254780933

254780933

valyl-tRNA synthetase

GeneID in NCBI database:8209955Locus tag:CLIBASIA_04160
Protein GI in NCBI database:254780933Protein Accession:YP_003065346.1
Gene range:+(921065, 923908)Protein Length:947aa
Gene description:valyl-tRNA synthetase
COG prediction:[J] Valyl-tRNA synthetase
KEGG prediction:valS; valyl-tRNA synthetase (EC:6.1.1.9); K01873 valyl-tRNA synthetase [EC:6.1.1.9]
SEED prediction:Valyl-tRNA synthetase (EC 6.1.1.9)
Pathway involved in KEGG:Valine, leucine and isoleucine biosynthesis [PATH:las00290]
Aminoacyl-tRNA biosynthesis [PATH:las00970]
Subsystem involved in SEED:tRNA aminoacylation, Val
sequencesequence profile

Prediction of Local Sequence Properties

SourceSummaryResult
scaler
NCBI Databasesequence
PSIPREDsecondary structure
SSPROsecondary structure
DISEMBLcoil and loop
DISEMBLflexible loop
SEGlow complexity
DISOPREDdisordered
DISEMBLmissing residues
DISPROdisordered
TMHMMnone TM-Helix
TOPPRED4 TM-Helix
HMMTOP1 TM-Helix
MEMSATnone TM-Helix
MEMSAT_SVM2 TM-Helix
PHOBIUS1 TM-Helix
SignalP_HMMno
SignalP_NNno
COILScoiled coil
70% MSAconservation map
90% MSAconservation map
  
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML
ccccccccHHHHHHHHHHHHHHcccccccccccccccEEEEEEccccccccccHHHHHHHHHHHHHHHHHHHccccEEEcccccHHHHHHHHHHHHHccccccccHHHccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccEEcccEEEEccccccccccHHHHHHcccccccEEEEEEEEcccccccccccccccccccccccccEEEcccccHHHcccEEEEEcccHHHHHHHcccEEEEEcccccccEEEcccccccccccEEEEcccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccHHHccHHHHHHHHHcccEEccccccccccccccccccEEEEEcccEEEEcHHHHHHHHHHHHccccEEEcHHHHHHHHHHHccccccEEEEEccccEEEEEEEcccccEEEcccHHHHHHHHHHccccccccccccHHHccccccccccccccccccccEEcccccHHEEEccccccHHHHHHccccEEEEEccccccHHHHHHHHHHHccccccccccccHHHHEEcccEEccccccHHcccccEEcHHHHHHHccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcHHHHccccHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHcccHHHHHHHHHHHHHHHHHccccEEEEccccccEEEEEEcccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
ccccccccHHHHHHHHHHHHHHccccccccccccccccEEEEcccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHcccEEEccEEEccccccccccccEEEEEccccccEEEEEcccccccccccEEEEcccccccccccccEEEEEcccccccccccEEEEccccHHHHHHcccEEEEEcccccccEEEcccccccccccEEEEccccccccccccccccccEEEEEcccccEcHHHcEEcccccccccccHHcHHHHccHHHHHHHHHHHHHHHHcccEEEEcccccccccccccccEEEccccccEEEccHHHHHHHHHHHHccccEEccHHHHHHHHHHHHHHHHHHHHHHHHcccccccEEcccccEEEEccHHHHHHHHHHHHHHccccccccHHHHHccccccHHccccccHHHHHHHHccccccccccccccHHHHccccccEEEcHHHHHHHHHHHHHHHHHHHHcccccHccccEcEEEEEccEEccccccccccccccccHHHHHccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHcHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHcccccccccccEEEEcccccccHcHHHHHHHHHHHHHHHHHHHHHHHHcccccccccEEEEEcccHHHHHHHHHHHHHHHHHccccEcccccccHHHHHHHHcccEEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
MMIDKTYDFAFIEQKSVekwnsvdafridvapklgsgvfciampppnvtgslhmghafnTTIQDIMIRFERmrgknvlwqpgtdhagiaTQITVESRLFAqssltredigrDAFIEKVWEWKKESGGSILSQLKRLgascdwsrerftmdegMSNAVRNAFVVLYkdgliyrdkrivnwdpslktsVSDLEVIQKEVdgnlwyvryplvegvtyrhpikfdddakpidwevRDYIIVsttrpetmfgdvaiavhpddyrykeligkyatlpivgrlipivsdvypdpefgdgavkvtpahdfndfeiakrhglgfiniltpEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKsnlldktdsyrhivphcersgvtiepciteqWYLDAKVLAESAIRSAKngclsfipqswdKSYYEWLENIQpwcisrqiwwghqipvwyspdgklfveNTEDAALRSAIDYYLSQDNDMTVKVRKMIkdgnisdllkRDEDVLDTWFssalwpfaslgwpeqtaelktyyptsvlvtGFDILFFWVARMMMMGLYFmkdaegkgiepFHIVYMHALVrdkngqkmskskgnvvdpidviDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSkmknarhsvsfvPQDVKWIVNKWIIKRLATVINDVTVGmenhrfndVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLlhpiipfvtedlyshvspqddmdkqgllchaqwpsliiddsesiEEVNWIIDLISKVRSIRtemnvplkAVVPLVFANIDAHVRKRLECHKCIIDrlssgniifadcppdrsIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKlennqfvekappsiLQAEKERFSKVEKKRISLENSLERIRML
mmidktydFAFIEqksvekwnsvDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAqssltredigrDAFIEKVWEWkkesggsilsqLKRLGASCDWSRERFtmdegmsnaVRNAFVVLYKDGLiyrdkrivnwdpslktsvSDLEVIQKevdgnlwyVRYPLVEgvtyrhpikfdddakpidwEVRDYIIVsttrpetmfgdVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKsnlldktdsyrhivphcersgvtiepCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYylsqdndmtVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQkmskskgnvvdPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSikkklennqfvekappsilqaekerfskvekkrislenslerirml
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML
**IDKTYDFAFIEQKSVEKWNSVDAFRID****LGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRL**********IGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFA*CPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKV*********KLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRM*
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDK*********GNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML
**IDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxhhhhhhhhhhhhhhhhhhhhxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKExxxxxxxxxxxxxxxxxxxxxxxxxQFVEKAPPSIxxxxxxxxxxxxxxxxxxxxxLERIRML
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML
MMIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQWPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKCIIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSSIKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIRML

