G, H, P, S and T) Back     alignment and domain information
>cd00779 ProRS_core_prok Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00772 ProRS_core Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00771 ThrRS_core Threonyl-tRNA synthetase (ThrRS) class II core catalytic domain Back     alignment and domain information
>cd00778 ProRS_core_arch_euk Prolyl-tRNA synthetase (ProRS) class II core catalytic domain Back     alignment and domain information
>cd00768 class_II_aaRS-like_core Class II tRNA amino-acyl synthetase-like catalytic core domain Back     alignment and domain information
>cd00670 Gly_His_Pro_Ser_Thr_tRS_core Gly_His_Pro_Ser_Thr_tRNA synthetase class II core domain Back     alignment and domain information
>cd00770 SerRS_core Seryl-tRNA synthetase (SerRS) class II core catalytic domain Back     alignment and domain information
>cd00774 GlyRS-like_core Glycyl-tRNA synthetase (GlyRS)-like class II core catalytic domain Back     alignment and domain information
>PRK09537 pylS pyrolysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR02367 PylS pyrrolysyl-tRNA synthetase; InterPro: IPR012739 PylS is the archaeal enzyme responsible for charging the pyrrolysine tRNA, PylT, by ligating a free molecule of pyrrolysine Back     alignment and domain information
>COG0172 SerS Seryl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05431 seryl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK04172 pheS phenylalanyl-tRNA synthetase subunit alpha; Provisional Back     alignment and domain information
>COG2269 Truncated, possibly inactive, lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG1190 LysU Lysyl-tRNA synthetase (class II) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0016 PheS Phenylalanyl-tRNA synthetase alpha subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PTZ00326 phenylalanyl-tRNA synthetase; Provisional Back     alignment and domain information
>KOG2509 consensus Back     alignment and domain information
>TIGR00414 serS seryl-tRNA synthetase; InterPro: IPR002317 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00468 pheS phenylalanyl-tRNA synthetase, alpha subunit; InterPro: IPR004529 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>cd00859 HisRS_anticodon HisRS Histidyl-anticodon binding domain Back     alignment and domain information
>cd00860 ThrRS_anticodon ThrRS Threonyl-anticodon binding domain Back     alignment and domain information
>pfam03129 HGTP_anticodon Anticodon binding domain Back     alignment and domain information
>cd00738 HGTP_anticodon HGTP anticodon binding domain, as found at the C-terminus of histidyl, glycyl, threonyl and prolyl tRNA synthetases, which are classified as a group of class II aminoacyl-tRNA synthetases (aaRS) Back     alignment and domain information
>cd00858 GlyRS_anticodon GlyRS Glycyl-anticodon binding domain Back     alignment and domain information
>cd00861 ProRS_anticodon_short ProRS Prolyl-anticodon binding domain, short version found predominantly in bacteria Back     alignment and domain information
>cd00862 ProRS_anticodon_zinc ProRS Prolyl-anticodon binding domain, long version found predominantly in eukaryotes and archaea Back     alignment and domain information
>cd02426 Pol_gamma_b_Cterm C-terminal domain of mitochondrial DNA polymerase gamma B subunit, which is required for processivity Back     alignment and domain information
>COG0442 ProS Prolyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG0173 AspS Aspartyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd00775 LysRS_core Lys_tRNA synthetase (LysRS) class II core domain Back     alignment and domain information
>PRK00484 lysS lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00776 AsxRS_core Asx tRNA synthetase (AspRS/AsnRS) class II core domain Back     alignment and domain information
>TIGR00459 aspS_bact aspartyl-tRNA synthetase; InterPro: IPR004524 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0017 AsnS Aspartyl/asparaginyl-tRNA synthetases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>pfam00152 tRNA-synt_2 tRNA synthetases class II (D, K and N) Back     alignment and domain information
>pfam01409 tRNA-synt_2d tRNA synthetases class II core domain (F) Back     alignment and domain information
>cd00496 PheRS_alpha_core Phenylalanyl-tRNA synthetase (PheRS) alpha chain catalytic core domain Back     alignment and domain information
