254780927

254780927

UDP-N-acetylglucosamine 1-carboxyvinyltransferase

GeneID in NCBI database:8209948Locus tag:CLIBASIA_04130
Protein GI in NCBI database:254780927Protein Accession:YP_003065340.1
Gene range:+(911856, 913148)Protein Length:430aa
Gene description:UDP-N-acetylglucosamine 1-carboxyvinyltransferase
COG prediction:[M] UDP-N-acetylglucosamine enolpyruvyl transferase
KEGG prediction:UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7); K00790 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
SEED prediction:UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC 2.5.1.7)
Pathway involved in KEGG:Amino sugar and nucleotide sugar metabolism [PATH:las00520]
Peptidoglycan biosynthesis [PATH:las00550]
Subsystem involved in SEED:UDP-N-acetylmuramate from Fructose-6-phosphate Biosynthesis;
Peptidoglycan Biosynthesis
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED5 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
ccEEEEccccEEEEEEEccccHHHHHHHHHHHHcccccEEEEccccHHHHHHHHHHHHHcccEEEEcccccEEEcccccEEEEccHHHcccccHHHHHHHHHHHHHHHHHHHHccccEEEEEccccccccccHHHHHHHHHHcccEEEEEccEEEEEEEccccccEEEEEccccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHcccEEEEccccEEEEEcccccccccEEEccccHHHHHHHHHHHccccEEEEcccccHHHHHHHHHHHHcccEEEEEccEEEEEEccccccEEEEccccccccccHHHHHHHHHHHHcccEEEEEEEEcccHHHHHHHHHHcccEEEEEccEEEEEccccccccEEEcccHHHHHHHHHHHHHccccEEEEcccccccccHHHHHHHHHcccEEEEEcc
ccEEEEEEccccEEEEEccEcHHHHHHHHHHHHHEcccEEEEcccccHHHHHHHHHHHHcccEEEEcccEEcccccccccEEEEcccccccEccHHHHccccHHHHHHHHHHHHHcEEEEEccccccccccccHHHHHHHHHcccEEEEEccEEEEEccccccEccEEEcccccHHHHHHHHHHHcccEcEEEEEcccccHHHHHHHHHHHHcccEEEcccccEEEEEccccEccEEEEccEcHHHHHHHHHHHHccccEEEEEcccHHHcHHHHHHHHHcccEEEEcccEEEEEccccccEcccEEEcccccccHHHHHHHHHHHHccEcEEEEEEcccccccccHHHHHccccEEEEEccEEEEEcccccEccEEEcccHHHHHHHHHHHHHcEEEEEEEccHHHHHHcccHHHHHHccccEEEEEcc
mdrikiiggnklngtiaisgaknasLPVMIASLLTsetltlenipdladVKLLIRILRSHGVeilsdssyndqnksysstmhfrCRHIVDLTGSYDLVSKMRASFWVIgpllaregyarislpggcaigtrpvDLFVDSLKSLGVVIKIDGGYvdarvsskglrgtsytfpkvsvGATQVMMMVASLShgdtsiynaarepevVDLAHCLNSMgakisgmgsstitiqgvtslsgtrhrilpdrieAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQtgvdidiidegirvrwngeklrpvdvitapfpgfptdLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGArislsgqtarvegvqglrgapvmatDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
mdrikiiggnklngtiAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHgveilsdssyndQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDArvsskglrgtsytfpKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGvtslsgtrhrILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMrqtgvdidiidegirvrwngeklrpvdVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLekklsrcgaliqrikg
MDRIKIIGGNKLNGTIAISGAKNASLPVMIAslltsetltleNIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFmammccaaGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRasvslviaalaaQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG
MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRILPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSRCGALIQRIKG

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
315122646428 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand 1 0.0
218675260430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhiz 1 0.0
190890280430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhiz 1 0.0
116250383430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhiz 1 0.0
86356231430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhiz 1 0.0
241203019430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhiz 1 0.0
209547846430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhiz 1 0.0
222147507430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Agro 1 0.0
15887887430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Agro 1 1e-178
325291929430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Agro 1 1e-177
>gi|315122646|ref|YP_004063135.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 428 Back     alignment and organism information
 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/430 (88%), Positives = 401/430 (93%), Gaps = 2/430 (0%)

Query: 1   MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSH 60
           MDRIKIIGGN+L G I ISGAKNASLPVMIASLLTSE LTLENIP+LADVKLL+RILRSH
Sbjct: 1   MDRIKIIGGNELKGIIPISGAKNASLPVMIASLLTSEKLTLENIPNLADVKLLMRILRSH 60

Query: 61  GVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARI 120
           GVEI  D    DQ++ YSSTMHFRCR+IVDLTGSYDL+SKMRASFW+IGPLLAREGYARI
Sbjct: 61  GVEISVDG--QDQDQDYSSTMHFRCRNIVDLTGSYDLISKMRASFWIIGPLLAREGYARI 118

Query: 121 SLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQV 180
           SLPGGCAIG RPVDLFVDSLK+LGV I++DGGYVDARVS+KGL GT YTFPKVSVGATQV
Sbjct: 119 SLPGGCAIGIRPVDLFVDSLKALGVTIELDGGYVDARVSNKGLIGTDYTFPKVSVGATQV 178

Query: 181 MMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI 240
           MMMVASLSHGDTSI NAAREPEVVDLAHCLNSMGAKISGMGSSTITI+GVTSLSG RHRI
Sbjct: 179 MMMVASLSHGDTSINNAAREPEVVDLAHCLNSMGAKISGMGSSTITIEGVTSLSGARHRI 238

Query: 241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEK 300
           LPDRIEAGTYAMAVAMTGGDVILKMTDS LL+TVFKVMRQTGVDI I+DEGI VRW+GEK
Sbjct: 239 LPDRIEAGTYAMAVAMTGGDVILKMTDSFLLETVFKVMRQTGVDISIVDEGICVRWDGEK 298

Query: 301 LRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLS 360
           LRPVD+ TAPFPGFPTDLQAQFMAMMCCA G+SHITETIFENRFMHVQEL RLGA+I LS
Sbjct: 299 LRPVDITTAPFPGFPTDLQAQFMAMMCCAGGVSHITETIFENRFMHVQELARLGAKIFLS 358

Query: 361 GQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSR 420
           GQTARVEGV  LRGAPVMATDLRASVSLVIAALA+QGETEISRVYHLDRGFE LEKKL R
Sbjct: 359 GQTARVEGVDVLRGAPVMATDLRASVSLVIAALASQGETEISRVYHLDRGFESLEKKLRR 418