Close Homologs Detected by BLAST or PSI-BLAST

Homolog within the Genome Detected by BLAST

IdentityAlignment graphLength Definition E-value
Target947 valyl-tRNA synthetase [Candidatus Liberibacter asiaticu
254780445963 isoleucyl-tRNA synthetase [Candidatus Liberibacter 4e-39
254780802869 leucyl-tRNA synthetase [Candidatus Liberibacter as 2e-25
255764461511 methionyl-tRNA synthetase [Candidatus Liberibacter 5e-08
255764461511 methionyl-tRNA synthetase [Candidatus Liberibacter 5e-05
>gi|254780445|ref|YP_003064858.1| isoleucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 963 Back     alignment
 Score =  155 bits (391), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 196/829 (23%), Positives = 326/829 (39%), Gaps = 121/829 (14%)

Query: 13  EQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTTIQDIMIRFERM 72
           E + +  W  +  F       +G   F +   PP   G +H+GHA N  ++D+++R  +M
Sbjct: 30  ESELITYWQKIRLFDKIRESAVGRKNFTLHDGPPYANGHIHIGHALNKILKDVIVRSFQM 89

Query: 73  RGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIG----RDAFIEKVWEWKKESGGS 128
           R  N  + PG D  G+  +  VE+   A+    ++DI     R A  +    W K     
Sbjct: 90  RNFNACFVPGWDCHGLPIEWKVENEYLAKGK-KKDDIPVNEFRQACRDSASAWVKIQS-- 146

Query: 129 ILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDPSLKTSVS 188
              + +RLG   D+     TM       + +  + + +   IYR  + + W  + +T+++
Sbjct: 147 --KEFQRLGIVGDFENPYTTMTRESEAQIASELLKIAESDQIYRGIKPIMWSIAEQTTLA 204

Query: 189 DLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTRPETMFGD 248
           + E+   +VD +   V +P+                   D+ ++  I++ TT P T+ G+
Sbjct: 205 EAEIEYHDVDSDSILVGFPVKSSA---------------DYLIKSQIVIWTTTPWTIPGN 249

Query: 249 VAIAV-----------------HPDDYRYKELIGKYATLPIVGRL--------------- 276
            AIA                  H  D   K +I K     I  +                
Sbjct: 250 RAIAFSSNHQYGLYDVISCSGQHTFDTGKKLIISKNLAQSIANQTNVKIALVCDVKAEDL 309

Query: 277 -----------------IPIVSDVYPDPEFGDGAVKVTPAHDFNDFEI---AKRHGLG-F 315
                            +P++   Y   + G G V V P+H   DF     AK   L   
Sbjct: 310 SKTMCSHPLKKLGYTFSVPLIDAEYVANDCGTGFVHVAPSHGVEDFTAWNEAKDILLNRS 369

Query: 316 INILTPEA----KIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNL 371
           ++I  P        + +E   F    VL D          G    A    I +L+    +
Sbjct: 370 VDIKVPSPVDGRGFYTTEAPGFSGARVLDDA---------GEKGNANEVVIAALINACAI 420

Query: 372 LDKTDSYRHIVPHCERSGVTIEPCITEQWYL--DAKVLAESAIRS---AKNGCLSFIPQS 426
           L+++   +H  PH  RS   I    T QW+L  D K+   S +RS   ++   + F P S
Sbjct: 421 LNRS-IVKHSYPHSWRSKKPIIFRTTSQWFLHMDKKLGDGSTLRSRALSEVEKIRFFPSS 479

Query: 427 WDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYLSQDND 486
                   +EN   W +SRQ  WG  I  +Y+  G++ ++   +  +   I  +  Q +D
Sbjct: 480 GKNRLRSMIENRPDWLLSRQRNWGVPICFFYNEKGEILLDKAINDRI---IKTFKDQGSD 536

Query: 487 --MTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTSVLV 544
              +   R        S+   + +D+LD WF SA      LG      + K  +P  V +
Sbjct: 537 AWFSEGSRDFFLGDRASEPWIQSKDILDVWFDSACTHTILLG-----KDPKLAWPADVYL 591

Query: 545 TGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVVDPI 604
            G D    W    ++      +    +G  PF  +  H    D+NG+KMSKSKGNVV P 
Sbjct: 592 EGSDQHRGWFQHSLL------ESCATRGSTPFTSLITHGFSVDENGEKMSKSKGNVVFPE 645

Query: 605 DVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHSVSF 664
           ++I + GAD LR Y+++ +    D  L    I    +   K  N IR+  +    H    
Sbjct: 646 EIISESGADVLR-YWAVNSDYHDDQRLGKNIIQTNIDTYRKLRNTIRW-MLGMLAHDTGN 703

Query: 665 VPQDVKW-IVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIKSI 723
            P       + + ++ RL  +   V    +   F +V   L  F   EL  +Y +  K  
Sbjct: 704 EPSLADMPALEQLMLHRLTELDQVVREAYDAFNFKEVVRQLTNFSNAELSSFYFDIRKDS 763

Query: 724 LNQKDSELVSETLSCFSYVLYNVCKLL----HPIIPFVTEDLYSHVSPQ 768
           L   DS    + LS  + V+  +C+ L     PI+PF  E+ +  ++P+
Sbjct: 764 L-YCDSPSSLKRLSSIA-VIRILCRHLIIWIAPILPFTAEEAWLSLNPE 810

>gi|254780802|ref|YP_003065215.1| leucyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 869 Back     alignment
 Score =  109 bits (273), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 188/865 (21%), Positives = 319/865 (36%), Gaps = 232/865 (26%)

Query: 46  PNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLT 105
           P  +G++HMGH  N  I D++ RF R  G +VL   G D  G+                 
Sbjct: 43  PYPSGNIHMGHLRNYVIGDVVARFMRASGYSVLHPMGWDAFGMPA--------------- 87