>PRK09350 lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK12820 bifunctional aspartyl-tRNA synthetase/aspartyl/glutamyl-tRNA amidotransferase subunit C; Provisional Back     alignment and domain information
>PRK06462 asparagine synthetase A; Reviewed Back     alignment and domain information
>PRK12445 lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>cd00669 Asp_Lys_Asn_RS_core Asp_Lys_Asn_tRNA synthetase class II core domain Back     alignment and domain information
>KOG1885 consensus Back     alignment and domain information
>PRK05159 aspC aspartyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK02983 lysS lysyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00476 aspS aspartyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG2411 consensus Back     alignment and domain information
>cd00777 AspRS_core Asp tRNA synthetase (aspRS) class II core domain Back     alignment and domain information
>PRK03932 asnC asparaginyl-tRNA synthetase; Validated Back     alignment and domain information
>KOG0556 consensus Back     alignment and domain information
>PRK00488 pheS phenylalanyl-tRNA synthetase subunit alpha; Validated Back     alignment and domain information
>cd00769 PheRS_beta_core Phenylalanyl-tRNA synthetase (PheRS) beta chain core domain Back     alignment and domain information
>KOG0554 consensus Back     alignment and domain information
>TIGR00458 aspS_arch aspartyl-tRNA synthetase; InterPro: IPR004523 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00457 asnS asparaginyl-tRNA synthetase; InterPro: IPR004522 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00462 genX lysyl-tRNA synthetase homolog GenX; InterPro: IPR004525 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00472 pheT_bact phenylalanyl-tRNA synthetase, beta subunit; InterPro: IPR004532 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK06253 O-phosphoseryl-tRNA synthetase; Reviewed Back     alignment and domain information
>TIGR00470 sepS O-phosphoseryl-tRNA(Cys) synthetase; InterPro: IPR005246 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK00629 pheT phenylalanyl-tRNA synthetase subunit beta; Reviewed Back     alignment and domain information
>CHL00192 syfB phenylalanyl-tRNA synthetase beta chain; Provisional Back     alignment and domain information
>COG0072 PheT Phenylalanyl-tRNA synthetase beta subunit [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2784 consensus Back     alignment and domain information
>COG3705 HisZ ATP phosphoribosyltransferase involved in histidine biosynthesis [Amino acid transport and metabolism] Back     alignment and domain information
>COG2024 Phenylalanyl-tRNA synthetase alpha subunit (archaeal type) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target496 histidyl-tRNA synthetase [Candidatus Liberibacter asiat
2el9_A431 Crystal Structure Of E.Coli Histidyl-Trna Synthetas 2e-70
1kmm_A424 Histidyl-Trna Synthetase Complexed With Histidyl-Ad 2e-70
1htt_A423 Histidyl-Trna Synthetase Length = 423 2e-69
1qe0_A420 Crystal Structure Of Apo S. Aureus Histidyl-Trna Sy 9e-62
3net_A465 Crystal Structure Of Histidyl-Trna Synthetase From 5e-61
3hrj_A439 Histidyl-Trna Synthetase From Trypanosoma Cruzi (Hi 9e-55
3hrk_A456 Histidyl-Trna Synthetase From Trypanosoma Cruzi (Hi 1e-54
1adj_A421 Histidyl-Trna Synthetase In Complex With Histidine 2e-54
3hri_A456 Histidyl-Trna Synthetase (Apo) From Trypanosoma Bru 6e-54
1wu7_A434 Crystal Structure Of Histidyl-Trna Synthetase From 1e-48
2i4l_A458 Rhodopseudomonas Palustris Prolyl-Trna Synthetase L 2e-06
3od1_A400 The Crystal Structure Of An Atp Phosphoribosyltrans 2e-25
1z7m_A344 Atp Phosphoribosyl Transferase (Hiszg Atp-Prtase) F 1e-12
1nyq_A645 Structure Of Staphylococcus Aureus Threonyl-Trna Sy 1e-05
1nyq_A645 Structure Of Staphylococcus Aureus Threonyl-Trna Sy 0.002
1evk_A401 Crystal Structure Of A Truncated Form Of Threonyl-T 5e-05
1qf6_A642 Structure Of E. Coli Threonyl-Trna Synthetase Compl 5e-05
2j3l_A572 Prolyl-Trna Synthetase From Enterococcus Faecalis C 0.004
>gi|170292177|pdb|2EL9|A Chain A, Crystal Structure Of E.Coli Histidyl-Trna Synthetase Complexed With A Histidyl-Adenylate Analogue Length = 431 Back     alignment and structure
 Score =  270 bits (691), Expect = 2e-70,   Method: Composition-based stats.
 Identities = 106/476 (22%), Positives = 187/476 (39%), Gaps = 64/476 (13%)