Query: 421 CGALIQRIKG 430
           CGALI+R+ G
Sbjct: 419 CGALIERVSG 428


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|218675260|ref|ZP_03524929.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhizobium etli GR56] Length = 430 Back     alignment and organism information
>gi|190890280|ref|YP_001976822.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhizobium etli CIAT 652] Length = 430 Back     alignment and organism information
>gi|116250383|ref|YP_766221.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhizobium leguminosarum bv. viciae 3841] Length = 430 Back     alignment and organism information
>gi|86356231|ref|YP_468123.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhizobium etli CFN 42] Length = 430 Back     alignment and organism information
>gi|241203019|ref|YP_002974115.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 430 Back     alignment and organism information
>gi|209547846|ref|YP_002279763.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 430 Back     alignment and organism information
>gi|222147507|ref|YP_002548464.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Agrobacterium vitis S4] Length = 430 Back     alignment and organism information
>gi|15887887|ref|NP_353568.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Agrobacterium tumefaciens str. C58] Length = 430 Back     alignment and organism information
>gi|325291929|ref|YP_004277793.1| UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Agrobacterium sp. H13-3] Length = 430 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
PRK09369417 PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvi 0.0
TIGR01072416 TIGR01072, murA, UDP-N-acetylglucosamine 1-carboxyvinyl 1e-154
cd01555400 cd01555, UdpNAET, UDP-N-acetylglucosamine enolpyruvyl t 1e-152
PRK12830417 PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvi 1e-120
pfam00275415 pfam00275, EPSP_synthase, EPSP synthase (3-phosphoshiki 3e-84
cd01554408 cd01554, EPT-like, Enol pyruvate transferases family in 1e-67
cd01556409 cd01556, EPSP_synthase, EPSP synthase domain 4e-22
COG0128428 COG0128, AroA, 5-enolpyruvylshikimate-3-phosphate synth 1e-17
TIGR01356409 TIGR01356, aroA, 3-phosphoshikimate 1-carboxyvinyltrans 2e-12
PRK02427435 PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltr 3e-08
COG0766421 COG0766, MurA, UDP-N-acetylglucosamine enolpyruvyl tran 1e-166
cd01553211 cd01553, EPT_RTPC-like, This domain family includes the 1e-07
TIGR01356409 TIGR01356, aroA, 3-phosphoshikimate 1-carboxyvinyltrans 2e-05
>gnl|CDD|181804 PRK09369, PRK09369, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated Back     alignment and domain information
>gnl|CDD|162190 TIGR01072, murA, UDP-N-acetylglucosamine 1-carboxyvinyltransferase Back     alignment and domain information
>gnl|CDD|30128 cd01555, UdpNAET, UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information
>gnl|CDD|183779 PRK12830, PRK12830, UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed Back     alignment and domain information
>gnl|CDD|144020 pfam00275, EPSP_synthase, EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) Back     alignment and domain information
>gnl|CDD|30127 cd01554, EPT-like, Enol pyruvate transferases family includes EPSP synthases and UDP-N-acetylglucosamine enolpyruvyl transferase Back     alignment and domain information
>gnl|CDD|30129 cd01556, EPSP_synthase, EPSP synthase domain Back     alignment and domain information
>gnl|CDD|30477 COG0128, AroA, 5-enolpyruvylshikimate-3-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|162316 TIGR01356, aroA, 3-phosphoshikimate 1-carboxyvinyltransferase Back     alignment and domain information
>gnl|CDD|179423 PRK02427, PRK02427, 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>gnl|CDD|31109 COG0766, MurA, UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|73274 cd01553, EPT_RTPC-like, This domain family includes the Enolpyruvate transferase (EPT) family and the RNA 3' phosphate cyclase family (RTPC) Back     alignment and domain information
>gnl|CDD|162316 TIGR01356, aroA, 3-phosphoshikimate 1-carboxyvinyltransferase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
PRK09369417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Vali 100.0
TIGR01072443 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; 100.0
PRK12830417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Revi 100.0
cd01555400 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase 100.0
COG0766421 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [C 100.0
TIGR01356444 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; Inte 100.0
PRK11860 662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 100.0
PRK02427424 3-phosphoshikimate 1-carboxyvinyltransferase; Provision 100.0
COG0128428 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino 100.0
cd01554408 EPT-like Enol pyruvate transferases family includes EPS 100.0
cd01556409 EPSP_synthase EPSP synthase domain. 3-phosphoshikimate 100.0
PRK11861673 bifunctional prephenate dehydrogenase/3-phosphoshikimat 100.0
pfam00275415 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carbo 100.0
KOG0692595 consensus 100.0
PRK09369417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Vali 99.88
cd01556409 EPSP_synthase EPSP synthase domain. 3-phosphoshikimate 99.87
cd01555400 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase 99.86
TIGR01356444 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; Inte 99.86
cd01554408 EPT-like Enol pyruvate transferases family includes EPS 99.85
COG0128428 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino 99.84
TIGR01072443 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; 99.83
PRK02427424 3-phosphoshikimate 1-carboxyvinyltransferase; Provision 99.83
pfam00275415 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carbo 99.8
COG0766421 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [C 99.78
PRK11861673 bifunctional prephenate dehydrogenase/3-phosphoshikimat 99.77
KOG0692 595 consensus 97.79
PRK12830417 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Revi 99.86
PRK11860 662 bifunctional 3-phosphoshikimate 1-carboxyvinyltransfera 99.83
cd01553211 EPT_RTPC-like This domain family includes the Enolpyruv 98.94
TIGR03399326 RNA_3prim_cycl RNA 3'-phosphate cyclase. Members of thi 97.05
TIGR03400360 18S_RNA_Rcl1p 18S rRNA biogenesis protein RCL1. Members 96.9
LOAD_rna_Cyc329 consensus 96.57
PRK04204339 RNA 3'-terminal-phosphate cyclase; Provisional 95.23
cd00875341 RNA_Cyclase_Class_I RNA 3' phosphate cyclase domain (cl 95.03
pfam01137330 RTC RNA 3'-terminal phosphate cyclase. RNA cyclases are 93.89
cd00874326 RNA_Cyclase_Class_II RNA 3' phosphate cyclase domain (c 93.63
cd00295338 RNA_Cyclase RNA 3' phosphate cyclase domain - RNA phosp 91.39
cd01553211 EPT_RTPC-like This domain family includes the Enolpyruv 96.97
TIGR03400360 18S_RNA_Rcl1p 18S rRNA biogenesis protein RCL1. Members 94.76
pfam01137330 RTC RNA 3'-terminal phosphate cyclase. RNA cyclases are 93.89
PRK04204339 RNA 3'-terminal-phosphate cyclase; Provisional 93.65
cd00875341 RNA_Cyclase_Class_I RNA 3' phosphate cyclase domain (cl 93.16
COG0430341 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing 95.56
COG0430341 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing 93.82
>PRK09369 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated Back     alignment and domain information
>TIGR01072 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; InterPro: IPR005750 The bacterial enzyme UDP-N-acetylglucosamine (UDP-GlcNAc) enolpyruvyltransferase (MurA) catalyzes the transfer of enolpyruvate from phosphoenolpyruvate to uridine diphospho-N-acetylglucosamine, which is the first committed step of bacterial cell wall biosynthesis Back     alignment and domain information
>PRK12830 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed Back     alignment and domain information
>cd01555 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information
>COG0766 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01356 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; InterPro: IPR006264 These sequences represent 5-enolpyruvyl shikimate-3-phosphate synthase (EPSP_synthase) (3-phosphoshikimate-1-carboxyvinyltransferase,aroA), which catalyzes the sixth of seven steps in the shikimate pathway of the biosynthesis of chorimate Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>PRK02427 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>COG0128 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01554 EPT-like Enol pyruvate transferases family includes EPSP synthases and UDP-N-acetylglucosamine enolpyruvyl transferase Back     alignment and domain information
>cd01556 EPSP_synthase EPSP synthase domain Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>pfam00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) Back     alignment and domain information
>KOG0692 consensus Back     alignment and domain information
>PRK09369 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Validated Back     alignment and domain information
>cd01556 EPSP_synthase EPSP synthase domain Back     alignment and domain information
>cd01555 UdpNAET UDP-N-acetylglucosamine enolpyruvyl transferase catalyzes enolpyruvyl transfer as part of the first step in the biosynthesis of peptidoglycan, a component of the bacterial cell wall Back     alignment and domain information
>TIGR01356 aroA 3-phosphoshikimate 1-carboxyvinyltransferase; InterPro: IPR006264 These sequences represent 5-enolpyruvyl shikimate-3-phosphate synthase (EPSP_synthase) (3-phosphoshikimate-1-carboxyvinyltransferase,aroA), which catalyzes the sixth of seven steps in the shikimate pathway of the biosynthesis of chorimate Back     alignment and domain information
>cd01554 EPT-like Enol pyruvate transferases family includes EPSP synthases and UDP-N-acetylglucosamine enolpyruvyl transferase Back     alignment and domain information
>COG0128 AroA 5-enolpyruvylshikimate-3-phosphate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01072 murA UDP-N-acetylglucosamine 1-carboxyvinyltransferase; InterPro: IPR005750 The bacterial enzyme UDP-N-acetylglucosamine (UDP-GlcNAc) enolpyruvyltransferase (MurA) catalyzes the transfer of enolpyruvate from phosphoenolpyruvate to uridine diphospho-N-acetylglucosamine, which is the first committed step of bacterial cell wall biosynthesis Back     alignment and domain information
>PRK02427 3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>pfam00275 EPSP_synthase EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) Back     alignment and domain information
>COG0766 MurA UDP-N-acetylglucosamine enolpyruvyl transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11861 bifunctional prephenate dehydrogenase/3-phosphoshikimate 1-carboxyvinyltransferase; Provisional Back     alignment and domain information
>KOG0692 consensus Back     alignment and domain information
>PRK12830 UDP-N-acetylglucosamine 1-carboxyvinyltransferase; Reviewed Back     alignment and domain information
>PRK11860 bifunctional 3-phosphoshikimate 1-carboxyvinyltransferase/cytidine monophosphate kinase; Provisional Back     alignment and domain information
>cd01553 EPT_RTPC-like This domain family includes the Enolpyruvate transferase (EPT) family and the RNA 3' phosphate cyclase family (RTPC) Back     alignment and domain information
>TIGR03399 RNA_3prim_cycl RNA 3'-phosphate cyclase Back     alignment and domain information
>TIGR03400 18S_RNA_Rcl1p 18S rRNA biogenesis protein RCL1 Back     alignment and domain information
>LOAD_rna_Cyc consensus Back     alignment and domain information
>PRK04204 RNA 3'-terminal-phosphate cyclase; Provisional Back     alignment and domain information
>cd00875 RNA_Cyclase_Class_I RNA 3' phosphate cyclase domain (class I) This subfamily of cyclase-like proteins are encoded in eukaryotic genomes Back     alignment and domain information
>pfam01137 RTC RNA 3'-terminal phosphate cyclase Back     alignment and domain information
>cd00874 RNA_Cyclase_Class_II RNA 3' phosphate cyclase domain (class II) Back     alignment and domain information
>cd00295 RNA_Cyclase RNA 3' phosphate cyclase domain - RNA phosphate cyclases are enzymes that catalyze the ATP-dependent conversion of 3'-phosphate at the end of RNA into 2', 3'-cyclic phosphodiester bond Back     alignment and domain information
>cd01553 EPT_RTPC-like This domain family includes the Enolpyruvate transferase (EPT) family and the RNA 3' phosphate cyclase family (RTPC) Back     alignment and domain information
>TIGR03400 18S_RNA_Rcl1p 18S rRNA biogenesis protein RCL1 Back     alignment and domain information
>pfam01137 RTC RNA 3'-terminal phosphate cyclase Back     alignment and domain information
>PRK04204 RNA 3'-terminal-phosphate cyclase; Provisional Back     alignment and domain information
>cd00875 RNA_Cyclase_Class_I RNA 3' phosphate cyclase domain (class I) This subfamily of cyclase-like proteins are encoded in eukaryotic genomes Back     alignment and domain information
>COG0430 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing and modification] Back     alignment and domain information
>COG0430 RCL1 RNA 3'-terminal phosphate cyclase [RNA processing and modification] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