Query: 106 REDIGRDAFIE-KVWEWKKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVL 164
            E+  R+  +  K+W +  ++   +  QL+ +G S DWS++  T D    +  +  F+  
Sbjct: 88  -ENAAREHNVHPKMWTY--QNIKVMRKQLQSIGLSIDWSKDFATCDVDYYHCQQLLFLDF 144

Query: 165 YKDGLIYRDKRIVNWDPSLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDD-- 222
            K  +I R    VNWDP  +T +++ +VI    +G  W    P+ +    +   K  D  
Sbjct: 145 MKHNVIVRKTAQVNWDPVEQTVLANEQVI----NGRGWRSDAPVEQRSLPQWFFKISDLS 200

Query: 223 ----------------------------DAKPIDWEVR-------DYIIVSTTRPETMFG 247
                                       +   I WE+        + I+V TTRPET+FG
Sbjct: 201 QELLDSIETLSEWPEKVKIMQKNWIGRSEGMEIRWEIVSNTIDQIEEILVYTTRPETIFG 260

Query: 248 D--VAIAV--------HPDDYRYKELIG----KYATLPIVGR------------------ 275
              +AIAV          D+   KE       K  +L ++ +                  
Sbjct: 261 ASFIAIAVDHSISEKLSCDNTDIKEFCDEEKQKGTSLSVLDKTEKKGIYTGIHVKHPLNP 320

Query: 276 --LIPIVSDVYPDPEFGDGAVKVTPAHDFNDFEIAKRHGLGFINILTPEAKIFLSENESF 333
             +IP+    +    +G GA+   P  D  D + AK++GL  I I+    K  ++ ++  
Sbjct: 321 NVVIPVYIANFVFMNYGTGAIFGCPFADQRDMDFAKKYGLPIIPIM----KRSINHSQDI 376

Query: 334 LENIVLSDEARNIFSEFEGLDCFAARSKIVSLLEKSNLLDKTDSYRHIVPHCERSGVTIE 393
            E    S +   I S F  LD                 +  T++ + ++ H E+  +   
Sbjct: 377 EEGKAFSGDGIMINSSF--LDG----------------MTNTEALQAVMSHLEKQNIKNS 418

Query: 394 PCITEQWYLDAKVLAESAIRSAKNGCLSFIPQSWDKSYYEWLENIQPWCISRQIWWGHQI 453
           P    +                    ++F               ++ WCISRQ  WG  I
Sbjct: 419 PIGKRK--------------------INF--------------RLRDWCISRQRSWGCPI 444

Query: 454 PVWYSPDGKLFVENTED--AALRSAIDYYLSQ---DNDMTVKVRKMIKDGNISDLLKRDE 508
           PV +     +     ED    L   +D+ L     +N  T K    +K G  S+ L R+ 
Sbjct: 445 PVIHCQKCGIVELPKEDLPVQLPEDLDFTLPGNPLENHPTWKKIFCVKCG--SEAL-RET 501

Query: 509 DVLDTWFSSALWPFASLGWPEQTAEL-----KTYYPTSVLVTGFD--ILFFWVARMMMMG 561
           D +DT+  S+ W +     P     +     + ++P    + G +  +L    AR     
Sbjct: 502 DTMDTFVDSS-WYYMRYMTPHAKDPINKELVRQWFPVDQYIGGIEHAVLHLLYARFFAHI 560

Query: 562 LYFMKDAEGKGIEPFHIVYMHALV-----------------------RDKNGQ------- 591
           L  +   E    EPF  ++   +V                       R+  G+       
Sbjct: 561 LKKIGYIEID--EPFKRLFTQGMVVHETYYQLEGIKKKYLKPDEVILRNIEGENCAFRLS 618

Query: 592 -----------KMSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYR 640
                      KMSKSK NV+DP+ VI  YGAD  R +    +   RDI    + +    
Sbjct: 619 DNSKVVIGPLEKMSKSKKNVIDPMKVIKSYGADTARLFVLSDSPPDRDIIWSNKGVDSTY 678

Query: 641 NFITKFWNAIRFSKMKNARHSVSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDV 700
            FI + W  I  +K        S   +D+       +I +    +  +    +N  FN  
Sbjct: 679 QFIQQIWRLIYNAK---DELQTSSTKKDIS------LISKSTKFLERIEENYQNLSFNKA 729

Query: 701 SAVLYRFVWDELCDWYVEFIKSILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTED 760
            A ++     EL +   + +  I  +K +   ++ +S   Y+L  +  ++ P+IP + E+
Sbjct: 730 VANIH-----ELVNVISKPLMEIAKKKSN---ADRISTIRYILEKLIIMMSPMIPHLAEE 781

Query: 761 LYSHVSPQDDMDKQGLLCHAQWPSL 785
            +        +   GL+   +WP L
Sbjct: 782 CWQL------LGNAGLVAQQKWPKL 800

>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 16/96 (16%)

Query: 537 YYPTSVLVTGFDILFF----WVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQK 592
           ++P  + V G DIL F    W A ++   L   K            V+ H  +  K G+K
Sbjct: 255 FWPADLHVIGKDILRFHAIYWPAFLLSANLPLPKK-----------VFSHGFILHK-GEK 302

Query: 593 MSKSKGNVVDPIDVIDQYGADALRFYFSIMAVQGRD 628
           +SKS GNV+DPI+VI++ G DALR++       G+D
Sbjct: 303 ISKSLGNVIDPIEVIEEVGVDALRYFLVREIACGKD 338

>gi|255764461|ref|YP_003064629.2| methionyl-tRNA synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 511 Back     alignment
 Score = 42.0 bits (97), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 30/87 (34%), Positives = 44/87 (50%), Gaps = 16/87 (18%)

Query: 42  AMPPPNVTGSLHMGHAFNTTIQDIMIRFERMRGKNVLWQPGTD-----------HAGIAT 90
           A+  PN     H+GHA+   I D++ RF R+ G +VL+  GTD           +AG+ T
Sbjct: 12  AIAYPNAQP--HIGHAYEMIIADVLARFHRLDGLDVLFTTGTDEHGQKIAKAAQNAGVTT 69

Query: 91  QITVE--SRLFAQSSLTREDIGRDAFI 115
           ++ V+  SR F   +    DI  D FI
Sbjct: 70  KVFVDQNSRNFRDMADVL-DISYDDFI 95

