254780932

254780932

hypothetical protein CLIBASIA_04155

GeneID in NCBI database:8209954Locus tag:CLIBASIA_04155
Protein GI in NCBI database:254780932Protein Accession:YP_003065345.1
Gene range:+(920276, 920986)Protein Length:236aa
Gene description:hypothetical protein
COG prediction:[S] Uncharacterized protein conserved in bacteria
KEGG prediction:hypothetical protein; K09991 hypothetical protein
SEED prediction:hypothetical protein
Pathway involved in KEGG:not defined
Subsystem involved in SEED:- none -
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPREDnone TM-Helix
HMMTOPnone TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVMnone TM-Helix
PHOBIUSnone TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH
ccccHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHcccccccccccHHHHHHHHHcccHHHccccccccccccccccccccccccccHHHHHHHHHHHHHccHHHHccHHHccccccHHHHHHHHHHccccccEEcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHcccccHHHHHHHHHHHHHHHHcccccc
cccccHcccccHHHHHHHHHHHHHccccccccccccccccccccHcccccccccccccHcccccccccHHHHHccccccccccccHcHHHHHHccccHHHHHHHHHcccccccccccHHHHHHHHHHcccccccccccccccccccHcccccccHcccccccccccccHcHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccc
maqynavsepsMEEIVNSIRRILEnndqefstsnnvqtqvpardegviekedfvqedkmsnhlfadqnshlkkygveypkketmsLSDVAARVRAEARgdariiadapspiansilpstdaleenavmdkplneglspssdlgmqaeesmyspdlvdkckgeeealvssdvgdqVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH
maqynavsepsmeEIVNSIRRILENndqefstsnnvqtqvpardegVIEKEDFVQEDKMsnhlfadqnshlKKYGVEYPKKETMSLSDVAARVRAEARGDariiadapspiansILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALResesrsldqlsLDVLRPMLrewlddnlpgiverLVREEieriargpirh
MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGiverlvreeieriarGPIRH
******VSEPSMEEIVNSIRRI*****************************************************************************************************************************************************************************QLSLDVLRPMLREWLDDNLPGIVERLVREEIE*********
***********MEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH
****************NSI*RILEN***************************************************************************ARIIADAPSPIANSILPSTDALEEN**M****************************************************QLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIAR*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH
MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH
MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMSNHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDARIIADAPSPIANSILPSTDALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSFDQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIRH

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

No hits with e-value below 0.05

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target236 hypothetical protein CLIBASIA_04155 [Candidatus Liberib
315122643231 hypothetical protein CKC_04475 [Candidatus Liberibacter 1 2e-63
163759465290 hypothetical protein HPDFL43_08937 [Hoeflea phototrophi 1 1e-22
190891499289 hypothetical protein RHECIAT_CH0001896 [Rhizobium etli 1 1e-19
218516421278 hypothetical protein Retl8_23591 [Rhizobium etli 8C-3] 1 1e-19
218509902175 hypothetical protein RetlB5_21760 [Rhizobium etli Brasi 1 2e-19
222148982307 hypothetical protein Avi_2684 [Agrobacterium vitis S4] 1 2e-19
218461653229 hypothetical protein RetlK5_20116 [Rhizobium etli Kim 5 1 2e-19
209549075294 hypothetical protein Rleg2_1474 [Rhizobium leguminosaru 1 5e-19
241204403289 hypothetical protein Rleg_1673 [Rhizobium leguminosarum 1 5e-19
116251794293 hypothetical protein RL2034 [Rhizobium leguminosarum bv 1 7e-19
>gi|315122643|ref|YP_004063132.1| hypothetical protein CKC_04475 [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 231 Back     alignment and organism information
 Score =  246 bits (627), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 144/236 (61%), Positives = 186/236 (78%), Gaps = 7/236 (2%)

Query: 1   MAQYNAVSEPSMEEIVNSIRRILENNDQEFSTSNNVQTQVPARDEGVIEKEDFVQEDKMS 60
           MAQ N VSEPSMEEIVNSIRRILENNDQEF  SNNV+TQV    E   E ++F +E++ S
Sbjct: 1   MAQSNTVSEPSMEEIVNSIRRILENNDQEFGVSNNVETQVQTCQENPPE-DNFQREERTS 59