IdentityAlignment graphLength Definition E-value
Target430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
1ryw_A419 C115s Mura Liganded With Reaction Products Length = 3e-86
1ejc_A419 Crystal Structure Of Unliganded Mura (Type2) Length 3e-86
3kqa_A419 Mura Dead-End Complex With Terreic Acid Length = 41 4e-86
1q3g_A419 Mura (Asp305ala) Liganded With Tetrahedral Reaction 4e-86
1naw_A419 Enolpyruvyl Transferase Length = 419 7e-86
1dlg_A419 Crystal Structure Of The C115s Enterobacter Cloacae 1e-85
2z2c_A423 Mura Inhibited By Unag-Cnicin Adduct Length = 423 1e-85
3kqj_A419 Mura Binary Complex With Udp-N-Acetylglucosamine Le 2e-85
3iss_A418 Crystal Structure Of Enolpyruvyl-Udp-Glcnac Synthas 2e-85
3kr6_A419 Mura Dead-End Complex With Fosfomycin Length = 419 2e-85
1uae_A419 Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Tr 3e-85
1a2n_A419 Structure Of The C115a Mutant Of Mura Complexed Wit 4e-85
2rl1_A424 Crystal Structure Of Udp-N-Acetylglucosamine Enolpy 2e-81
2yvw_A425 Crystal Structure Of Udp-N-Acetylglucosamine 1- Car 7e-69
3r38_A454 2.23 Angstrom Resolution Crystal Structure Of Udp-N 4e-57
1rf4_A427 Structural Studies Of Streptococcus Pneumoniae Epsp 4e-45
2pqd_A445 A100g Cp4 Epsps Liganded With (R)-Difluoromethyl Te 5e-44
2pqb_A445 Cp4 Epsps Liganded With (R)-Difluoromethyl Tetrahed 6e-44
2ggd_A455 Cp4 Epsp Synthase Ala100gly Liganded With S3p And G 7e-44
2gg4_A455 Cp4 Epsp Synthase (Unliganded) Length = 455 8e-44
3nvs_A450 1.02 Angstrom Resolution Crystal Structure Of 3-Pho 4e-35
1mi4_A427 Glyphosate Insensitive G96a Mutant Epsp Synthase Li 1e-34
1g6s_A427 Structure Of Epsp Synthase Liganded With Shikimate- 2e-34
2qfs_A427 E.Coli Epsp Synthase Pro101ser Liganded With S3p Le 2e-34
2qfq_A427 E. Coli Epsp Synthase Pro101leu Liganded With S3p L 2e-34
3fjx_A427 E. Coli Epsp Synthase (T97i) Liganded With S3p Leng 2e-34
3fk0_A427 E. Coli Epsp Synthase (Tips Mutation) Liganded With 3e-34
1q36_A427 Epsp Synthase (Asp313ala) Liganded With Tetrahedral 3e-34
1eps_A427 Structure And Topological Symmetry Of The Glyphosph 7e-33
2bjb_A462 Mycobacterium Tuberculosis Epsp Synthase In Unligan 1e-16
2o0b_A450 Mycobacterium Tuberculosis Epsp Synthase In Complex 2e-16
1p88_A216 Substrate-Induced Structural Changes To The Isolate 1e-05
>gi|282403807|pdb|1RYW|A Chain A, C115s Mura Liganded With Reaction Products Length = 419 Back     alignment and structure
 Score =  323 bits (828), Expect = 3e-86,   Method: Composition-based stats.
 Identities = 195/430 (45%), Positives = 272/430 (63%), Gaps = 12/430 (2%)

Query: 1   MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSH 60
           MD+ ++ G  +L G + ISGAKNA+LP++ A+LL  E + ++N+P L D+   +++L   
Sbjct: 1   MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQL 60