Query: 1   MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFL 60
           M K      +  RG  D    E  I  RI  +++N+  +YG+  I  P++E +    + +
Sbjct: 8   MAKN----IQAIRGMNDYLPGETAIWQRIEGTLKNVLGSYGYSEIRLPIVEQTPLFKRAI 63

Query: 61  PD-EDRPNKGVFSLQDDDGQWISLRYDLTAPLARYVAENFDTIVFPCRTYRIGPVFRNEK 119
            +  D   K +++ +D +G  ++LR + TA   R   E+        R + IGP+FR+E+
Sbjct: 64  GEVTDVVEKEMYTFEDRNGDSLTLRPEGTAGCVRAGIEHGLLYNQEQRLWYIGPMFRHER 123

Query: 120 HGPGRFRQFIQCDVDNVGSSAETADAEMCMMMADTLEAVGIKRN-----DYHIGINNRKI 174
              GR+RQF Q   +  G      DAE+ M+ A    A+GI  +     +    +  R  
Sbjct: 124 PQKGRYRQFHQLGCEVFGLQGPDIDAELIMLTARWWRALGISEHVTLELNSIGSLEARAN 183

Query: 175 LDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDFTKGANLTS 234
               L        +KL+E        D   +     +++L  +     +           
Sbjct: 184 YRDALVAFLEQHKEKLDE--------DCKRRMYTNPLRVLDSKNPEVQA---------LL 226

Query: 235 EQIDIMVSFLSIDLEKSMHELYELVKGTIAGEKGFNELVVISELVRKSGYNSNRIKISST 294
                +  +L  +  +    L +L++           L                      
Sbjct: 227 NDAPALGDYLDEESREHFAGLCKLLESAGIAYTVNQRL---------------------- 264

Query: 295 IVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRFKGQNVPATGFSIG 354
            VRGL+YY   V+E +               G+V  GGRYDGLV +  G+  PA GF++G
Sbjct: 265 -VRGLDYYNRTVFEWVTNS--------LGSQGTVCAGGRYDGLVEQLGGRATPAVGFAMG 315

Query: 355 ISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLRTA--GIRAEMFLG 412
           + RL++ ++++       K    V I  +   +D+ S      + LR    G++     G
Sbjct: 316 LERLVLLVQAVN---PEFKADPVVDIYLVASGADTQSAAMALAERLRDELPGVKLMTNHG 372

Query: 413 SSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIKNNESWRE 468
              NF  Q   AD+    +A++ G  E + G   +KDL  G++ +    +  +   
Sbjct: 373 GG-NFKKQFARADKWGARVAVVLGESEVANGTAVVKDLRSGEQTAVAQDSVAAHLR 427