Close Homologs Detected BLAST or PSI-BLAST in the First 2 Iterations

IdentityAlignment graphLength Definition Round E-value
Target947 valyl-tRNA synthetase [Candidatus Liberibacter asiaticu
315122642945 valyl-tRNA synthetase [Candidatus Liberibacter solanace 1 0.0
222085774947 valyl-tRNA synthetase [Agrobacterium radiobacter K84] L 1 0.0
222148981947 valyl-tRNA synthetase [Agrobacterium vitis S4] Length = 1 0.0
227821920947 valyl-tRNA synthetase [Sinorhizobium fredii NGR234] Len 1 0.0
241204404947 valyl-tRNA synthetase [Rhizobium leguminosarum bv. trif 1 0.0
116251795947 valyl-tRNA synthetase [Rhizobium leguminosarum bv. vici 1 0.0
150396370947 valyl-tRNA synthetase [Sinorhizobium medicae WSM419] Le 1 0.0
307317033947 valyl-tRNA synthetase [Sinorhizobium meliloti AK83] Len 1 0.0
15965269947 valyl-tRNA synthetase [Sinorhizobium meliloti 1021] Len 1 0.0
190891500947 valyl-tRNA synthetase [Rhizobium etli CIAT 652] Length 1 0.0
>gi|315122642|ref|YP_004063131.1| valyl-tRNA synthetase [Candidatus Liberibacter solanacearum CLso-ZC1] Length = 945 Back     alignment and organism information
 Score = 1553 bits (4021), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 723/944 (76%), Positives = 844/944 (89%), Gaps = 1/944 (0%)

Query: 2   MIDKTYDFAFIEQKSVEKWNSVDAFRIDVAPKLGSGVFCIAMPPPNVTGSLHMGHAFNTT 61
           MIDKTY+FA +EQKS EKW+S+DAFR+    K  S  FCI MPPPNVTGSLHMGHAFN+ 
Sbjct: 1   MIDKTYNFASVEQKSAEKWDSIDAFRMGANAKSDSESFCIVMPPPNVTGSLHMGHAFNSV 60

Query: 62  IQDIMIRFERMRGKNVLWQPGTDHAGIATQITVESRLFAQSSLTREDIGRDAFIEKVWEW 121
           IQDIMIRFERMRGKNVLWQPG DHAGIATQI VE +L A+SSLTR+DIGR AFIEKVW+W
Sbjct: 61  IQDIMIRFERMRGKNVLWQPGMDHAGIATQIMVERQLSAESSLTRKDIGRKAFIEKVWDW 120

Query: 122 KKESGGSILSQLKRLGASCDWSRERFTMDEGMSNAVRNAFVVLYKDGLIYRDKRIVNWDP 181
           KK+SG SILSQLK++GASCDWSRERFTMD+GMS +V  AFV LYK+GLIY+DKRI NWDP
Sbjct: 121 KKKSGSSILSQLKKIGASCDWSRERFTMDQGMSKSVIEAFVSLYKEGLIYKDKRISNWDP 180

Query: 182 SLKTSVSDLEVIQKEVDGNLWYVRYPLVEGVTYRHPIKFDDDAKPIDWEVRDYIIVSTTR 241
            L TSVSDLEV+Q EVDG+LWY+RYPL++G++YRHPI+FDDDAKP++WEVRDYI+V+TTR
Sbjct: 181 YLGTSVSDLEVVQNEVDGSLWYIRYPLMDGISYRHPIEFDDDAKPVEWEVRDYIVVATTR 240

Query: 242 PETMFGDVAIAVHPDDYRYKELIGKYATLPIVGRLIPIVSDVYPDPEFGDGAVKVTPAHD 301
           PET+FGDVAI VHP+D RYKE++GKY  LPIVGR IPI+ D YP+P FG GAVKVTPAHD
Sbjct: 241 PETIFGDVAIVVHPEDCRYKEIVGKYTALPIVGRRIPIIFDSYPNPNFGAGAVKVTPAHD 300

Query: 302 FNDFEIAKRHGLGFINILTPEAKIFLSENESFLENIVLSDEARNIFSEFEGLDCFAARSK 361
           FNDFEIAKR+GLGFINILT +AK+ L ENE FL+++V+SDE +NIFSEFEGLDC  ARSK
Sbjct: 301 FNDFEIAKRYGLGFINILTSQAKLCLLENEFFLKDLVISDETKNIFSEFEGLDCLTARSK 360

Query: 362 IVSLLEKSNLLDKTDSYRHIVPHCERSGVTIEPCITEQWYLDAKVLAESAIRSAKNGCLS 421
           IV+LLE++ LLDK   Y+H+VP CERSG+TIEP ITEQWYL+A VLA+ AIRS KN   S
Sbjct: 361 IVALLEQTGLLDKITPYKHVVPCCERSGITIEPRITEQWYLNAAVLAKPAIRSVKNSLTS 420

Query: 422 FIPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYSPDGKLFVENTEDAALRSAIDYYL 481
           F+PQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWY P+GKLFVE+TE AAL SAIDYYL
Sbjct: 421 FVPQSWDKSYYEWLENIQPWCISRQIWWGHQIPVWYGPEGKLFVEHTESAALNSAIDYYL 480

Query: 482 SQDNDMTVKVRKMIKDGNISDLLKRDEDVLDTWFSSALWPFASLGWPEQTAELKTYYPTS 541
           SQ+NDMT+ V+KMIK+GNI+DLLKRDEDVLDTWFSSALWPFASLGWPE+T ELKTYYPT+
Sbjct: 481 SQNNDMTLIVQKMIKEGNIADLLKRDEDVLDTWFSSALWPFASLGWPEKTIELKTYYPTN 540

Query: 542 VLVTGFDILFFWVARMMMMGLYFMKDAEGKGIEPFHIVYMHALVRDKNGQKMSKSKGNVV 601
           V+VTGFDILFFW+ARMMMMGL+FMKD+E KGIEPF IVYMHALVRDK GQKMSKSKGNVV
Sbjct: 541 VVVTGFDILFFWIARMMMMGLHFMKDSENKGIEPFRIVYMHALVRDKYGQKMSKSKGNVV 600