Query: 61  GVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARI 120
           G ++  D S           +     ++ + +  YDLV  MRAS W +GPL+AR G  ++
Sbjct: 61  GTKVERDGS-----------VWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQV 109

Query: 121 SLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQV 180
           SLPGG AIG RPVDL +  L+ LG  IK++ GYV A V+ +          KVSVGAT  
Sbjct: 110 SLPGGSAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNGRLKGAHIVM-DKVSVGATVT 168

Query: 181 MMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI 240
           +M  A+L+ G T I NAAREPE+VD A+ L ++GAKISG G+  ITI+GV  L G  +R+
Sbjct: 169 IMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRV 228

Query: 241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEK 300
           LPDRIE GT+ +A A++GG ++ +      L  V   +R+ G DI+  ++ I +  +G++
Sbjct: 229 LPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKR 288

Query: 301 LRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLS 360
            + V V TAP P FPTD+QAQF  +   A G   ITETIFENRFMHV EL+R+GA   + 
Sbjct: 289 PKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIE 348

Query: 361 GQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSR 420
             T    GV+ L GA VMATDLRAS SLV+A   A+G T + R+YH+DRG+E +E KL  
Sbjct: 349 SNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRA 408

Query: 421 CGALIQRIKG 430
            GA I+R+KG
Sbjct: 409 LGANIERVKG 418


>gi|282403785|pdb|1EJC|A Chain A, Crystal Structure Of Unliganded Mura (Type2) Length = 419 Back     alignment and structure
>gi|295321799|pdb|3KQA|A Chain A, Mura Dead-End Complex With Terreic Acid Length = 419 Back     alignment and structure
>gi|282403791|pdb|1Q3G|A Chain A, Mura (Asp305ala) Liganded With Tetrahedral Reaction Intermediate Length = 419 Back     alignment and structure
gi|2392464|pdb|1NAW|A Chain A, Enolpyruvyl Transferase Length = 419 Back     alignment and structure
>gi|325534097|pdb|1DLG|A Chain A, Crystal Structure Of The C115s Enterobacter Cloacae Mura In The Un- Liganded State Length = 419 Back     alignment and structure
>gi|282403821|pdb|2Z2C|A Chain A, Mura Inhibited By Unag-Cnicin Adduct Length = 423 Back     alignment and structure
>gi|295321803|pdb|3KQJ|A Chain A, Mura Binary Complex With Udp-N-Acetylglucosamine Length = 419 Back     alignment and structure
>gi|282403825|pdb|3ISS|A Chain A, Crystal Structure Of Enolpyruvyl-Udp-Glcnac Synthase (Mura) :udp-N-Acetylmuramic Acid:phosphite From Escherichia Coli Length = 418 Back     alignment and structure
>gi|295321804|pdb|3KR6|A Chain A, Mura Dead-End Complex With Fosfomycin Length = 419 Back     alignment and structure
gi|157834054|pdb|1UAE|A Chain A, Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Transferase Length = 419 Back     alignment and structure
>gi|157829656|pdb|1A2N|A Chain A, Structure Of The C115a Mutant Of Mura Complexed With The Fluorinated Analog Of The Reaction Tetrahedral Intermediate Length = 419 Back     alignment and structure
gi|170785034|pdb|2RL1|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Transferase From Haemophilus Influenzae In Complex With Udp-N-Acetylglucosamine Length = 424 Back     alignment and structure
gi|158431289|pdb|2YVW|A Chain A, Crystal Structure Of Udp-N-Acetylglucosamine 1- Carboxyvinyltransferase From Aquifex Aeolicus Vf5 Length = 425 Back     alignment and structure
>gi|326634644|pdb|3R38|A Chain A, 2.23 Angstrom Resolution Crystal Structure Of Udp-N-Acetylglucosamine 1-Carboxyvinyltransferase (Mura) From Listeria Monocytogenes Egd-E Length = 454 Back     alignment and structure
>gi|46015460|pdb|1RF4|A Chain A, Structural Studies Of Streptococcus Pneumoniae Epsp Synthase, Tetrahedral Intermediate Bound State Length = 427 Back     alignment and structure
>gi|169791695|pdb|2PQD|A Chain A, A100g Cp4 Epsps Liganded With (R)-Difluoromethyl Tetrahedral Reaction Intermediate Analog Length = 445 Back     alignment and structure
>gi|169791693|pdb|2PQB|A Chain A, Cp4 Epsps Liganded With (R)-Difluoromethyl Tetrahedral Intermediate Analog Length = 445 Back     alignment and structure
>gi|114794061|pdb|2GGD|A Chain A, Cp4 Epsp Synthase Ala100gly Liganded With S3p And Glyphosate Length = 455 Back     alignment and structure
gi|114794058|pdb|2GG4|A Chain A, Cp4 Epsp Synthase (Unliganded) Length = 455 Back     alignment and structure
>gi|301016109|pdb|3NVS|A Chain A, 1.02 Angstrom Resolution Crystal Structure Of 3-Phosphoshikimate 1- Carboxyvinyltransferase From Vibrio Cholerae In Complex With Shikimate-3-Phosphate (Partially Photolyzed) And Glyphosate Length = 450 Back     alignment and structure
>gi|27573942|pdb|1MI4|A Chain A, Glyphosate Insensitive G96a Mutant Epsp Synthase Liganded With Shikimate-3-Phosphate Length = 427 Back     alignment and structure
gi|13096161|pdb|1G6S|A Chain A, Structure Of Epsp Synthase Liganded With Shikimate-3- Phosphate And Glyphosate Length = 427 Back     alignment and structure
>gi|158430187|pdb|2QFS|A Chain A, E.Coli Epsp Synthase Pro101ser Liganded With S3p Length = 427 Back     alignment and structure
>gi|158430186|pdb|2QFQ|A Chain A, E. Coli Epsp Synthase Pro101leu Liganded With S3p Length = 427 Back     alignment and structure
>gi|223674057|pdb|3FJX|A Chain A, E. Coli Epsp Synthase (T97i) Liganded With S3p Length = 427 Back     alignment and structure
>gi|223674059|pdb|3FK0|A Chain A, E. Coli Epsp Synthase (Tips Mutation) Liganded With S3p Length = 427 Back     alignment and structure
>gi|40889351|pdb|1Q36|A Chain A, Epsp Synthase (Asp313ala) Liganded With Tetrahedral Reaction Intermediate Length = 427 Back     alignment and structure
>gi|157830987|pdb|1EPS|A Chain A, Structure And Topological Symmetry Of The Glyphosphate 5- Enol-Pyruvylshikimate-3-Phosphate Synthase: A Distinctive Protein Fold Length = 427 Back     alignment and structure
>gi|93278857|pdb|2BJB|A Chain A, Mycobacterium Tuberculosis Epsp Synthase In Unliganded State Length = 462 Back     alignment and structure
gi|178847075|pdb|2O0B|A Chain A, Mycobacterium Tuberculosis Epsp Synthase In Complex With S3p (Partially Photolyzed) Length = 450 Back     alignment and structure
>gi|56553616|pdb|1P88|A Chain A, Substrate-Induced Structural Changes To The Isolated N- Terminal Domain Of 5-Enolpyruvylshikimate-3-Phosphate Synthase Length = 216 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
1ejd_A419 MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransfera 1e-117
3nvs_A450 3-phosphoshikimate 1-carboxyvinyltransferase; structura 1e-69
2yvw_A425 UDP-N-acetylglucosamine 1- carboxyvinyltransferase; pep 3e-69
1g6s_A427 EPSP synthase; two-domain structure, inside-OUT alpha-b 4e-68
1rf6_A427 5-enolpyruvylshikimate-3-phosphate synthase; shikimate 1e-56
2pqc_A445 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OU 1e-52
2o0b_A450 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate 2e-35
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carr 5e-04
>1ejd_A MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransferase; inside-OUT alpha/beta barrel; 1.55A {Enterobacter cloacae} SCOP: d.68.2.2 PDB: 1ejc_A 1eyn_A* 1ybg_A* 1naw_A 1q3g_A* 1dlg_A 1ryw_A* 2z2c_A* 1uae_A* 3iss_A* 1a2n_A* 2rl1_A* 2rl2_A* Length = 419 Back     alignment and structure
 Score =  417 bits (1073), Expect = e-117
 Identities = 196/430 (45%), Positives = 274/430 (63%), Gaps = 12/430 (2%)