gi|2781066|pdb|1KMM|A Chain A, Histidyl-Trna Synthetase Complexed With Histidyl-Adenylate Length = 424 Back     alignment and structure
>gi|1942448|pdb|1HTT|A Chain A, Histidyl-Trna Synthetase Length = 423 Back     alignment and structure
>gi|9955267|pdb|1QE0|A Chain A, Crystal Structure Of Apo S. Aureus Histidyl-Trna Synthetase Length = 420 Back     alignment and structure
>gi|302148840|pdb|3NET|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Nostoc Sp. Pcc 7120 Length = 465 Back     alignment and structure
>gi|270047663|pdb|3HRK|A Chain A, Histidyl-Trna Synthetase From Trypanosoma Cruzi (Histidyl- Adenylate Complex) Length = 456 Back     alignment and structure
>gi|2392059|pdb|1ADJ|A Chain A, Histidyl-Trna Synthetase In Complex With Histidine Length = 421 Back     alignment and structure
>gi|270047656|pdb|3HRI|A Chain A, Histidyl-Trna Synthetase (Apo) From Trypanosoma Brucei Length = 456 Back     alignment and structure
>gi|83753553|pdb|1WU7|A Chain A, Crystal Structure Of Histidyl-Trna Synthetase From Thermoplasma Acidophilum Length = 434 Back     alignment and structure
>gi|118138193|pdb|2I4L|A Chain A, Rhodopseudomonas Palustris Prolyl-Trna Synthetase Length = 458 Back     alignment and structure
>gi|304446078|pdb|3OD1|A Chain A, The Crystal Structure Of An Atp Phosphoribosyltransferase Regulatory SubunitHISTIDYL-Trna Synthetase From Bacillus Halodurans C Length = 400 Back     alignment and structure
>gi|75765683|pdb|1Z7M|A Chain A, Atp Phosphoribosyl Transferase (Hiszg Atp-Prtase) From Lactococcus Lactis Length = 344 Back     alignment and structure
gi|38492559|pdb|1NYQ|A Chain A, Structure Of Staphylococcus Aureus Threonyl-Trna Synthetase Complexed With An Analogue Of Threonyl Adenylate Length = 645 Back     alignment and structure
gi|38492559|pdb|1NYQ|A Chain A, Structure Of Staphylococcus Aureus Threonyl-Trna Synthetase Complexed With An Analogue Of Threonyl Adenylate Length = 645 Back     alignment and structure
>gi|9955215|pdb|1EVK|A Chain A, Crystal Structure Of A Truncated Form Of Threonyl-Trna Synthetase With The Ligand Threonine Length = 401 Back     alignment and structure
gi|5107656|pdb|1QF6|A Chain A, Structure Of E. Coli Threonyl-Trna Synthetase Complexed With Its Cognate Trna Length = 642 Back     alignment and structure
gi|118138617|pdb|2J3L|A Chain A, Prolyl-Trna Synthetase From Enterococcus Faecalis Complexed With A Prolyl-Adenylate Analogue ('5'-O-(N-(L-Prolyl)- Sulfamoyl)adenosine) Length = 572 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target496 histidyl-tRNA synthetase [Candidatus Liberibacter asiat
3net_A465 Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, li 3e-77
3lc0_A456 Histidyl-tRNA synthetase; tRNA-ligase, aminoacyl-tRNA s 2e-75
1qe0_A420 Histidyl-tRNA synthetase; class II tRNA synthetase, bet 2e-62
1h4v_B421 Histidyl-tRNA synthetase; class IIA aminoacyl-tRNA synt 2e-49
1htt_A423 Histidyl-tRNA synthetase; complex (tRNA synthetase/His- 1e-48
1wu7_A434 Histidyl-tRNA synthetase; ligase, structural genomics, 3e-44
2i4l_A458 Proline-tRNA ligase; alpha beta; 2.00A {Rhodopseudomona 1e-05
3od1_A400 ATP phosphoribosyltransferase regulatory subunit; struc 9e-64
1z7m_A344 ATP phosphoribosyltransferase regulatory subunit; ATP-P 7e-42
1usy_A275 ATP phosphoribosyltransferase regulatory subunit; amino 6e-36
3ial_A518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 5e-18
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, zinc 2e-16
2zin_A291 Pyrrolysyl-tRNA synthetase; aminoacyl-tRNA synthetase, 3e-16
3dsq_A288 Pyrrolysyl-tRNA synthetase; homodimer, aminoacyl-tRNA s 2e-13
1hc7_A477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 8e-07
1qf6_A642 THRRS, threonyl-tRNA synthetase; tRNA(Thr), AMP, zinc, 1e-06
1nj8_A459 Proline-tRNA synthetase, proline--tRNA ligase; class-II 4e-06
1nyr_A645 Threonyl-tRNA synthetase 1; ATP, threonine, ligase; HET 6e-06
3a5y_A345 GENX, putative lysyl-tRNA synthetase; aminoacyl-tRNA sy 7e-06
1nnh_A294 Asparaginyl-tRNA synthetase-related peptide; structural 8e-06
1e1o_A504 Lysyl-tRNA synthetase; ligase, aminoacyl-tRNA synthetas 2e-05
1eov_A487 ASPRS, aspartyl-tRNA synthetase; aminoacyl tRNA synthet 1e-04
1l0w_A580 Aspartyl-tRNA synthetase; space-grown crystal, dimeric 2e-04
3e9h_A493 Lysyl-tRNA synthetase; aminoacyl tRNA synthetase, ligas 6e-04
1nj1_A501 Proline-tRNA synthetase, proline--tRNA ligase; protein- 6e-04
3g1z_A326 Putative lysyl-tRNA synthetase; drug target, nucleotide 0.001
3a32_A471 Probable threonyl-tRNA synthetase 1; aeropyrum pernix K 0.003
3ial_A518 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, tRNA 2e-10
1evl_A401 Threonyl-tRNA synthetase; amino acid recognition, zinc 1e-10
1hc7_A477 Prolyl-tRNA synthetase; aminoacyl-tRNA synthetase, ATP 0.003
1c0a_A585 Aspartyl tRNA synthetase; protein-RNA complex; HET: 4SU 4e-05
2j3l_A572 Prolyl-tRNA synthetase; class II aminoacyl- tRNA synthe 1e-04
3mf2_A346 BLL0957 protein; aminoacyl-tRNA synthetase, seryl-tRNA 0.003
>3net_A Histidyl-tRNA synthetase; aminoacyl-tRNA synthetase, ligase, structural genomics, PSI- nostoc, protein structure initiative; 2.70A {Nostoc SP} Length = 465 Back     alignment and structure
 Score =  284 bits (728), Expect = 3e-77
 Identities = 147/508 (28%), Positives = 221/508 (43%), Gaps = 66/508 (12%)