Query: 602 DPIDVIDQYGADALRFYFSIMAVQGRDINLDLERIAGYRNFITKFWNAIRFSKMKNARHS 661
           DPID+I+QYGADALRFYFSIMAVQGRDI LDL R+ GYRNFITKFWNA+RF+++KNA+HS
Sbjct: 601 DPIDLINQYGADALRFYFSIMAVQGRDIKLDLARVVGYRNFITKFWNAVRFAEIKNAKHS 660

Query: 662 VSFVPQDVKWIVNKWIIKRLATVINDVTVGMENHRFNDVSAVLYRFVWDELCDWYVEFIK 721
           VSFVPQ+VK ++NKWI+ RL+TVIN+VT G+ENHRFND+SA+LYRFVW ELCDWYVEFIK
Sbjct: 661 VSFVPQNVKCVINKWIVVRLSTVINEVTTGIENHRFNDISAILYRFVWHELCDWYVEFIK 720

Query: 722 SILNQKDSELVSETLSCFSYVLYNVCKLLHPIIPFVTEDLYSHVSPQDDMDKQGLLCHAQ 781
           SILNQ DS+L+SETLSCFSYVLYNVCKLLHPIIPFVTE+LY+++SP D +DK+  LCHAQ
Sbjct: 721 SILNQDDSDLISETLSCFSYVLYNVCKLLHPIIPFVTEELYAYISP-DGIDKKEFLCHAQ 779

Query: 782 WPSLIIDDSESIEEVNWIIDLISKVRSIRTEMNVPLKAVVPLVFANIDAHVRKRLECHKC 841
           WPSL+ ++S ++EEV+WII LIS++RS+R EMNVPLKAVVPLVF N+D  +R+RL  H+ 
Sbjct: 780 WPSLVFEESSAVEEVDWIIRLISEIRSVRIEMNVPLKAVVPLVFVNVDLSMRERLISHQY 839

Query: 842 IIDRLSSGNIIFADCPPDRSIQIILDGMVLFLAIGDFVDFVKERSRLKKSLEKVLDELSS 901
           II+RLSSGNI+F+D  P+RSIQI+LDGM+ FL IGDFVDF KE+SRL+KSL KVLDELS 
Sbjct: 840 IINRLSSGNIVFSDSSPERSIQIVLDGMIFFLKIGDFVDFSKEKSRLEKSLTKVLDELSI 899

Query: 902 IKKKLENNQFVEKAPPSILQAEKERFSKVEKKRISLENSLERIR 945
           +KK+L ++ F+EKA P ILQ EKE+ SK+EKK+ SL+ SL RI+
Sbjct: 900 VKKRLAHSNFIEKAHPDILQLEKEKLSKIEKKKQSLDISLARIK 943


Species: Candidatus Liberibacter solanacearum
Genus: Candidatus Liberibacter
Family: Rhizobiaceae
Order: Rhizobiales
Class: Alphaproteobacteria
Phylum: Proteobacteria
Superkingdom: Bacteria
>gi|222085774|ref|YP_002544304.1| valyl-tRNA synthetase [Agrobacterium radiobacter K84] Length = 947 Back     alignment and organism information
>gi|222148981|ref|YP_002549938.1| valyl-tRNA synthetase [Agrobacterium vitis S4] Length = 947 Back     alignment and organism information
>gi|227821920|ref|YP_002825890.1| valyl-tRNA synthetase [Sinorhizobium fredii NGR234] Length = 947 Back     alignment and organism information
>gi|241204404|ref|YP_002975500.1| valyl-tRNA synthetase [Rhizobium leguminosarum bv. trifolii WSM1325] Length = 947 Back     alignment and organism information
>gi|116251795|ref|YP_767633.1| valyl-tRNA synthetase [Rhizobium leguminosarum bv. viciae 3841] Length = 947 Back     alignment and organism information
>gi|150396370|ref|YP_001326837.1| valyl-tRNA synthetase [Sinorhizobium medicae WSM419] Length = 947 Back     alignment and organism information
>gi|307317033|ref|ZP_07596474.1| valyl-tRNA synthetase [Sinorhizobium meliloti AK83] Length = 947 Back     alignment and organism information
>gi|15965269|ref|NP_385622.1| valyl-tRNA synthetase [Sinorhizobium meliloti 1021] Length = 947 Back     alignment and organism information
>gi|190891500|ref|YP_001978042.1| valyl-tRNA synthetase [Rhizobium etli CIAT 652] Length = 947 Back     alignment and organism information