Query: 1   MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSH 60
           MD+ ++ G  +L G + ISGAKNA+LP++ A+LL  E + ++N+P L D+   +++L   
Sbjct: 1   MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQL 60

Query: 61  GVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARI 120
           G ++               ++     ++ + +  YDLV  MRAS W +GPL+AR G  ++
Sbjct: 61  GTKV-----------ERDGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQV 109

Query: 121 SLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQV 180
           SLPGGCAIG RPVDL +  L+ LG  IK++ GYV A V+   L+G      KVSVGAT  
Sbjct: 110 SLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVN-GRLKGAHIVMDKVSVGATVT 168

Query: 181 MMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI 240
           +M  A+L+ G T I NAAREPE+VD A+ L ++GAKISG G+  ITI+GV  L G  +R+
Sbjct: 169 IMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRV 228

Query: 241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEK 300
           LPDRIE GT+ +A A++GG ++ +      L  V   +R+ G DI+  ++ I +  +G++
Sbjct: 229 LPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKR 288

Query: 301 LRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLS 360
            + V V TAP P FPTD+QAQF  +   A G   ITETIFENRFMHV EL+R+GA   + 
Sbjct: 289 PKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIE 348

Query: 361 GQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSR 420
             T    GV+ L GA VMATDLRAS SLV+A   A+G T + R+YH+DRG+E +E KL  
Sbjct: 349 SNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRA 408

Query: 421 CGALIQRIKG 430
            GA I+R+KG
Sbjct: 409 LGANIERVKG 418


>3nvs_A 3-phosphoshikimate 1-carboxyvinyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: S3P SKM GPJ EPE; 1.02A {Vibrio cholerae} PDB: 1g6s_A* 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1eps_A 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1q36_A* 1p88_A 1p89_A Length = 450 Back     alignment and structure
>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5} Length = 425 Back     alignment and structure
>1g6s_A EPSP synthase; two-domain structure, inside-OUT alpha-beta barrel, transferase; HET: S3P GPJ; 1.50A {Escherichia coli} SCOP: d.68.2.2 PDB: 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 1q36_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1eps_A 1p88_A 1p89_A Length = 427 Back     alignment and structure
>1rf6_A 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae} SCOP: d.68.2.2 PDB: 1rf5_A 1rf4_A* Length = 427 Back     alignment and structure
>2pqc_A 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A* Length = 445 Back     alignment and structure
>2o0b_A 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_A Length = 450 Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl reductase, beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Length = 1688 Back     alignment and structure

Homologous Structures in PDB70 Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
1ejd_A419 MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransfera 100.0
2yvw_A425 UDP-N-acetylglucosamine 1- carboxyvinyltransferase; pep 100.0
3nvs_A450 3-phosphoshikimate 1-carboxyvinyltransferase; structura 100.0
2pqc_A445 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OU 100.0
1rf6_A427 5-enolpyruvylshikimate-3-phosphate synthase; shikimate 100.0
2o0b_A450 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate 100.0
2o0b_A450 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate 99.82
3nvs_A450 3-phosphoshikimate 1-carboxyvinyltransferase; structura 99.78
1rf6_A427 5-enolpyruvylshikimate-3-phosphate synthase; shikimate 99.78
1ejd_A419 MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransfera 99.79
2pqc_A445 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OU 99.74
2yvw_A425 UDP-N-acetylglucosamine 1- carboxyvinyltransferase; pep 99.72
>1ejd_A MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransferase; inside-OUT alpha/beta barrel; 1.55A {Enterobacter cloacae} SCOP: d.68.2.2 PDB: 1ejc_A 1eyn_A* 1ybg_A* 1naw_A 1q3g_A* 1dlg_A 1ryw_A* 3lth_A* 3kqa_A* 3kqj_A* 2z2c_A* 1uae_A* 3iss_A* 3kr6_A* 1a2n_A* 2rl1_A* 2rl2_A* Back     alignment and structure
Probab=100.00  E-value=0  Score=733.41  Aligned_cols=418  Identities=47%  Similarity=0.799  Sum_probs=383.7

Q ss_pred             CCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCEEEECCCCE
Q ss_conf             94389827973137897696466899999999746996999869836999999999997498999927741142024525
Q gi|254780927|r    1 MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSST   80 (430)
Q Consensus         1 M~~l~V~g~~~L~G~i~vpgSKs~s~Ral~aaaLa~g~s~i~n~~~s~D~~~~~~~l~~lG~~i~~~~~~~~~~~~~~~~   80 (430)
                      |+||+|+||++|+|+|++|||||+|||+|++|+|++|+|+|+|+|+|+||++|+++||+||++|+++++           
T Consensus         1 M~~~~i~g~~~L~G~i~ipgsKS~s~RaLi~aaLa~g~s~I~n~l~s~D~~~~i~~l~~LG~~I~~~~~-----------   69 (419)
T 1ejd_A            1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERDGS-----------   69 (419)
T ss_dssp             CEEEEEEECCCCEEEEECCBCHHHHHHHHHHGGGBSSCEEEESCCCCHHHHHHHHHHHHTTCEEEESSS-----------
T ss_pred             CCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEECCE-----------
T ss_conf             985999588935879978883899999999999739989995499029999999999978999998997-----------


Q ss_pred             EEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEEEC
Q ss_conf             99943666586444023431132110225332333210453058663332012123433321033224568614899950
Q gi|254780927|r   81 MHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSS  160 (430)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~r~s~~~l~~lla~~~~~~v~l~G~~~l~~RP~~~l~~~L~~lGa~i~~~~g~~p~~i~g  160 (430)
                      ..+.+........+.+.....+++.+++++++++++...++++|||+|++|||++++++|++|||+|++++|++|+.+.+
T Consensus        70 ~~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~a~~~~~~~~l~Gd~sl~~RPm~~li~~L~~lGa~i~~~~g~~~~~i~g  149 (419)
T 1ejd_A           70 VWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNG  149 (419)
T ss_dssp             EEEECTTCCCCEECHHHHTTCGGGGGGHHHHHHHHSEEEEECCCCSCCSSCTTHHHHHHHHHTTCEEEEETTEEEEECSS
T ss_pred             EEEECCCCCCCCCCHHHHHCCCCCCCCCCHHHHHCCCEEEEECCCCCCCCCCHHHHHHHHHHCCCEEEECCCCEEEECCC
T ss_conf             99988997877665667624663100200256642871798438854688974789999986787799607925550378