Query: 61  NHLFADQNSHLKKYGVEYPKKETMSLSDVAARVRAEARGDA-RIIADAPSPIANSILPST 119
           NH+F++QN  L++Y   YP+K+TMSLSDVAARVRAEAR D+ R+I D+ +P+      S 
Sbjct: 60  NHIFSEQN-RLREYNAAYPQKKTMSLSDVAARVRAEARADSSRVITDS-APLEKD---SI 114

Query: 120 DALEENAVMDKPLNEGLSPSSDLGMQAEESMYSPDLVDKCKGEEEALVSSDVGDQVASSF 179
            +L  NAV +K +++  S  S+L +Q +ESM+S   VD+ + ++  L+SSD+G+QV+SSF
Sbjct: 115 SSLSNNAVEEKFVDDFSSSDSNLNIQMKESMHSSVAVDQREDKDSGLISSDIGNQVSSSF 174

Query: 180 DQLVKALRESESRSLDQLSLDVLRPMLREWLDDNLPGIVERLVREEIERIARGPIR 235
           DQL KAL+ES++RS+DQ+S++VLRPMLREWLDDNLPGIVERLVREEIERIARGP R
Sbjct: 175 DQLAKALQESDNRSIDQISIEVLRPMLREWLDDNLPGIVERLVREEIERIARGPSR 230


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|163759465|ref|ZP_02166550.1| hypothetical protein HPDFL43_08937 [Hoeflea phototrophica DFL-43] Length = 290 Back     alignment and organism information
>gi|190891499|ref|YP_001978041.1| hypothetical protein RHECIAT_CH0001896 [Rhizobium etli CIAT 652] Length = 289 Back     alignment and organism information
>gi|218516421|ref|ZP_03513261.1| hypothetical protein Retl8_23591 [Rhizobium etli 8C-3] Length = 278 Back     alignment and organism information
>gi|218509902|ref|ZP_03507780.1| hypothetical protein RetlB5_21760 [Rhizobium etli Brasil 5] Length = 175 Back     alignment and organism information
>gi|222148982|ref|YP_002549939.1| hypothetical protein Avi_2684 [Agrobacterium vitis S4] Length = 307 Back     alignment and organism information
>gi|218461653|ref|ZP_03501744.1| hypothetical protein RetlK5_20116 [Rhizobium etli Kim 5] Length = 229 Back     alignment and organism information
>gi|209549075|ref|YP_002280992.1| hypothetical protein Rleg2_1474 [Rhizobium leguminosarum bv. trifolii WSM2304] Length = 294 Back     alignment and organism information
>gi|241204403|ref|YP_002975499.1| hypothetical protein Rleg_1673 [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 289 Back     alignment and organism information
>gi|116251794|ref|YP_767632.1| hypothetical protein RL2034 [Rhizobium leguminosarum bv. viciae 3841] Length = 293 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target236 hypothetical protein CLIBASIA_04155 [Candidatus Liberib
pfam1069172 pfam10691, DUF2497, Protein of unknown function (DUF249 4e-18
COG3827231 COG3827, COG3827, Uncharacterized protein conserved in 2e-20
>gnl|CDD|151187 pfam10691, DUF2497, Protein of unknown function (DUF2497) Back     alignment and domain information
>gnl|CDD|33620 COG3827, COG3827, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 236 hypothetical protein CLIBASIA_04155 [Candidatus Liberib
COG3827231 Uncharacterized protein conserved in bacteria [Function 100.0
pfam1069172 DUF2497 Protein of unknown function (DUF2497). Members 99.88
COG3827231 Uncharacterized protein conserved in bacteria [Function 96.08
>COG3827 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>pfam10691 DUF2497 Protein of unknown function (DUF2497) Back     alignment and domain information
>COG3827 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information

Homologous Structures in PDB Database
Detected by PSI-BLAST, RPS-BLAST and HHsearch

Homologous Structures Detected by PSI-BLAST against Nonredundant Database

No homologous structure with e-value below 0.005

Homologous Structures in PDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Structures in PDB70 Database Detected by HHsearch

No hit with probability above 90.00


Homologous Domains in SCOP and MMDB Database
Detected by RPS-BLAST and HHsearch

Homologous Domains in SCOP70 (Version1.75) Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in SCOP70 (Version 1.75) Database Detected by HHsearch

No hit with probability above 90.00

Homologous Domains in MMDB70 Database Detected by RPS-BLAST

No hit with e-value below 0.005

Homologous Domains in MMDB70 Database Detected by HHsearch

No hit with probability higher than 90.00