Conserved Domains in CDD Database
Detected by RPS-BLAST and HHsearch

Conserved Domains in CDD Database Detected by RPS-BLAST

IdentityAlignment graphLength Definition E-value
Target947 valyl-tRNA synthetase [Candidatus Liberibacter asiaticu
KOG0432995 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Trans 0.0
PRK05729874 PRK05729, valS, valyl-tRNA synthetase; Reviewed 0.0
TIGR00422861 TIGR00422, valS, valyl-tRNA synthetase 0.0
PTZ00419995 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; 0.0
PRK14900 1052 PRK14900, valS, valyl-tRNA synthetase; Provisional 0.0
PLN02943958 PLN02943, PLN02943, aminoacyl-tRNA ligase 0.0
PLN023811066 PLN02381, PLN02381, valyl-tRNA synthetase 0.0
KOG0434 1070 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [T 1e-60
TIGR00395938 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal 1e-40
COG0525877 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribo 0.0
pfam00133606 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, 0.0
KOG0435876 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Tran 2e-35
PRK13208800 PRK13208, valS, valyl-tRNA synthetase; Reviewed 1e-139
COG0060933 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, 1e-95
PRK06039975 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed 9e-88
COG0495814 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, rib 2e-57
PLN02882 1159 PLN02882, PLN02882, aminoacyl-tRNA ligase 4e-49
TIGR00392861 TIGR00392, ileS, isoleucyl-tRNA synthetase 1e-97
PTZ00427 1205 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; P 2e-36
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 3e-92
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 2e-40
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 7e-31
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 8e-12
PLN029591084 PLN02959, PLN02959, aminoacyl-tRNA ligase 5e-07
cd00817382 cd00817, ValRS_core, catalytic core domain of valyl-tRN 6e-74
cd00668312 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain 8e-33
cd00818338 cd00818, IleRS_core, catalytic core domain of isoleucyl 4e-19
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 3e-17
pfam09334388 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) 3e-08
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 1e-07
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 2e-07
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 7e-07
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 4e-06
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 2e-05
KOG0433937 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [T 1e-59
PRK05743912 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed 2e-57
PRK13804961 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional 2e-49
cd07962135 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of 4e-40
cd07375117 cd07375, Anticodon_Ia_like, Anticodon-binding domain of 6e-07
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 6e-34
TIGR00396842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 2e-32
PLN02563963 PLN02563, PLN02563, aminoacyl-tRNA ligase 2e-26
PLN02843974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 7e-32
pfam08264148 pfam08264, Anticodon_1, Anticodon-binding domain 9e-30
COG0143558 COG0143, MetG, Methionyl-tRNA synthetase [Translation, 6e-21
PRK12268556 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed 7e-14
TIGR00398530 TIGR00398, metG, methionyl-tRNA synthetase 5e-12
PRK12300897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 7e-21
PRK00390805 PRK00390, leuS, leucyl-tRNA synthetase; Validated 3e-20
PRK12300897 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed 4e-19
PRK11893511 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed 4e-19
KOG0436578 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [T 7e-13
TIGR00396842 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacteri 5e-18
cd07961183 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domai 5e-16
cd07960180 cd07960, Anticodon_Ia_Ile_BEm, Anticodon-binding domain 2e-12
PLN02843974 PLN02843, PLN02843, isoleucyl-tRNA synthetase 8e-16
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 6e-15
PLN02224616 PLN02224, PLN02224, methionine-tRNA ligase 6e-08
cd00812314 cd00812, LeuRS_core, catalytic core domain of leucyl-tR 2e-11
COG0215464 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, 2e-07
cd00674353 cd00674, LysRS_core_class_I, catalytic core domain of c 2e-06
PRK00260463 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated 4e-06
PRK00133673 PRK00133, metG, methionyl-tRNA synthetase; Reviewed 2e-05
PRK00750510 PRK00750, lysK, lysyl-tRNA synthetase; Reviewed 4e-05
pfam01921355 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K) 2e-04
COG1384521 COG1384, LysS, Lysyl-tRNA synthetase (class I) [Transla 5e-04
TIGR00435465 TIGR00435, cysS, cysteinyl-tRNA synthetase 6e-04
cd00672213 cd00672, CysRS_core, catalytic core domain of cysteinyl 7e-04
PRK01611507 PRK01611, argS, arginyl-tRNA synthetase; Reviewed 0.002
cd00814319 cd00814, MetRS_core, catalytic core domain of methionin 3e-11
pfam1045866 pfam10458, Val_tRNA-synt_C, Valyl tRNA synthetase tRNA 6e-10
KOG04371080 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Tran 7e-10
PLN02563963 PLN02563, PLN02563, aminoacyl-tRNA ligase 2e-09
KOG04371080 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Tran 7e-07
PLN02959 1084 PLN02959, PLN02959, aminoacyl-tRNA ligase 1e-05
KOG0436578 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [T 0.001
PRK12267648 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed 2e-04
PLN02224616 PLN02224, PLN02224, methionine-tRNA ligase 4e-04
>gnl|CDD|35653 KOG0432, KOG0432, KOG0432, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180225 PRK05729, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161872 TIGR00422, valS, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|185605 PTZ00419, PTZ00419, valyl-tRNA synthetase-like protein; Provisional Back     alignment and domain information
>gnl|CDD|184893 PRK14900, valS, valyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|166584 PLN02943, PLN02943, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|178007 PLN02381, PLN02381, valyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|35655 KOG0434, KOG0434, KOG0434, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161856 TIGR00395, leuS_arch, leucyl-tRNA synthetase, archaeal and cytosolic family Back     alignment and domain information
>gnl|CDD|30871 COG0525, ValS, Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|143905 pfam00133, tRNA-synt_1, tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>gnl|CDD|35656 KOG0435, KOG0435, KOG0435, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183895 PRK13208, valS, valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30409 COG0060, IleS, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180364 PRK06039, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|30841 COG0495, LeuS, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178470 PLN02882, PLN02882, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|161854 TIGR00392, ileS, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173617 PTZ00427, PTZ00427, isoleucine-tRNA ligase, putative; Provisional Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|185677 cd00817, ValRS_core, catalytic core domain of valyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|185674 cd00668, Ile_Leu_Val_MetRS_core, catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|173909 cd00818, IleRS_core, catalytic core domain of isoleucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|117876 pfam09334, tRNA-synt_1g, tRNA synthetases class I (M) Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|35654 KOG0433, KOG0433, KOG0433, Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|180231 PRK05743, ileS, isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|184337 PRK13804, ileS, isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|153416 cd07962, Anticodon_Ia_Val, Anticodon-binding domain of valyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153408 cd07375, Anticodon_Ia_like, Anticodon-binding domain of class Ia aminoacyl tRNA synthetases and similar domains Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|178436 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|149360 pfam08264, Anticodon_1, Anticodon-binding domain Back     alignment and domain information
>gnl|CDD|30492 COG0143, MetG, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183390 PRK12268, PRK12268, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|161858 TIGR00398, metG, methionyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|178996 PRK00390, leuS, leucyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|183418 PRK12300, leuS, leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|183364 PRK11893, PRK11893, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161857 TIGR00396, leuS_bact, leucyl-tRNA synthetase, eubacterial and mitochondrial family Back     alignment and domain information
>gnl|CDD|153415 cd07961, Anticodon_Ia_Ile_ABEc, Anticodon-binding domain of archaeal, bacterial, and eukaryotic cytoplasmic isoleucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|153414 cd07960, Anticodon_Ia_Ile_BEm, Anticodon-binding domain of bacterial and eukaryotic mitochondrial isoleucyl tRNA synthetases Back     alignment and domain information
>gnl|CDD|178436 PLN02843, PLN02843, isoleucyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information
>gnl|CDD|173906 cd00812, LeuRS_core, catalytic core domain of leucyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|30564 COG0215, CysS, Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|173900 cd00674, LysRS_core_class_I, catalytic core domain of class I lysyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|178951 PRK00260, cysS, cysteinyl-tRNA synthetase; Validated Back     alignment and domain information
>gnl|CDD|178889 PRK00133, metG, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|179109 PRK00750, lysK, lysyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|145212 pfam01921, tRNA-synt_1f, tRNA synthetases class I (K) Back     alignment and domain information
>gnl|CDD|31574 COG1384, LysS, Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|161877 TIGR00435, cysS, cysteinyl-tRNA synthetase Back     alignment and domain information
>gnl|CDD|173899 cd00672, CysRS_core, catalytic core domain of cysteinyl tRNA synthetase Back     alignment and domain information
>gnl|CDD|179308 PRK01611, argS, arginyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|173907 cd00814, MetRS_core, catalytic core domain of methioninyl-tRNA synthetases Back     alignment and domain information
>gnl|CDD|151031 pfam10458, Val_tRNA-synt_C, Valyl tRNA synthetase tRNA binding arm Back     alignment and domain information
>gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178177 PLN02563, PLN02563, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|35658 KOG0437, KOG0437, KOG0437, Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|178544 PLN02959, PLN02959, aminoacyl-tRNA ligase Back     alignment and domain information
>gnl|CDD|35657 KOG0436, KOG0436, KOG0436, Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|183389 PRK12267, PRK12267, methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>gnl|CDD|177869 PLN02224, PLN02224, methionine-tRNA ligase Back     alignment and domain information