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCEE
Q ss_conf             24433333334346661135665044446873323322201599899875014544320244321202554222234200
Q gi|254780927|r  161 KGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI  240 (430)
Q Consensus       161 ~~l~g~~i~l~~~S~q~~s~lLlaA~~a~G~t~I~~~~~~P~i~~t~~~L~~~Gv~I~~~~~~~i~I~g~~~l~~~~~~V  240 (430)
                      + ++|+++.++.+|+|++|++|||+++++|.+++.+++++||+++|++||++||++|++.++.++.|+|.+.+++.+|+|
T Consensus       150 ~-l~g~~~~~~~~Ssq~~s~llla~~~~~g~~~i~~~~~~~~i~~t~~~l~~~G~~i~~~~~~~~~i~g~~~~~~~~~~V  228 (419)
T 1ejd_A          150 R-LKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRV  228 (419)
T ss_dssp             S-CBCCEEECSSCCHHHHHHHHHHHTTSBSEEEEETCCCCHHHHHHHHHHHHTTCEEECTTSSEEEEECCSCBCCEEEEC
T ss_pred             C-CCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEEECCCCCCHHHHHHHHHHCCEEEEECCCEEEEEECCCCCCCCCEEE
T ss_conf             8-667469658775899999998776166962897258766598998889859639996387199990750157973595


Q ss_pred             CCCCHHCCHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHCCCCEEEECCCEEEEECCCCCCEEEEECCCCCCCCCCCHH
Q ss_conf             14310000100000124442010023456421046889752674367445126753267643157621535666421013
Q gi|254780927|r  241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQA  320 (430)
Q Consensus       241 ~~D~ssAa~fl~Aaalt~g~i~i~n~~~~~~~~~l~iL~~mGa~i~~~~~~i~V~~~~~~l~~~di~~~~~pg~~~D~~p  320 (430)
                      |||||+|+||++||+++++++++.|..+++++.++++|++||+++++.++++.|...+.++..+|++++|.|..+.|++|
T Consensus       229 ~~D~ssaa~~~~aa~l~~~~i~~~~~~~~~~~~~~~il~~mg~~i~~~~~~~~v~~~~~~~~~id~~~~~d~~~~~~~~~  308 (419)
T 1ejd_A          229 LPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQA  308 (419)
T ss_dssp             CBCHHHHHHHHHHHHTTTCEEEEESCCGGGCHHHHHHHHHTTCEEEECSSEEEEECTTCCCBCCCEECCSTTSCCGGGHH
T ss_pred             CCCCHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEECCCEEEEEEECCCCCCEEEECCCCCCCCHHHHH
T ss_conf             88817899999998266986999387868878999999975998996488699985056445458627856664123567


Q ss_pred             HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEE
Q ss_conf             46676313566416732046567566788974885899978969998889851015660818999999999985498199
Q gi|254780927|r  321 QFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETE  400 (430)
Q Consensus       321 ~la~laa~A~G~s~I~e~i~e~R~~~~~eL~klG~~v~~~~d~l~I~G~~~l~g~~v~~~DHRiaMa~~ia~L~a~g~~~  400 (430)
                      +++.+++++.|.++++++.++.+...++||+|||+++++++|+++|+|+++++|++++++||||||||++|||.++|+++
T Consensus       309 ~~~~~~~~~~G~~~~~~ke~dr~~~~~~~L~klG~~v~~~~d~l~I~G~~~l~g~~v~s~DHRiaMa~ava~l~~~g~~~  388 (419)
T 1ejd_A          309 QFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTV  388 (419)
T ss_dssp             HHHHHHHTSBSEEEEECCSCSSCCTHHHHHHHTTCEEEEETTEEEEECCSCCBCCEECCSSHHHHHHHHHHHHHSBEEEE
T ss_pred             HHHHHHEEECCCEEEEEEEEECHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCEEECCCHHHHHHHHHHHHHCCCCEE
T ss_conf             76412128136329999998578999999995799799989999998999773872713808999999999983999399


Q ss_pred             EECCCEECCCCCCHHHHHHHCCCEEEEECC
Q ss_conf             924330117784878899866978999519
Q gi|254780927|r  401 ISRVYHLDRGFECLEKKLSRCGALIQRIKG  430 (430)
Q Consensus       401 I~~~~~i~ksyp~f~~~L~~LGa~Ie~i~~  430 (430)
                      |+|++||+||||+||++|++|||+||||||
T Consensus       389 I~~~~~v~kSyP~F~~~l~~LGa~Ie~v~~  418 (419)
T 1ejd_A          389 VDRIYHIDRGYERIEDKLRALGANIERVKG  418 (419)
T ss_dssp             ECCTHHHHHHSSSHHHHHHTTTCEEEEEEC
T ss_pred             ECCCEEEECCCCCHHHHHHHCCCEEEEECC
T ss_conf             847138978642489999966989999707



>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5} Back     alignment and structure
>3nvs_A 3-phosphoshikimate 1-carboxyvinyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: S3P SKM GPJ EPE; 1.02A {Vibrio cholerae} PDB: 1g6s_A* 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1eps_A 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1q36_A* 1p88_A 1p89_A Back     alignment and structure
>2pqc_A 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A* Back     alignment and structure
>1rf6_A 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae} SCOP: d.68.2.2 PDB: 1rf5_A 1rf4_A* Back     alignment and structure
>2o0b_A 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_A Back     alignment and structure
>2o0b_A 3-phosphoshikimate 1-carboxyvinyltransferase; shikimate pathway, EPSP synthase, structural genomics; HET: S3P; 1.15A {Mycobacterium tuberculosis} PDB: 2o0d_A* 2o0e_A* 2o0x_A* 2o0z_A* 2o15_A 2bjb_A Back     alignment and structure
>3nvs_A 3-phosphoshikimate 1-carboxyvinyltransferase; structural genomics, center for structural genomics of infec diseases, csgid; HET: S3P SKM GPJ EPE; 1.02A {Vibrio cholerae} PDB: 1g6s_A* 1g6t_A* 1x8r_A* 1x8t_A* 2aa9_A* 2aay_A* 2pq9_A* 1eps_A 1mi4_A* 3fjz_A* 3fjx_A* 2qfs_A* 2qft_A* 2qfq_A* 2qfu_A* 3fk0_A* 3fk1_A* 1q36_A* 1p88_A 1p89_A Back     alignment and structure
>1rf6_A 5-enolpyruvylshikimate-3-phosphate synthase; shikimate pathway, EPSP synthase, glyphosate, PEP, transferase; HET: GPJ S3P; 1.90A {Streptococcus pneumoniae} SCOP: d.68.2.2 PDB: 1rf5_A 1rf4_A* Back     alignment and structure
>1ejd_A MURA, EPT, UDP-N-acetylglucosamine enolpyruvyltransferase; inside-OUT alpha/beta barrel; 1.55A {Enterobacter cloacae} SCOP: d.68.2.2 PDB: 1ejc_A 1eyn_A* 1ybg_A* 1naw_A 1q3g_A* 1dlg_A 1ryw_A* 3lth_A* 3kqa_A* 3kqj_A* 2z2c_A* 1uae_A* 3iss_A* 3kr6_A* 1a2n_A* 2rl1_A* 2rl2_A* Back     alignment and structure
>2pqc_A 3-phosphoshikimate 1-carboxyvinyltransferase; inside-OUT alpha/beta barrel; HET: RC1; 1.60A {Agrobacterium SP} PDB: 2pqb_A* 2gg6_A* 2gg4_A* 2gga_A* 2ggd_A* 2pqd_A* Back     alignment and structure
>2yvw_A UDP-N-acetylglucosamine 1- carboxyvinyltransferase; peptidoglycan, structural genomics, NPPSFA; HET: EPU; 1.81A {Aquifex aeolicus VF5} Back     alignment and structure

Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
d1ejda_419 d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl trans 8e-89
d1rf6a_427 d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPS 7e-55
d1g6sa_427 d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPS 6e-54
d1p88a_216 d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPS 6e-18
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Length = 419 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: IF3-like
superfamily: EPT/RTPC-like
family: Enolpyruvate transferase, EPT
domain: UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ)
species: Enterobacter cloacae [TaxId: 550]
 Score =  321 bits (823), Expect = 8e-89
 Identities = 196/430 (45%), Positives = 274/430 (63%), Gaps = 12/430 (2%)

Query: 1   MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSH 60
           MD+ ++ G  +L G + ISGAKNA+LP++ A+LL  E + ++N+P L D+   +++L   
Sbjct: 1   MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQL 60

Query: 61  GVEILSDSSYNDQNKSYSSTMHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARI 120
           G ++               ++     ++ + +  YDLV  MRAS W +GPL+AR G  ++
Sbjct: 61  GTKV-----------ERDGSVWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQV 109

Query: 121 SLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSSKGLRGTSYTFPKVSVGATQV 180
           SLPGGCAIG RPVDL +  L+ LG  IK++ GYV A V+   L+G      KVSVGAT  
Sbjct: 110 SLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVN-GRLKGAHIVMDKVSVGATVT 168

Query: 181 MMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI 240
           +M  A+L+ G T I NAAREPE+VD A+ L ++GAKISG G+  ITI+GV  L G  +R+
Sbjct: 169 IMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRV 228

Query: 241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEK 300
           LPDRIE GT+ +A A++GG ++ +      L  V   +R+ G DI+  ++ I +  +G++
Sbjct: 229 LPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKR 288

Query: 301 LRPVDVITAPFPGFPTDLQAQFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLS 360
            + V V TAP P FPTD+QAQF  +   A G   ITETIFENRFMHV EL+R+GA   + 
Sbjct: 289 PKAVTVRTAPHPAFPTDMQAQFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIE 348

Query: 361 GQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETEISRVYHLDRGFECLEKKLSR 420
             T    GV+ L GA VMATDLRAS SLV+A   A+G T + R+YH+DRG+E +E KL  
Sbjct: 349 SNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTVVDRIYHIDRGYERIEDKLRA 408

Query: 421 CGALIQRIKG 430
            GA I+R+KG
Sbjct: 409 LGANIERVKG 418


>d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Length = 427 Back     information, alignment and structure
>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Length = 427 Back     information, alignment and structure
>d1p88a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Length = 216 Back     information, alignment and structure

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase [Cand
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, M 100.0
d1g6sa_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 100.0
d1rf6a_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {S 100.0
d1p88a_216 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 100.0
d1ejda_419 UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, M 99.79
d1rf6a_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {S 99.79
d1g6sa_427 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 99.76
d1p88a_216 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {E 99.55
d1qmha2239 RNA 3'-terminal phosphate cyclase, RPTC {Escherichia co 94.65
d1qmha2239 RNA 3'-terminal phosphate cyclase, RPTC {Escherichia co 93.01
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: IF3-like
superfamily: EPT/RTPC-like
family: Enolpyruvate transferase, EPT
domain: UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ)
species: Enterobacter cloacae [TaxId: 550]
Probab=100.00  E-value=0  Score=735.28  Aligned_cols=418  Identities=47%  Similarity=0.796  Sum_probs=383.3

Q ss_pred             CCEEEEECCCCEEEEEECCCCHHHHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCCEEEEECCCCEEEECCCCE
Q ss_conf             94389827973137897696466899999999746996999869836999999999997498999927741142024525
Q gi|254780927|r    1 MDRIKIIGGNKLNGTIAISGAKNASLPVMIASLLTSETLTLENIPDLADVKLLIRILRSHGVEILSDSSYNDQNKSYSST   80 (430)
Q Consensus         1 M~~l~V~g~~~L~G~i~vpgSKs~s~Ral~aaaLa~g~s~i~n~~~s~D~~~~~~~l~~lG~~i~~~~~~~~~~~~~~~~   80 (430)
                      |+||+|+||++|+|+|++|||||+|||+|++|+|++|+|+|+|+|+|+||++|+++||+||++|+++++           
T Consensus         1 M~~~~i~g~~~L~G~V~ipgsKS~s~Rali~aaLa~g~s~I~n~l~s~D~~~~~~al~~LG~~I~~~~~-----------   69 (419)
T d1ejda_           1 MDKFRVQGPTRLQGEVTISGAKNAALPILFAALLAEEPVEIQNVPKLKDIDTTMKLLTQLGTKVERDGS-----------   69 (419)
T ss_dssp             CEEEEEEECCCCEEEEECCBCHHHHHHHHHHGGGBSSCEEEESCCCCHHHHHHHHHHHHTTCEEEESSS-----------
T ss_pred             CCEEEEECCCEEEEEEECCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHCCCEEEECCE-----------
T ss_conf             986999488904779978883899999999999849989992599019999999999977998998987-----------


Q ss_pred             EEEECCCCCCCCCCHHHHHHCCCCCCCCCCCCCCCCCEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCEEEEEEC
Q ss_conf             99943666586444023431132110225332333210453058663332012123433321033224568614899950
Q gi|254780927|r   81 MHFRCRHIVDLTGSYDLVSKMRASFWVIGPLLAREGYARISLPGGCAIGTRPVDLFVDSLKSLGVVIKIDGGYVDARVSS  160 (430)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~~r~s~~~l~~lla~~~~~~v~l~G~~~l~~RP~~~l~~~L~~lGa~i~~~~g~~p~~i~g  160 (430)
                      +.+..........+.+.....+++.+++++++++++...+.++|||+|++|||++++++|++|||+|++++|++|+.+.+
T Consensus        70 ~~I~~~~~~~~~~~~~~~~~~~~t~~~~~~~~a~~~~~~~~l~Gd~sL~~RPm~~li~~L~~lGa~i~~~~g~~~~~i~g  149 (419)
T d1ejda_          70 VWIDASNVNNFSAPYDLVKTMRASIWALGPLVARFGQGQVSLPGGCAIGARPVDLHIFGLEKLGAEIKLEEGYVKASVNG  149 (419)
T ss_dssp             EEEECTTCCCCEECHHHHTTCGGGGGGHHHHHHHHSEEEEECCCCSCCSSCTTHHHHHHHHHTTCEEEEETTEEEEECSS
T ss_pred             EEEECCCCCCCCCCHHHHHCCCCCCCCCCHHHHHCCCCCCCCCCCCCCCCCCHHHHHHHHHHCCEEEEECCCCEEEECCC
T ss_conf             99989997777665545403543200244256652775246666434577742678899985361699628924453378


Q ss_pred             CCCCCCCCCCCCCCCCCEEEEEEECCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCCCCCCCCCCEEECCCCCCCCCCCEE
Q ss_conf             24433333334346661135665044446873323322201599899875014544320244321202554222234200
Q gi|254780927|r  161 KGLRGTSYTFPKVSVGATQVMMMVASLSHGDTSIYNAAREPEVVDLAHCLNSMGAKISGMGSSTITIQGVTSLSGTRHRI  240 (430)
Q Consensus       161 ~~l~g~~i~l~~~S~q~~s~lLlaA~~a~G~t~I~~~~~~P~i~~t~~~L~~~Gv~I~~~~~~~i~I~g~~~l~~~~~~V  240 (430)
                       +++|++|.++.+|+|++|++||||++++|.+++.++.++||+++|++||++||++|++.+++++.++|.+.+.+.+|+|
T Consensus       150 -~l~g~~~~~~~~Ssq~~s~llla~~~~~g~~~i~~~~~~~~i~~t~~~l~~~G~~i~~~~~~~~~i~g~~~~~~~~~~V  228 (419)
T d1ejda_         150 -RLKGAHIVMDKVSVGATVTIMSAATLAEGTTIIENAAREPEIVDTANFLVALGAKISGQGTDRITIEGVERLGGGVYRV  228 (419)
T ss_dssp             -SCBCCEEECSSCCHHHHHHHHHHHTTSBSEEEEETCCCCHHHHHHHHHHHHTTCEEECTTSSEEEEECCSCBCCEEEEC
T ss_pred             -CCCCCEEECCCCCHHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHHCCEEEECCCCEEEEECCCCCCCCCCEEE
T ss_conf             -8667467458762567788984455237963542024441566677776522010011795499980542346774053