Query: 1   MGKKTKLRAELPRGFADCPTKEIRIRNRILDSIRNIYENYGFDPIETPLLEYSDSLGKFL 60
           M K  K+    P GF +    E R+   +LD+IR +YE+YGF PIETP +E  + L    
Sbjct: 4   MAKNDKINFSTPSGFPEFLPSEKRLELYLLDTIRRVYESYGFTPIETPAVERLEVLQAKG 63

Query: 61  PDEDRPNKGVFSLQ------------DDDGQWISLRYDLTAPLARYVAENFDTIVFPCRT 108
              D    G+  +             D   +  +L++D T PLA Y+A + + + FP   
Sbjct: 64  NQGDNIIYGLEPILPPNRQAEKDKSGDTGSEARALKFDQTVPLAAYIARHLNDLTFPFAR 123

Query: 109 YRIGPVFRNEKHGPGRFRQFIQCDVDNVGSSA--ETADAEMCMMMADTLEAVGIKRNDYH 166
           Y++  VFR E+   GRFRQF QCD+D VG        DA+M  ++ +  EAV I   D+ 
Sbjct: 124 YQMDVVFRGERAKDGRFRQFRQCDIDVVGREKLSLLYDAQMPAIITEIFEAVNIG--DFV 181

Query: 167 IGINNRKILDGILEKIGLHGDDKLNERLIVLRAIDKLDKFGLQGVKLLLGEGRTDNSGDF 226
           I INNRK+L G  + + +      +     +  ID L+K G   VKL L           
Sbjct: 182 IRINNRKVLTGFFQSLNISETQIKSC----ISIIDNLEKIGEAKVKLEL----------- 226

Query: 227 TKGANLTSEQIDIMVSFLSI-----DLEKSMHELYELVKGTIAGEKGFNELVVISELVRK 281
            +   +  EQ   ++ F+ I     D+   +  L + +  +     G +EL  +   VR 
Sbjct: 227 -EKEGINPEQTQKIIDFVKIDGSVDDVLDKLKHLSQTLPESEQFNLGVSELETVITGVRN 285

Query: 282 SGYNSNRIKISSTIVRGLEYYTGCVYEAILGFPVMNEKQKPVVFGSVGGGGRYDGLVSRF 341
            G    R  I   I RGL YYTG VYE  L              GS+  GGRY+ LV  F
Sbjct: 286 LGVPDKRFCIDLAIARGLNYYTGTVYETTLI--------GHEALGSICSGGRYEELVGTF 337

Query: 342 KGQNVPATGFSIGISRLIVALKSLESSTNNIKEMGPVLITTMDHDSDSLSKYQMYTQMLR 401
            G+ +P  G SIG++RLI  L               V++  M    + +  Y   +Q LR
Sbjct: 338 IGEKMPGVGISIGLTRLISRLLKAGILNTLPPTPAQVVVVNM--QDELMPTYLKVSQQLR 395

Query: 402 TAGIRAEMFLGSSKNFGNQLKYADRRNCPLAIIQGTGERSRGMLQIKDLAKGKELSREIK 461
            AG+         +  G Q + AD++     +I G  E +     +KDL  G+       
Sbjct: 396 QAGLNVITNFE-KRQLGKQFQAADKQGIRFCVIIGADEAAAQKSSLKDLQSGE------- 447

Query: 462 NNESWREARVAQITIPISELVSTVKKIL 489
                      Q+ + +++L   +K+ L
Sbjct: 448 -----------QVEVALADLAEEIKRRL 464