Conserved Domains in CDD Database Detected by HHsearch

IdentityAlignment graphLength Definition Probability
Target 947 valyl-tRNA synthetase [Candidatus Liberibacter asiaticu
TIGR00422970 valS valyl-tRNA synthetase; InterPro: IPR002303 The ami 100.0
PRK05729877 valS valyl-tRNA synthetase; Reviewed 100.0
COG0525877 ValS Valyl-tRNA synthetase [Translation, ribosomal stru 100.0
PRK060391042 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
KOG0432995 consensus 100.0
KOG0434 1070 consensus 100.0
PRK13208809 valS valyl-tRNA synthetase; Reviewed 100.0
PRK05743910 ileS isoleucyl-tRNA synthetase; Reviewed 100.0
PRK13804966 ileS isoleucyl-tRNA synthetase; Provisional 100.0
PRK00390822 leuS leucyl-tRNA synthetase; Validated 100.0
TIGR00396916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 100.0
TIGR003951109 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 T 100.0
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 100.0
TIGR00392938 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The 100.0
KOG04371080 consensus 100.0
COG0060933 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal 100.0
KOG0433937 consensus 100.0
KOG0435876 consensus 100.0
pfam00133606 tRNA-synt_1 tRNA synthetases class I (I, L, M and V). O 100.0
cd00817363 ValRS_core This is the catalytic core domain of valine 100.0
cd00818339 IleRS_core This is the catalytic core domain of isoleuc 100.0
pfam09334388 tRNA-synt_1g tRNA synthetases class I (M). This family 100.0
cd00668334 Ile_Leu_Val_MetRS_core This is the catalytic core domai 100.0
cd00812376 LeuRS_core This is the catalytic core domain of leucyl 100.0
cd00814319 MetRS_core This is the catalytic core domain of methion 100.0
PRK12300888 leuS leucyl-tRNA synthetase; Reviewed 100.0
PRK12268558 methionyl-tRNA synthetase; Reviewed 100.0
PRK11893512 methionyl-tRNA synthetase; Reviewed 100.0
PRK12267644 methionyl-tRNA synthetase; Reviewed 100.0
PRK00133666 metG methionyl-tRNA synthetase; Reviewed 100.0
COG0143558 MetG Methionyl-tRNA synthetase [Translation, ribosomal 100.0
TIGR00398573 metG methionyl-tRNA synthetase; InterPro: IPR002304 The 100.0
KOG0436578 consensus 100.0
KOG1247567 consensus 100.0
cd07961183 Anticodon_Ia_Ile_ABEc Anticodon-binding domain of archa 100.0
cd07960180 Anticodon_Ia_Ile_BEm Anticodon-binding domain of bacter 100.0
pfam01406301 tRNA-synt_1e tRNA synthetases class I (C) catalytic dom 100.0
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 98.23
PRK12558461 glutamyl-tRNA synthetase; Provisional 98.2
pfam00749314 tRNA-synt_1c tRNA synthetases class I (E and Q), cataly 98.2
PRK01406467 gltX glutamyl-tRNA synthetase; Reviewed 98.18
PRK12410433 glutamyl-tRNA synthetase; Provisional 98.02
PRK04156566 gltX glutamyl-tRNA synthetase; Provisional 97.9
cd00807238 Gln_GluRS_non_core Glutaminyl-tRNA synthetase (GlnRS) a 97.82
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 97.74
PRK05347556 glutaminyl-tRNA synthetase; Provisional 97.63
COG0008472 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Transla 97.63
cd00418223 GlxRS_core Glutamyl-tRNA synthetase(GluRS)/Glutaminyl-t 97.34
TIGR00463600 gltX_arch glutamyl-tRNA synthetase; InterPro: IPR004526 97.27
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 97.1
TIGR00440564 glnS glutaminyl-tRNA synthetase; InterPro: IPR004514 Th 96.87
cd07962135 Anticodon_Ia_Val Anticodon-binding domain of valyl tRNA 99.97
cd07375117 Anticodon_Ia_like Anticodon-binding domain of class Ia 99.9
cd07958117 Anticodon_Ia_Leu_BEm Anticodon-binding domain of bacter 99.78
cd07956156 Anticodon_Ia_Arg Anticodon-binding domain of arginyl tR 95.41
pfam08264148 Anticodon_1 Anticodon-binding domain. This domain is fo 99.96
PRK00260460 cysS cysteinyl-tRNA synthetase; Validated 99.94
COG0215464 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal 99.85
TIGR03447411 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deo 99.83
PRK12418384 cysteinyl-tRNA synthetase; Provisional 99.83
KOG2007586 consensus 99.75
PRK12451562 arginyl-tRNA synthetase; Reviewed 99.66
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 99.52
cd07959117 Anticodon_Ia_Leu_AEc Anticodon-binding domain of archae 99.71
cd07957129 Anticodon_Ia_Met Anticodon-binding domain of methionyl 99.35
COG0018577 ArgS Arginyl-tRNA synthetase [Translation, ribosomal st 99.71
cd00802142 class_I_aaRS_core Class I amino acyl-tRNA synthetase (a 99.67
cd00672213 CysRS_core This is the catalytic core domain of cystein 99.49
cd00674354 LysRS_core_class_I This is the catalytic core domain of 99.29
PRK00750513 lysK lysyl-tRNA synthetase; Reviewed 99.27
pfam01921355 tRNA-synt_1f tRNA synthetases class I (K). This family 99.23
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 97.39
cd00808239 GluRS_core Descriminating Glutamyl-tRNA synthetase (Glu 96.14
cd02156147 nt_trans nt_trans (nucleotidyl transferase) This superf 93.77
PRK01611570 argS arginyl-tRNA synthetase; Reviewed 99.67