Q ss_pred             CCCCHHCCHHHHHCCCCCCCEEEECCCCCCCCCHHHHHHHCCCCEEEECCCEEEEECCCCCCEEEEECCCCCCCCCCCHH
Q ss_conf             14310000100000124442010023456421046889752674367445126753267643157621535666421013
Q gi|254780927|r  241 LPDRIEAGTYAMAVAMTGGDVILKMTDSSLLKTVFKVMRQTGVDIDIIDEGIRVRWNGEKLRPVDVITAPFPGFPTDLQA  320 (430)
Q Consensus       241 ~~D~ssAa~fl~Aaalt~g~i~i~n~~~~~~~~~l~iL~~mGa~i~~~~~~i~V~~~~~~l~~~di~~~~~pg~~~D~~p  320 (430)
                      |||||||+||++||++++++++++|+.++.++.++++|++||+++++.++++.|.....++.++|++++|.|.++.|++|
T Consensus       229 ~~D~ssAa~~~~aa~i~g~~i~i~~~~~~~~~~~~~~l~~mg~~i~~~~~~~~i~~~~~~~~~i~~~~~~~~~~~~~~~~  308 (419)
T d1ejda_         229 LPDRIETGTFLVAAAISGGKIVCRNAQPDTLDAVLAKLREAGADIETGEDWISLDMHGKRPKAVTVRTAPHPAFPTDMQA  308 (419)
T ss_dssp             CBCHHHHHHHHHHHHTTTCEEEEESCCGGGCHHHHHHHHHTTCEEEECSSEEEEECTTCCCBCCCEECCSTTSCCGGGHH
T ss_pred             CCHHHHHHHHHHHHCCCCCEEECCCCCHHHHHHHHHHHHHHCCEEEECCCEEEEEECCCCCCCCCCCCCCCCCCCCCHHH
T ss_conf             57066431133322156865521677806778898876642313997377699997676544300256632234421145


Q ss_pred             HHHHHHHCCCCCEEEEEECCHHHHHHHHHHHHCCCEEEEECCEEEEECCCCCEEEEEEECCHHHHHHHHHHHHHCCCEEE
Q ss_conf             46676313566416732046567566788974885899978969998889851015660818999999999985498199
Q gi|254780927|r  321 QFMAMMCCAAGISHITETIFENRFMHVQELVRLGARISLSGQTARVEGVQGLRGAPVMATDLRASVSLVIAALAAQGETE  400 (430)
Q Consensus       321 ~la~laa~A~G~s~I~e~i~e~R~~~~~eL~klG~~v~~~~d~l~I~G~~~l~g~~v~~~DHRiaMa~~ia~L~a~g~~~  400 (430)
                      .++.+++++.|.++++++.++.|...+.||+|||+++++++|+++|+|+++++|++++++||||||||+||||.++|+++
T Consensus       309 ~~~~~~~~~~G~~~~~~ke~dr~~~~~~eL~klG~~v~~~~d~l~I~G~~~l~g~~v~~~DHRiAMa~aia~l~~~g~~~  388 (419)
T d1ejda_         309 QFTLLNLVAEGTGVITETIFENRFMHVPELIRMGAHAEIESNTVICHGVEKLSGAQVMATDLRASASLVLAGCIAEGTTV  388 (419)
T ss_dssp             HHHHHHHTSBSEEEEECCSCSSCCTHHHHHHHTTCEEEEETTEEEEECCSCCBCCEECCSSHHHHHHHHHHHHHSBEEEE
T ss_pred             HHHCCCEEECCCEEEEEECCCHHHHHHHHHHHCCCEEEEECCEEEEECCCCCCCCEECCCCHHHHHHHHHHHHHCCCCEE
T ss_conf             54122218736167764023438789999996889799969999997999863761613838999999999981999499


Q ss_pred             EECCCEECCCCCCHHHHHHHCCCEEEEECC
Q ss_conf             924330117784878899866978999519
Q gi|254780927|r  401 ISRVYHLDRGFECLEKKLSRCGALIQRIKG  430 (430)
Q Consensus       401 I~~~~~i~ksyp~f~~~L~~LGa~Ie~i~~  430 (430)
                      |+|++||+||||+||++|++|||+||||||
T Consensus       389 I~~~~~i~~SyP~F~~~l~~LGa~I~~~~~  418 (419)
T d1ejda_         389 VDRIYHIDRGYERIEDKLRALGANIERVKG  418 (419)
T ss_dssp             ECCTHHHHHHSSSHHHHHHTTTCEEEEEEC
T ss_pred             ECCCEEEECCCHHHHHHHHHCCCEEEEECC
T ss_conf             836137868734099999967989999717



>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1p88a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ejda_ d.68.2.2 (A:) UDP-N-acetylglucosamine enolpyruvyl transferase (EPT, MurA, MurZ) {Enterobacter cloacae [TaxId: 550]} Back     information, alignment and structure
>d1rf6a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g6sa_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p88a_ d.68.2.2 (A:) 5-enol-pyruvyl shikimate-3-phosphate (EPSP) synthase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target 430 UDP-N-acetylglucosamine 1-carboxyvinyltransferase
1ejd_A_21-230210 (A:21-230) MURA, EPT, UDP-N-acetylglucosamine enol 2e-36
1g6s_A_21-243223 (A:21-243) EPSP synthase; two-domain structure, in 5e-36
2yvw_A_30-237208 (A:30-237) UDP-N-acetylglucosamine 1- carboxyvinyl 3e-33
2o0b_A_21-240220 (A:21-240) 3-phosphoshikimate 1-carboxyvinyltransf 2e-28
1ejd_A_21-230210 (A:21-230) MURA, EPT, UDP-N-acetylglucosamine enol 5e-30
1g6s_A_21-243223 (A:21-243) EPSP synthase; two-domain structure, in 2e-26
2yvw_A_30-237208 (A:30-237) UDP-N-acetylglucosamine 1- carboxyvinyl 8e-28
2o0b_A_21-240220 (A:21-240) 3-phosphoshikimate 1-carboxyvinyltransf 3e-26
1ejd_A_21-230210 (A:21-230) MURA, EPT, UDP-N-acetylglucosamine enol 3e-04
2yvw_A_1-18_295-425149 (A:1-18,A:295-425) UDP-N-acetylglucosamine 1- carb 2e-30
1rf6_A_297-411115 (A:297-411) 5-enolpyruvylshikimate-3-phosphate syn 4e-21
1ejd_A_1-20_231-419209 (A:1-20,A:231-419) MURA, EPT, UDP-N-acetylglucosam 4e-28
1rf6_A_80-220141 (A:80-220) 5-enolpyruvylshikimate-3-phosphate synt 2e-24
2pqc_A_83-228146 (A:83-228) 3-phosphoshikimate 1-carboxyvinyltransf 7e-23
1rf6_A_297-411115 (A:297-411) 5-enolpyruvylshikimate-3-phosphate syn 2e-09