TIGR00456600 argS arginyl-tRNA synthetase; InterPro: IPR001278 The a 99.48
pfam1045866 Val_tRNA-synt_C Valyl tRNA synthetase tRNA binding arm. 99.4
PRK10636638 putative ABC transporter ATP-binding protein; Provision 94.43
PTZ00248324 eukaryotic translation initiation factor 2 alpha subuni 93.02
PRK11147632 ABC transporter ATPase component; Reviewed 92.77
KOG2916304 consensus 91.9
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 98.87
cd00671267 ArgRS_core This is the catalytic core domain of Arginyl 98.47
TIGR00435660 cysS cysteinyl-tRNA synthetase; InterPro: IPR002308 The 96.21
KOG1195567 consensus 95.73
PRK08560333 tyrosyl-tRNA synthetase; Validated 93.1
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 91.2
pfam00750345 tRNA-synt_1d tRNA synthetases class I (R). Other tRNA s 98.04
PRK12282333 tryptophanyl-tRNA synthetase II; Reviewed 94.83
PRK00574489 gltX glutamyl-tRNA synthetase; Reviewed 94.32
PRK12558461 glutamyl-tRNA synthetase; Provisional 91.59
TIGR00396 916 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 T 98.01
PRK00390822 leuS leucyl-tRNA synthetase; Validated 96.47
KOG0435 876 consensus 95.4
COG1384521 LysS Lysyl-tRNA synthetase (class I) [Translation, ribo 97.32
KOG4426656 consensus 96.86
PRK12284436 tryptophanyl-tRNA synthetase; Reviewed 96.4
PRK12283398 tryptophanyl-tRNA synthetase; Reviewed 96.06
PRK00927325 tryptophanyl-tRNA synthetase; Reviewed 96.03
PRK12410433 glutamyl-tRNA synthetase; Provisional 90.08
PRK13354405 tyrosyl-tRNA synthetase; Provisional 96.89
cd00805268 TyrRS_core Tyrosinyl-tRNA synthetase (TyrRS) catalytic 96.87
PRK12556328 tryptophanyl-tRNA synthetase; Provisional 95.8
pfam00579291 tRNA-synt_1b tRNA synthetases class I (W and Y). 95.62
cd00395274 Tyr_Trp_RS_core Tyrosinyl-tRNA synthetase (TyrRS)/Trypt 95.61
PRK05912402 tyrosyl-tRNA synthetase; Validated 95.21
COG0162401 TyrS Tyrosyl-tRNA synthetase [Translation, ribosomal st 94.75
TIGR00464513 gltX_bact glutamyl-tRNA synthetase; InterPro: IPR004527 93.54
PTZ00126399 tyrosyl-tRNA synthetase; Provisional 92.32
COG0495814 LeuS Leucyl-tRNA synthetase [Translation, ribosomal str 96.87
KOG1147712 consensus 96.46
KOG1149524 consensus 95.93
KOG1148764 consensus 95.44
cd00806282 TrpRS_core Tryptophanyl-tRNA synthetase (TrpRS) catalyt 94.99
PRK08560333 tyrosyl-tRNA synthetase; Validated 94.16
COG0180314 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosom 94.05
PRK05710299 glutamyl-Q tRNA(Asp) synthetase; Reviewed 90.5
>TIGR00422 valS valyl-tRNA synthetase; InterPro: IPR002303 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>PRK05729 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>KOG0432 consensus Back     alignment and domain information
>KOG0434 consensus Back     alignment and domain information
>PRK13208 valS valyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional Back     alignment and domain information
>PRK00390 leuS leucyl-tRNA synthetase; Validated Back     alignment and domain information
>TIGR00396 leuS_bact leucyl-tRNA synthetase; InterPro: IPR002302 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>TIGR00395 leuS_arch leucyl-tRNA synthetase; InterPro: IPR004493 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00392 ileS isoleucyl-tRNA synthetase; InterPro: IPR002301 The aminoacyl-tRNA synthetases (6 Back     alignment and domain information
>KOG0437 consensus Back     alignment and domain information
>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG0433 consensus Back     alignment and domain information
>KOG0435 consensus Back     alignment and domain information
>pfam00133 tRNA-synt_1 tRNA synthetases class I (I, L, M and V) Back     alignment and domain information
>cd00817 ValRS_core This is the catalytic core domain of valine amino-acyl tRNA synthetases (ValRS) Back     alignment and domain information
>cd00818 IleRS_core This is the catalytic core domain of isoleucine amino-acyl tRNA synthetases (IleRS) Back     alignment and domain information
>pfam09334 tRNA-synt_1g tRNA synthetases class I (M) Back     alignment and domain information
>cd00668 Ile_Leu_Val_MetRS_core This is the catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases Back     alignment and domain information
>cd00812 LeuRS_core This is the catalytic core domain of leucyl tRNA synthetase (LeuRS) Back     alignment and domain information
>cd00814 MetRS_core This is the catalytic core domain of methionine tRNA synthetase (MetRS) Back     alignment and domain information
>PRK12300 leuS leucyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12268 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK11893 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK12267 methionyl-tRNA synthetase; Reviewed Back     alignment and domain information
>PRK00133 metG methionyl-tRNA synthetase; Reviewed Back     alignment and domain information